[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for atum0:rbsK

[Show Plain Result]

#ERROR : Can't open dsspfile "1rkdA.bssp"
#ERROR : Can't open dsspfile "1gqtB.bssp"
#ERROR : Can't open dsspfile "1gqtA.bssp"
#ERROR : Can't open dsspfile "2fv7A.bssp"
#ERROR : Can't open dsspfile "1vm7B.bssp"
#ERROR : Can't open dsspfile "1vm7A.bssp"
#ERROR : Can't open dsspfile "3ikhC.bssp"
#ERROR : Can't open dsspfile "3ikhA.bssp"
#ERROR : Can't open dsspfile "3i3yB.bssp"
#ERROR : Can't open dsspfile "3ikhB.bssp"
#ERROR : Can't open dsspfile "1v19A.bssp"
#ERROR : Can't open dsspfile "1v1bA.bssp"
#ERROR : Can't open dsspfile "2qcvA.bssp"
#ERROR : Can't open dsspfile "3cqdB.bssp"
#ERROR : Can't open dsspfile "1tz6B.bssp"
#ERROR : Can't open dsspfile "1tz6A.bssp"
#ERROR : Can't open dsspfile "3cqdA.bssp"
#ERROR : Can't open dsspfile "1tz3B.bssp"
#ERROR : Can't open dsspfile "1tyyB.bssp"
#ERROR : Can't open dsspfile "1tz3A.bssp"
#ERROR : Can't open dsspfile "1tyyA.bssp"
#ERROR : Can't open dsspfile "2jg5A.bssp"
#ERROR : Can't open dsspfile "2qhpA.bssp"
#ERROR : Can't open dsspfile "3iq0B.bssp"
#ERROR : Can't open dsspfile "2abqA.bssp"
#ERROR : Can't open dsspfile "3iq0A.bssp"
#ERROR : Can't open dsspfile "2hqqA.bssp"
#ERROR : Can't open dsspfile "1j5vD.bssp"
#ERROR : Can't open dsspfile "2afbB.bssp"
#ERROR : Can't open dsspfile "1j5vB.bssp"
#ERROR : Can't open dsspfile "1wyeA.bssp"
#ERROR : Can't open dsspfile "2dcnA.bssp"
#ERROR : Can't open dsspfile "1j5vA.bssp"
#ERROR : Can't open dsspfile "3in1A.bssp"
#ERROR : Can't open dsspfile "3ie7A.bssp"
#ERROR : Can't open dsspfile "3hicA.bssp"
#ERROR : Can't open dsspfile "2afbA.bssp"
#ERROR : Can't open dsspfile "2hlzD.bssp"
#ERROR : Can't open dsspfile "2hlzC.bssp"
#ERROR : Can't open dsspfile "2hlzA.bssp"
#ERROR : Can't open dsspfile "3h49A.bssp"
#ERROR : Can't open dsspfile "2v78A.bssp"
#ERROR : Can't open dsspfile "3b3lA.bssp"
#ERROR : Can't open dsspfile "3ih0A.bssp"
#ERROR : Can't open dsspfile "3gbuA.bssp"
#ERROR : Can't open dsspfile "3ewmA.bssp"
#ERROR : Can't open dsspfile "2i6aA.bssp"
#ERROR : Can't open dsspfile "1bx4A.bssp"
#ERROR : Can't open dsspfile "2ddoB.bssp"
#ERROR : Can't open dsspfile "2ddwB.bssp"
#ERROR : Can't open dsspfile "1lhpA.bssp"
#ERROR : Can't open dsspfile "2ddmB.bssp"
#ERROR : Can't open dsspfile "2c4eA.bssp"
#ERROR : Can't open dsspfile "2c49B.bssp"
#ERROR : Can't open dsspfile "2c49A.bssp"
#ERROR : Can't open dsspfile "2yxuA.bssp"
#ERROR : Can't open dsspfile "2yxtA.bssp"
#ERROR : Can't open dsspfile "1yhjA.bssp"
#ERROR : Can't open dsspfile "1rfuA.bssp"
#ERROR : Can't open dsspfile "1lhpB.bssp"
#ERROR : Can't open dsspfile "2i6bA.bssp"
#ERROR : Can't open dsspfile "3julA.bssp"
#ERROR : Can't open dsspfile "2ajpA.bssp"
#ERROR : Can't open dsspfile "1lhrA.bssp"
