[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for atum0:accD.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2f9yB.bssp"
#ERROR : Can't open dsspfile "2f9iB.bssp"
#ERROR : Can't open dsspfile "2f9iD.bssp"
#ERROR : Can't open dsspfile "1x0uA.bssp"
#ERROR : Can't open dsspfile "2bzrF.bssp"
#ERROR : Can't open dsspfile "2bzrD.bssp"
#ERROR : Can't open dsspfile "2bzrC.bssp"
#ERROR : Can't open dsspfile "2bzrB.bssp"
#ERROR : Can't open dsspfile "2bzrA.bssp"
#ERROR : Can't open dsspfile "2a7sA.bssp"
#ERROR : Can't open dsspfile "1xnwA.bssp"
#ERROR : Can't open dsspfile "1xnvA.bssp"
#ERROR : Can't open dsspfile "1vrgA.bssp"
#ERROR : Can't open dsspfile "1on9E.bssp"
#ERROR : Can't open dsspfile "1on9D.bssp"
#ERROR : Can't open dsspfile "1on9C.bssp"
#ERROR : Can't open dsspfile "1on3E.bssp"
#ERROR : Can't open dsspfile "1on3D.bssp"
#ERROR : Can't open dsspfile "1on3C.bssp"
#ERROR : Can't open dsspfile "1on3B.bssp"
#ERROR : Can't open dsspfile "1on3A.bssp"

## Summary of PDB Search
:298
    1e-64  48%  2f9yB  [x.x.x] ACETYL-COENZYME A CARBOXYLASE CARBOXYL
    8e-55  41%  2f9iB  [x.x.x] ACETYL-COENZYME A CARBOXYLASE CARBOXYL
    4e-54  41%  2f9iD  [x.x.x] ACETYL-COENZYME A CARBOXYLASE CARBOXYL
    5e-14  27%  1x0uA  [x.x.x] HYPOTHETICAL METHYLMALONYL-COA DECARBOXYLASE
    2e-10  30%  2bzrF  [x.x.x] PROPIONYL-COA CARBOXYLASE BETA CHAIN 5
    2e-10  30%  2bzrD  [x.x.x] PROPIONYL-COA CARBOXYLASE BETA CHAIN 5
    2e-10  30%  2bzrC  [x.x.x] PROPIONYL-COA CARBOXYLASE BETA CHAIN 5
    2e-10  30%  2bzrB  [x.x.x] PROPIONYL-COA CARBOXYLASE BETA CHAIN 5
    2e-10  30%  2bzrA  [x.x.x] PROPIONYL-COA CARBOXYLASE BETA CHAIN 5
    2e-10  30%  2a7sA  [x.x.x] PROBABLE PROPIONYL-COA CARBOXYLASE BETA CHAIN 5
    6e-09  33%  1xnwA  [c.14.1 - c.14.1] PROPIONYL-COA CARBOXYLASE COMPLEX B SUBUNIT
    6e-09  33%  1xnvA  [c.14.1 - c.14.1] PROPIONYL-COA CARBOXYLASE COMPLEX B SUBUNIT
    6e-09  30%  1vrgA  [x.x.x] PROPIONYL-COA CARBOXYLASE, BETA SUBUNIT
    2e-08  38%  1on9E  [c.14.1 - c.14.1] METHYLMALONYL-COA CARBOXYLTRANSFERASE 12S
    2e-08  38%  1on9D  [c.14.1 - c.14.1] METHYLMALONYL-COA CARBOXYLTRANSFERASE 12S
    2e-08  38%  1on9C  [c.14.1 - c.14.1] METHYLMALONYL-COA CARBOXYLTRANSFERASE 12S
    2e-08  38%  1on3E  [c.14.1 - c.14.1] METHYLMALONYL-COA CARBOXYLTRANSFERASE 12S
    2e-08  38%  1on3D  [c.14.1 - c.14.1] METHYLMALONYL-COA CARBOXYLTRANSFERASE 12S
    2e-08  38%  1on3C  [c.14.1 - c.14.1] METHYLMALONYL-COA CARBOXYLTRANSFERASE 12S
    2e-08  38%  1on3B  [c.14.1 - c.14.1] METHYLMALONYL-COA CARBOXYLTRANSFERASE 12S
    2e-08  38%  1on3A  [c.14.1 - c.14.1] METHYLMALONYL-COA CARBOXYLTRANSFERASE 12S
:298

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxPENLWIKCPETGEMVFHKDLEDNKWVIPASGYHMKMPAKARLADLFDG
2f9yB           -------------------------VWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMTARNRLHXXXXX
2f9iB           ----------------------PAGIMTKCPKCKKIMYTKELAENLNVCFNCDHHIALTAYKRIEAISDE
2f9iD           ----------------------------KCPKCKKIMYTKELAENLNVCFNCDHHIALTAYKRIEAISDE
1x0uA           --------------------------------------------------------KLTARERLALLFDD
2bzrF           ----------------------------------------------------------------------
2bzrD           ----------------------------------------------------------------------
2bzrC           ----------------------------------------------------------------------
2bzrB           ----------------------------------------------------------------------
2bzrA           ----------------------------------------------------------------------
2a7sA           ----------------------------------------------------------------------
1xnwA           ----------------------------------------------------------------------
