[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for atum0:AAK85915.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1j8bA.bssp"
#ERROR : Can't open dsspfile "1pugA.bssp"
#ERROR : Can't open dsspfile "1pugD.bssp"
#ERROR : Can't open dsspfile "1pugB.bssp"
#ERROR : Can't open dsspfile "1pugC.bssp"
#ERROR : Can't open dsspfile "3f42B.bssp"
#ERROR : Can't open dsspfile "3f42A.bssp"

## Summary of PDB Search
:107
    2e-10  51%  1j8bA  [d.222.1] YBAB
    5e-10  39%  1pugA  [d.222.1] HYPOTHETICAL UPF0133 PROTEIN YBAB
    6e-10  40%  1pugD  [d.222.1] HYPOTHETICAL UPF0133 PROTEIN YBAB
    6e-10  41%  1pugB  [d.222.1] HYPOTHETICAL UPF0133 PROTEIN YBAB
    5e-07  38%  1pugC  [d.222.1] HYPOTHETICAL UPF0133 PROTEIN YBAB
    1e-04  34%  3f42B  [x.x.x] PROTEIN HP0035
    1e-04  34%  3f42A  [x.x.x] PROTEIN HP0035
:107

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxGMMGKVKEMQSKMEKVQQEIAALEIEGRAGGGLVTVILNGKGEMRGLKIDPSLFKEDEVEILEDL
1j8bA           ---------------------------LEVTGESGAGLVKITINGAHNCRRIDIDPSL--EDDKE-LEDL
1pugA           ---------------------------LEVTGESGAGLVKVTINGAHNCRRVEIDPS-XXXXXXXXXXXX
1pugD           -----------------MQKMQEEIAQLEVTGESGAGLVKVTINGAHNCRRVEIDPS-XXXXXXXXXXXX
1pugB           --------------QEKMQKMQEEIAQLEVTGESGAGLVKVTINGAHNCRRVEIDPS-XXXXXXXXXXXX
1pugC           ------------------------IAQLEVTGESGAGLVKVTINGAHNCRRVEIDPS-XXXXXXXXXXXX
3f42B           -----GLLDGKKEFSQLEEKNKDTIHT----SKSGGG-VSVSFNGLGELVDLQIDDSLLEDKEAQIYLSA
3f42A           -----GLLDGKKEFSQLEEKNKDTIHT----SKSGGG-VSVSFNGLGELVDLQIDDSLLEDKEAQIYLSA


                         .         .         *         .         .         .         .:140
query           IVAAHKDAKEKGEAQAQEKMADLTAGLPLPPGxxxxx
1j8bA           IAAAFNDAVRRAE-ELQKEKASVTAG-----------
1pugA           VAAAFNDAARRIEETQKEKMASVSSGMQLPPG-----
1pugD           VAAAFNDAARRIEETQKEKMASV--------------
1pugB           VAAAFNDAARRIEETQKEK------------------
1pugC           VAAAFNDAARRIEETQKEKMASV--------------
3f42B           LNDGYKAVEE---------------------------
3f42A           LNDGYKAVEE---------------------------