#ERROR : Can't open dsspfile "2i6bB.bssp"
#ERROR : Can't open dsspfile "3fhxA.bssp"

## Summary of PDB Search
:299
    1e-41  33%  1rkdA  [c.72.1 (1gqtC)] RIBOKINASE
    1e-41  33%  1gqtB  [c.72.1] RIBOKINASE
    1e-41  33%  1gqtA  [c.72.1] RIBOKINASE
    3e-29  30%  2fv7A  [x.x.x] RIBOKINASE
    8e-26  31%  1vm7B  [c.72.1] RIBOKINASE
    8e-26  31%  1vm7A  [c.72.1] RIBOKINASE
    5e-19  33%  3ikhC  [x.x.x] CARBOHYDRATE KINASE
    5e-19  33%  3ikhA  [x.x.x] CARBOHYDRATE KINASE
    5e-18  30%  3i3yB  [x.x.x] CARBOHYDRATE KINASE
    4e-17  32%  3ikhB  [x.x.x] CARBOHYDRATE KINASE
    2e-10  25%  1v19A  [c.72.1] 2-KETO-3-DEOXYGLUCONATE KINASE
    5e-10  25%  1v1bA  [c.72.1] 2-KETO-3-DEOXYGLUCONATE KINASE
    2e-09  25%  2qcvA  [x.x.x] PUTATIVE 5-DEHYDRO-2-DEOXYGLUCONOKINASE
    4e-09  21%  3cqdB  [x.x.x] 6-PHOSPHOFRUCTOKINASE ISOZYME 2
    5e-09  27%  1tz6B  [c.72.1] PUTATIVE SUGAR KINASE
    7e-09  27%  1tz6A  [c.72.1] PUTATIVE SUGAR KINASE
    1e-08  21%  3cqdA  [x.x.x] 6-PHOSPHOFRUCTOKINASE ISOZYME 2
    2e-08  26%  1tz3B  [c.72.1] PUTATIVE SUGAR KINASE
    2e-08  26%  1tyyB  [c.72.1] PUTATIVE SUGAR KINASE
    3e-08  26%  1tz3A  [c.72.1] PUTATIVE SUGAR KINASE
    3e-08  26%  1tyyA  [c.72.1] PUTATIVE SUGAR KINASE
    7e-08  29%  2jg5A  [x.x.x] FRUCTOSE 1-PHOSPHATE KINASE
    9e-08  37%  2qhpA  [x.x.x] FRUCTOKINASE
    2e-07  27%  3iq0B  [x.x.x] PUTATIVE RIBOKINASE II
    6e-07  25%  2abqA  [x.x.x] FRUCTOSE 1-PHOSPHATE KINASE
    8e-07  36%  3iq0A  [x.x.x] PUTATIVE RIBOKINASE II
    1e-06  25%  2hqqA  [x.x.x] KETOHEXOKINASE
    2e-06  34%  1j5vD  [c.72.1] 2-KETO-3-DEOXYGLUCONATE KINASE
    2e-06  32%  2afbB  [x.x.x] 2-KETO-3-DEOXYGLUCONATE KINASE
    2e-06  34%  1j5vB  [c.72.1] 2-KETO-3-DEOXYGLUCONATE KINASE
    4e-06  29%  1wyeA  [x.x.x] 2-KETO-3-DEOXYGLUCONATE KINASE
    4e-06  29%  2dcnA  [x.x.x] HYPOTHETICAL FRUCTOKINASE
    7e-06  32%  1j5vA  [c.72.1] 2-KETO-3-DEOXYGLUCONATE KINASE
    7e-06  29%  3in1A  [x.x.x] UNCHARACTERIZED SUGAR KINASE YDJH
    7e-06  31%  3ie7A  [x.x.x] LIN2199 PROTEIN
    7e-06  31%  3hicA  [x.x.x] LIN2199 PROTEIN
    9e-06  33%  2afbA  [x.x.x] 2-KETO-3-DEOXYGLUCONATE KINASE
    1e-05  25%  2hlzD  [x.x.x] KETOHEXOKINASE
    1e-05  25%  2hlzC  [x.x.x] KETOHEXOKINASE
    1e-05  25%  2hlzA  [x.x.x] KETOHEXOKINASE
    1e-05  30%  3h49A  [x.x.x] RIBOKINASE
    2e-05  27%  2v78A  [x.x.x] FRUCTOKINASE
    2e-05  22%  3b3lA  [x.x.x] KETOHEXOKINASE
    3e-05  22%  3ih0A  [x.x.x] UNCHARACTERIZED SUGAR KINASE PH1459
    3e-05  22%  3gbuA  [x.x.x] UNCHARACTERIZED SUGAR KINASE PH1459
    3e-05  22%  3ewmA  [x.x.x] UNCHARACTERIZED SUGAR KINASE PH1459
    4e-05  27%  2i6aA  [x.x.x] ADENOSINE KINASE
    4e-05  27%  1bx4A  [c.72.1] PROTEIN (ADENOSINE KINASE)
    7e-05  32%  2ddoB  [x.x.x] PYRIDOXINE KINASE
    2e-04  32%  2ddwB  [x.x.x] PYRIDOXINE KINASE