1xnvA           ----------------------------------------------------------------------
1vrgA           ----------------------------------------------------------------------
1on9E           ----------------------------------------------------------------------
1on9D           ----------------------------------------------------------------------
1on9C           ----------------------------------------------------------------------
1on3E           ----------------------------------------------------------------------
1on3D           ----------------------------------------------------------------------
1on3C           ----------------------------------------------------------------------
1on3B           ----------------------------------------------------------------------
1on3A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GIYEALAQPKVAQDPLKFRDSKKYTDRLRDSRAKTEQEDTILAGVGLLKGLKIVAVVHEFQFMAGSLGIA
2f9yB           XXXXXXXXXXXPKDVLKFRDSKKYKQK------ETGEKDALVVMKGTLYGMPVVAAAFEFAFMGGSMGSV
2f9iB           GSFTEFDKGMTSANPLDF---PSYLEKIEKDQQKTGLKEAVVTGTAQLDGMKFGVAVMDSRFRMGSMGSV
2f9iD           GSFTEFDKGMTSANPLDF---PSYLEKIEKDQQKTGLKEAVVTGTAQLDGMKFGVAVMDSRFRMGSMGSV
1x0uA           GKFNEIMTFATTRATEFGLDKQRFYG------------DGVVTGWGKVDGRTVFAYAQDFTVLGGSLGET
2bzrF           --------------------------------------DGVVTGYGTIDGRDVCIFSQDATVFGGSLGEV
2bzrD           --------------------------------------DGVVTGYGTIDGRDVCIFSQDATVFGGSLGEV
2bzrC           --------------------------------------DGVVTGYGTIDGRDVCIFSQDATVFGGSLGEV
2bzrB           --------------------------------------DGVVTGYGTIDGRDVCIFSQDATVFGGSLGEV
2bzrA           --------------------------------------DGVVTGYGTIDGRDVCIFSQDATVFGGSLGEV
2a7sA           --------------------------------------DGVVTGYGTIDGRDVCIFSQDATVFGGSLGEV
1xnwA           ----------------------------------------------------------DFTVFGGALGEV
1xnvA           ----------------------------------------------------------DFTVFGGALGEV
1vrgA           --------------------------------------DGVITGVGEINGRKVAVFSQDFT-VGGSLGEH
1on9E           --------------------------------------DGVVTGRGTILGRPVHAASQDFTVMGGSAGET
1on9D           --------------------------------------DGVVTGRGTILGRPVHAASQDFTVMGGSAGET
1on9C           --------------------------------------DGVVTGRGTILGRPVHAASQDFTVMGGSAGET
1on3E           --------------------------------------DGVVTGRGTILGRPVHAASQDFTVMGGSAGET
1on3D           --------------------------------------DGVVTGRGTILGRPVHAASQDFTVMGGSAGET
1on3C           --------------------------------------DGVVTGRGTILGRPVHAASQDFTVMGGSAGET
1on3B           --------------------------------------DGVVTGRGTILGRPVHAASQDFTVMGGSAGET
1on3A           --------------------------------------DGVVTGRGTILGRPVHAASQDFTVMGGSAGET


                         +         .         .         .         .         *         .:210
query           AGEAIVKAFERAISERCPLVMFPASGGARMQEGILSLMQLPRTTVAVNMLKEAGMPYIVVLTNPTTGGVT
2f9yB           VGARFVRAVEQALEDNCPLICFSASGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVS
2f9iB           IGEKICRIIDYCTENRLPFILFSASGGARMQEGIISLMQMGKTSVSLKRHSDAGLLYISYLTHPTTGGVS
2f9iD           IGEKICRIIDYCTENRLPFILFSASGGARMQEGIISLMQMGKTSVSLKRHSDAGLLYISYLTHPTTGGVS
1x0uA           HANKIVRAYELALKVGAPVVGINDSGGARIQEGALSL-EGYGAVFKMNVMASGVIPQITIMAGPAAGGAV
2bzrF           YGEKIVKVQELAIKTGRPLIGINDGAGARIQEGVVSLGLYSR-IFRNNILASGVIPQISLIMGAAAGGHV
2bzrD           YGEKIVKVQELAIKTGRPLIGINDGAGARIQEGVVSLGLYSR-IFRNNILASGVIPQISLIMGAAAGGHV
2bzrC           YGEKIVKVQELAIKTGRPLIGINDGAGARIQEGVVSLGLYSR-IFRNNILASGVIPQISLIMGAAAGGHV
2bzrB           YGEKIVKVQELAIKTGRPLIGINDGAGARIQEGVVSLGLYSR-IFRNNILASGVIPQISLIMGAAAGGHV
2bzrA           YGEKIVKVQELAIKTGRPLIGINDGAGARIQEGVVSLGLYSR-IFRNNILASGVIPQISLIMGAAAGGHV
2a7sA           YGEKIVKVQELAIKTGRPLIGINDGAGARIQEGVVSLGLYSR-IFRNNILASGVIPQISLIMGAAAGGHV