    3e-04  33%  1lhpA  [c.72.1] PYRIDOXAL KINASE
    3e-04  34%  2ddmB  [x.x.x] PYRIDOXINE KINASE
    3e-04  33%  2c4eA  [x.x.x] SUGAR KINASE MJ0406
    3e-04  33%  2c49B  [x.x.x] SUGAR KINASE MJ0406
    3e-04  33%  2c49A  [x.x.x] SUGAR KINASE MJ0406
    4e-04  34%  2yxuA  [x.x.x] PYRIDOXAL KINASE
    4e-04  34%  2yxtA  [x.x.x] PYRIDOXAL KINASE
    4e-04  32%  1yhjA  [x.x.x] PYRIDOXAL KINASE
    4e-04  32%  1rfuA  [c.72.1] PYRIDOXAL KINASE
    4e-04  32%  1lhpB  [c.72.1] PYRIDOXAL KINASE
    4e-04  26%  2i6bA  [x.x.x] ADENOSINE KINASE
    5e-04  33%  3julA  [x.x.x] LIN2199 PROTEIN
    5e-04  34%  2ajpA  [x.x.x] PYRIDOXAL KINASE
    6e-04  32%  1lhrA  [c.72.1] PYRIDOXAL KINASE
    6e-04  26%  2i6bB  [x.x.x] ADENOSINE KINASE
    8e-04  34%  3fhxA  [x.x.x] PYRIDOXAL KINASE
:299

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MITVFGSINMDLVATAKRLPKPGETVTGDTFSTAAGGKGANQALAARRAGVTVKMAGATGDDTFAAPALT
1rkdA           -LVVLGSINADHILNLQSFPTPGETVTGNHYQVAFGGKGANQAVAAGRSGANIAFIACTGDDSIGESVRQ
1gqtB           -LVVLGSINADHILNLQSFPTPGETVTGNHYQVAFGGKGANQAVAAGRSGANIAFIACTGDDSIGESVRQ
1gqtA           -LVVLGSINADHILNLQSFPTPGETVTGNHYQVAFGGKGANQAVAAGRSGANIAFIACTGDDSIGESVRQ
2fv7A           -VVVVGSCMTDLVSLTSRLPKTGETXXXXXXXXXXXXXXANQCVQAARLGAMTSMVCKVGKDSFGNDYIE
1vm7B           VISVVGSSNIDIVLKVDHFTKPGETQKAIEMNVFPGGKGANQAVTVAKIGEKCRFVTCIGNDDYSDLLIE
1vm7A           VISVVGSSNIDIVLKVDHFTKPGETQKAIEMNVFPGGKGANQAVTVAKIGEKCRFVTCIGNDDYSDLLIE
3ikhC           -VYVTGNITVDETWSIPDIPKKGASIHGVKVSQDIGGKGANQAIILSRCGIETRLIAATGNDSNGAWIRQ
3ikhA           -VYVTGNITVDETWSIPDIPKKGASIHGVKVSQDIGGKGANQAIILSRCGIETRLIAATGNDSNGAWIRQ
3i3yB           -VYVTGNITVDETWSIPDIPKKGASIHGVKVSQDIGGKGANQAIILSRCGIETRLIAATGNDSNGAWIRQ
3ikhB           -VYVTGNITVDETWSIPDIPKKGASIHGVKVSQDIGGKGANQAIILSRCGIETRLIAATGNDSNGAWIRQ
1v19A           --------------------EPGHLRGKRLLEVYVGGAEVNVAVALARLGVKVGFVGRVGEDELGAMVEE
1v1bA           --------------------EPGHLRGKRLLEVYVGGAEVNVAVALARLGVKVGFVGRVGEDELGAMVEE
2qcvA           ----------------------------------------------------------------------
3cqdB           --------------------------TAPVFEPGGGGINVARAIAHLGGSATAPAGGATGEHL-----VS
1tz6B           -VWVIGDASVDLVPEKQ-----------NSYLKCPGGASANVGVCVARLGGECGFIGCLGDDDAGRFLRQ
1tz6A           -VWVIGDASVDLVPEKQ-----------NSYLKCPGGASANVGVCVARLGGECGFIGCLGDDDAGRFLRQ
3cqdA           --------------------------TAPVFEPGGGGINVARAIAHLGGSATAPAGGATGEHL-----VS
1tz3B           -VWVIGDASVDLVPEKQ-----------NSYLKCPGGASANVGVCVARLGGECGFIGCLGDDDAGRFLRQ
1tyyB           -VWVIGDASVDLVPEKQ-----------NSYLKCPGGASANVGVCVARLGGECGFIGCLGDDDAGRFLRQ
1tz3A           -VWVIGDASVDLVPEKQ-----------NSYLKCPGGASANVGVCVARLGGECGFIGCLGDDDAGRFLRQ
1tyyA           -VWVIGDASVDLVPEKQ-----------NSYLKCPGGASANVGVCVARLGGECGFIGCLGDDDAGRFLRQ
2jg5A           ----------------------------------------------------------------------
2qhpA           ----------------------------------------------------------------------
3iq0B           -----------------------------------------------RLGVPCGIISCVGNDGFGDINIH
2abqA           -----------------------------------GGKGINVSRVLKRLGHETKALGFLGGFT-GAYVRN
3iq0A           ----------------------------------------------------------------------
2hqqA           -ILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFMGSMAPGHVADFVLD
1j5vD           ----------------------------------------------------------------------
2afbB           ----------------------------------------------------------------------
1j5vB           ----------------------------------------------------------------------
1wyeA           ---------------------PGPLRHVSYFEKHVAGSEANYCVAFIKQGNECGIIAKVGDDEFGYNAIE
2dcnA           ---------------------PGPLRHVSYFEKHVAGSEANYCVAFIKQGNECGIIAKVGDDEFGYNAIE
1j5vA           ----------------------------------------------------------------------
3in1A           ----------------------------------------------------------------------
3ie7A           ----------------------------------------------------------------------
3hicA           ----------------------------------------------------------------------
2afbA           ----------------------------------------------------------------------
2hlzD           -ILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTILSLLGAPCAFGSAPGH--VADFVLD
2hlzC           -ILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTILSLLGAPCAFGSAPGH--VADFVLD
2hlzA           -ILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTILSLLGAPCAFGSAPGH--VADFVLD
3h49A           ----------------------------------------------------------------------
2v78A           ----------------------------------------------------------------------
3b3lA           -ILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFMGSMAPGHVADFLVA
3ih0A           LIASIGELLIDLISVEE-----GDLKDVRLFEKHPGGAPANVAVGVSRLGVKSSLISKVGNDPFGEYLIE
3gbuA           LIASIGELLIDLISVEE-----GDLKDVRLFEKHPGGAPANVAVGVSRLGVKSSLISKVGNDPFGEYLIE
3ewmA           LIASIGELLIDLISVEE-----GDLKDVRLFEKHPGGAPANVAVGVSRLGVKSSLISKVGNDPFGEYLIE
2i6aA           ----------------------------------------------------------------------
1bx4A           ----------------------------------------------------------------------
2ddoB           ----------------------------------------------------------------------
2ddwB           ----------------------------------------------------------------------
1lhpA           ----------------------------------------------------------------------
2ddmB           ----------------------------------------------------------------------
2c4eA           ----------------------------------------------------------------------