1xnwA           YGQKIVKVMDFALKTGCPVVGINDSGGARIQEGVASLGAFRRNTHASGVI-----PQISLVVGPCAGGAV
1xnvA           YGQKIVKVMDFALKTGCPVVGINDSGGARIQEGVASLGAFRRNTHASGVI-----PQISLVVGPCAGGAV
1vrgA           A-KKIVKLLDLAL-KGIPVIGINDSGGARIQEGVDALAGYGEIFLR-NTLASGVVPQITVIAGPCAGGAV
1on9E           QSTKVVETMEQALLTGTPFLFFYDSGGARIQEGIDSL---------------------------------
1on9D           QSTKVVETMEQALLTGTPFLFFYDSGGARIQEGIDSL---------------------------------
1on9C           QSTKVVETMEQALLTGTPFLFFYDSGGARIQEGIDSL---------------------------------
1on3E           QSTKVVETMEQALLTGTPFLFFYDSGGARIQEGIDSL---------------------------------
1on3D           QSTKVVETMEQALLTGTPFLFFYDSGGARIQEGIDSL---------------------------------
1on3C           QSTKVVETMEQALLTGTPFLFFYDSGGARIQEGIDSL---------------------------------
1on3B           QSTKVVETMEQALLTGTPFLFFYDSGGARIQEGIDSL---------------------------------
1on3A           QSTKVVETMEQALLTGTPFLFFYDSGGARIQEGIDSL---------------------------------


                         .         .         .         +         .         .         .:280
query           ASYAMLGDVHIAEPGAEICFAGKRVIEQTIREKLPEGFQTSEYLLEHGMVDMVIDRREIPDTLASMLKIM
2f9yB           ASFAMLGDLNIAEPKALIGFAGPRVIEQTVREKLPPGFQRSEFLIEKGAIDMIVRRPEMRLKLASILAKL
2f9iB           ASFASVGDINLSEPKALIGFAGRRVIEQTINEKLPDDFQTAEFLLEHGQLDKVVHRNDMRQTLSEILKI-
2f9iD           ASFASVGDINLSEPKALIGFAGRRVIEQTINEKLPDDFQTAEFLLEHGQLDKVVHRNDMRQTLSEILKI-
1x0uA           YSPALTDFIIMIKGDAYYMFTGPEITKVVLGEEV--SFQDLGGAVVHGVVHFMVDSEQ--EAINLTKRLL
2bzrF           YSPALTDFVIMVDQTSQMFITGPDVIKTVTGEEV------------------------------------
2bzrD           YSPALTDFVIMVDQTSQMFITGPDVIKTVTGEEV------------------------------------
2bzrC           YSPALTDFVIMVDQTSQMFITGPDVIKTVTGEEV------------------------------------
2bzrB           YSPALTDFVIMVDQTSQMFITGPDVIKTVTGEEV------------------------------------
2bzrA           YSPALTDFVIMVDQTSQMFITGPDVIKTVTGEEV------------------------------------
2a7sA           YSPALTDFVIMVDQTSQMFITGPDVIKTVTGEEV------------------------------------
1xnwA           YSPAITDFTVMVDQTSHMFITGPDVIKTVTGEDV--GFE-------------------------------
1xnvA           YSPAITDFTVMVDQTSHMFITGPDVIKTVTGEDV--GFE-------------------------------
1vrgA           YSPA-LTDFIVVDQTARF-ITGPNVIKAVTGEEIQEDLGGAVHNQKSGNAHFLADNDEKASLVRTLLSYL
1on9E           ----------------------------------------------------------------------
1on9D           ----------------------------------------------------------------------
1on9C           ----------------------------------------------------------------------
1on3E           ----------------------------------------------------------------------
1on3D           ----------------------------------------------------------------------
1on3C           ----------------------------------------------------------------------
1on3B           ----------------------------------------------------------------------
1on3A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           TKAPADNAxxxxxxxxxx
2f9yB           MNLPAPN-----------
2f9iB           ------------------
2f9iD           ------------------
1x0uA           SYLPSNN-----------
2bzrF           ------------------
2bzrD           ------------------
2bzrC           ------------------
2bzrB           ------------------
2bzrA           ------------------
2a7sA           ------------------
1xnwA           ------------------
1xnvA           ------------------
1vrgA           ---PSNNA----------
1on9E           ------------------
1on9D           ------------------
1on9C           ------------------
1on3E           ------------------
1on3D           ------------------
1on3C           ------------------
1on3B           ------------------
1on3A           ------------------