2c49B           ----------------------------------------------------------------------
2c49A           ----------------------------------------------------------------------
2yxuA           ----------------------------------------------------------------------
2yxtA           ----------------------------------------------------------------------
1yhjA           ----------------------------------------------------------------------
1rfuA           ----------------------------------------------------------------------
1lhpB           ----------------------------------------------------------------------
2i6bA           ----------------------------------------------------------------------
3julA           ----------------------------------------------------------------------
2ajpA           ----------------------------------------------------------------------
1lhrA           ----------------------------------------------------------------------
2i6bB           ----------------------------------------------------------------------
3fhxA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           LLRDAGTDLSLVKTAPGPTGTAVILIGEGGENMISVIPAANGEVSAFDATKVVGEMDAGDILMLQFEIPX
1rkdA           QLATDNIDITPVSVIKGSTGVALIFVNGEGENVIGIHAGANAALSPALVEAQRERIANASALLMQLESPL
1gqtB           QLATDNIDITPVSVIKGSTGVALIFVNGEGENVIGIHAGANAALSPALVEAQRERIANASALLMQLESPL
1gqtA           QLATDNIDITPVSVIKGSTGVALIFVNGEGENVIGIHAGANAALSPALVEAQRERIANASALLMQLESPL
2fv7A           NLKDISTEFT-YQTKDAATGTASIIVNNEGQNIIVIVAGANLLLNTEDLRAAANVISRAKVMVCQLEITP
1vm7B           NYEKLGITGYIRVSLP--TGRAFIEVDKTGQNRIIIFPGANAELKK----ELINTLSESDILLLQNEIPF
1vm7A           NYEKLGITGYIRVSLP--TGRAFIEVDKTGQNRIIIFPGANAELKK----ELINTLSESDILLLQNEIPF
3ikhC           QIKNEPLLL--------PDGTSIILNSADGDNXXXXXXXXXXXFSLDEIPH--ADAVAGDILLQQGNF-S
3ikhA           QIKNEPLLL--------PDGTSIILNSADGDNXXXXXXXXXXXFSLDEIPH--ADAVAGDILLQQGNF-S
3i3yB           QIKNE--PLLLPDGHFNQHSDTSIILADGNXXXXXXXXXXXFSLDEIPHADAV----AGDILLQQGNFSL
3ikhB           QIKNEPLLL--------PDGTSIILNSXXXXXXXXXXXXXXFSLDEIPHADAV----AGDILLQQGNFSL
1v19A           RLRAEGVDLTHFRRAPGPLGQGRVFYYRKGSAGSALAPGA------FDPDYLEGVRFLHLSGITPALSPE
1v1bA           RLRAEGVDLTHFRRAPGPLGQGRVFYYRKGSAGSALAPGA------FDPDYLEGVRFLHLSGITPALSPE
2qcvA           ----------------------------------------------------------------------
3cqdB           LLADENVPVATVEAKDWTRQNLHVHVEASGEQYRFVMPAALNEDEFRQLEEQVLEIESGAILVISGSLPP
1tz6B           VFQDNGVDVTFLRLDADLTSAVLILVHPGADTYVSLPPFRQYEWFYFSSIGLTDRREAGGYVLFDVNL--
1tz6A           VFQDNGVDVTFLRLDADLTSAVLILVHPGADTYVSLPPFRQYEWFYFSSIGLTDRREAGGYVLFDVNL--
3cqdA           LLADENVPVATVEAKDWTRQNLHVHVEASGEQYRFVMPAALNEDEFRQLEEQVLEIESGAILVISGSLPP
1tz3B           VFQDNGVDVTFLRLDADLTSAVLILVHPGADTYVSLPPFRQYEWFYFSSIGLTDRREAGGYVLFDVNLRS
1tyyB           VFQDNGVDVTFLRLDADLTSAVLILVHPGADTYVSLPPFRQYEWFYFSSIGLTDRREAGGYVLFDVNLRS
1tz3A           VFQDNGVDVTFLRLDADLTSAVLILVHPGADTYVSLPPFRQYEWFYFSSIGLTDRREAGGYVLFDVNLRS
1tyyA           VFQDNGVDVTFLRLDADLTSAVLILVHPGADTYVSLPPFRQYEWFYFSSIGLTDRREAGGYVLFDVNLRS
2jg5A           ----------------------------------------------------------------------
2qhpA           ----------------------------------------------------------------------
3iq0B           RLAADGVDIRGISVLPEATGSAFVTYGDR-DFIFNIKNAACGKLSA----QHVDENILKDCT--HFHI-G
2abqA           ALEKEEIGLSFIEVE-GDTRINVKIKGKQETELNGTAPLIKKEVQAL--LEQLTELEKGDVLVLAGSVPQ
3iq0A           ----------------------------------------------------------------------
2hqqA           DLRRYSVDLRYVFQTTGSVPIATVIINEAGSRTILYYDRSLPDVSATDFEKVEGRNASEQVKMLQ-----
1j5vD           ----------------------------------------------------------------------
2afbB           ----------------------------------------------------------------------
1j5vB           ----------------------------------------------------------------------
1wyeA           WLRGQGVDVSHMKIDPAPTG--------------------------------------------------
2dcnA           WLRGQGVDVSHMKIDPAPTG--------------------------------------------------
1j5vA           ----------------------------------------------------------------------
3in1A           ----------------------------------------------------------------------
3ie7A           ----------------------------------------------------------------------
3hicA           ----------------------------------------------------------------------
2afbA           ----------------------------------------------------------------------
2hlzD           DLRRYSVDLRYVFQTTGSVPIATVIINEAGSRTILYYDRSLPDVSATDFEKVIEGRNASEQVKLQ-----
2hlzC           DLRRYSVDLRYVFQTTGSVPIATVIINEAGSRTILYYDRSLPDVSATDFEKVIEGRNASEQVKLQ-----
2hlzA           DLRRYSVDLRYVFQTTGSVPIATVIINEAGSRTILYYDRSLPDVSATDFEKVIEGRNASEQVKLQ-----
3h49A           ----------------------------------------------------------------------
2v78A           ----------------------------------------------------------------------
3b3lA           DFRRRGVDVSQVAQSKGDTGNRTIVLHDTSLPDVSATDFEKVDLTQFKWIHIEGRNASEQVKMLQ-----
3ih0A           ELSKENVDTGIVKDEKKHTGIVFVQLKGASPSFLLY-----DDVAYFNTLNDINWDIVEEAKIVNF---G
3gbuA           ELSKENVDTGIVKDEKKHTGIVFVQLKGASPSFLLY-----DDVAYFNTLNDINWDIVEEAKIVNF---G
3ewmA           ELSKENVDTGIVKDEKKHTGIVFVQLKGASPSFLLY-----DDVAYFNTLNDINWDIVEEAKIVNF---G
2i6aA           ----------------------------------------------------------------------
1bx4A           ----------------------------------------------------------------------
2ddoB           ----------------------------------------------------------------------
2ddwB           ----------------------------------------------------------------------
1lhpA           ----------------------------------------------------------------------
2ddmB           ----------------------------------------------------------------------
2c4eA           ----------------------------------------------------------------------
2c49B           ----------------------------------------------------------------------
2c49A           ----------------------------------------------------------------------
2yxuA           ----------------------------------------------------------------------
2yxtA           ----------------------------------------------------------------------
1yhjA           ----------------------------------------------------------------------
1rfuA           ----------------------------------------------------------------------
1lhpB           ----------------------------------------------------------------------
2i6bA           ----------------------------------------------------------------------
3julA           ----------------------------------------------------------------------
2ajpA           ----------------------------------------------------------------------
1lhrA           ----------------------------------------------------------------------
2i6bB           ----------------------------------------------------------------------
3fhxA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           XXXXXXXXXXXXKRITTVINTAPLTADGPRLAGLADIVIANETEFELLIGKNGLSSGERESELKALHDRT
1rkdA           ESVMAAAKIAHQNKTIVALNPAPARELPDELLALVDIITPNETEAEKLTGIRVENDEDAAKAAQVLHEKG
1gqtB           ESVMAAAKIAHQNKTIVALNPAPARELPDELLALVDIITPNETEAEKLTGIRVENDEDAAKAAQVLHEKG
1gqtA           ESVMAAAKIAHQNKTIVALNPAPARELPDELLALVDIITPNETEAEKLTGIRVENDEDAAKAAQVLHEKG
2fv7A           ATSLEALTMARRSGVKTLFNPAPAIADDPQFYTLSDVFCCNESEAEILTGLTVGSAADAGEAALVLLKRG
1vm7B           ETTLECA-----KRFNGIVIFDPAPAQGEEIFQYLDYLTPNEKEIEALSKDFFGEFLTVEKAAEKFLELG
1vm7A           ETTLECA-----KRFNGIVIFDPAPAQGEEIFQYLDYLTPNEKEIEALSKDFFGEFLTVEKAAEKFLELG
3ikhC           LDKTRALFQYARSRGTTVFNPSPVNPDFCHLWPLIDIAVVNESEAEL------------------LQPYG
3ikhA           LDKTRALFQYARSRGTTVFNPSPVNPDFCHLWPLIDIAVVNESEAEL------------------LQPYG
3i3yB           DKTRALFQYAR-SRGTTVFNPSPVNPDFCHLWPLIDIAVVNESEAELL------------------QPYG
3ikhB           DKTRALFQYAR-SRGTTVFNPSPVNPDFCHLWPLIDIAVVNESEAELL------------------QPYG
1v19A           ARAFSLWAMEEAKRVSLDVNYRQTLWSPEEARGFLERALPGVDXXXXXXXXXXXXXGRVEEALRAL---S
1v1bA           ARAFSLWAMEEAKRVSLDVNYRQTLWSPEEARGFLERALPGVDXXXXXXXXXXXXXGRVEEALRAL---S
2qcvA           ------------------------------VAEQSDIVIGTREEFDVL--ENRTEKGDNDETIRYLFKHS
3cqdB           GVKLEKLTQLISQGIRCIVDSSGEALSAALAIGNIELVKPNQKELSALVNRELTQPDDRKAAQEIVNSGK
1tz6B           -------------RSKMWGNTDEIPELIARSAALASICKVSADELCQLSG-----ASHWQDARYYLRDLG
1tz6A           -------------RSKMWGNTDEIPELIARSAALASICKVSADELCQLSG-----ASHWQDARYYLRDLG
3cqdA           GVKLEKLTQLISQGIRCIVDSSGEALSAALAIGNIELVKPNQKELSALVNRELTQPDDRKAAQEIVNSGK
1tz3B           KWG----------------NTDEIPELIARSAALASICKVSADELCQLSG-----ASHWQDARYYLRDLG
1tyyB           KWG----------------NTDEIPELIARSAALASICKVSADELCQLSG-----ASHWQDARYYLRDLG
1tz3A           KWG----------------NTDEIPELIARSAALASICKVSADELCQLSG-----ASHWQDARYYLRDLG
1tyyA           KWG----------------NTDEIPELIARSAALASICKVSADELCQLSG-----ASHWQDARYYLRDLG
2jg5A           ----------------------------------------NKDELEVMFNTTVNSDADVIKYGRLLVDKG
2qhpA           ----------------------------------------------------------------------
3iq0B           SSLFSFHVDAVKKAVTIVKANGGVISFDPNIRKELDIPERDALHFVLELTDIYPSEGEPERAIAGFLEEG
2abqA           APQTIYRSTQIAKRGAFVAVDTSGEALHEVLAAKPSFIKPNHHELSELVSKPIASIEDAIPHVQRLIGEG
3iq0A           ----------------------------------------------------------------------
2hqqA           RIDAHNTRQPPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHL----GFQSAEEA--LRGLYGRV
1j5vD           -----------------------------------DVLIANEEDIEKVLGIS--VEGNREAYAKIAEEVT
2afbB           -----------------------------------DVLIANEEDIEKVLGISVEGLDNREAYAKIAEEVT
1j5vB           -----------------------------------DVLIANEEDIEKVLG---ISVENREAYAKIAEEVT
1wyeA           -----------------------------------------------------LGESDPDKAAKAFSDYA
2dcnA           -----------------------------------------------------LGESDPDKAAKAFSDYA
1j5vA           -----------------------------------DVLIANEEDIEKVLGREAYAKIAEEVTRKYNFKTV
3in1A           -----------------------------------DYLFPNFAEAKLLTGKETLD------EIADCFLAC
3ie7A           -----------------------------------DFIKPNEDEVIAILDEK---TNSLEENIRTLAEKI
3hicA           -----------------------------------DFIKPNEDEVIAILDEK---TNSLEENIRTLAEKI
2afbA           -----------------------------------DVLIANEEDIEKVLGIS-VEGLNREAYAKIAEEVT
2hlzD           RIDAHNTRQPPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHL----GFQSAEEA--LRGLYGRV
2hlzC           RIDAHNTRQPPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHL----GFQSAEEA--LRGLYGRV
2hlzA           RIDAHNTRQPPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHL----GFQSAEEA--LRGLYGRV
3h49A           -----------------------------------DYLFPNFAEAKLLTGKETLD------EIADCFLAC
2v78A           ----------------------------------------------------------------------
3b3lA           RIDAHNTRQPPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHL----GFQSAEEA--LRGLYGRV
3ih0A           SVILARNPSRETVKVIKKIKGSSLIAFDVNLR--LDLWRGQEEEIKVLEESIKLADIVKASEEEVLYEVK
3gbuA           SVILARNPSRETVKVIKKIKGSSLIAFDVNLR--LDLWRGQEEEIKVLEESIKLADIVKASEEEVLYEVK
3ewmA           SVILARNPSRETVKVIKKIKGSSLIAFDVNLR--LDLWRGQEEEIKVLEESIKLADIVKASEEEVLYEVK
2i6aA           -----------------------------------DILFGNETEAATFAREQGFETAKKTQALPKMNSKR
1bx4A           -----------------------------------DILFGNETEAATFAREQGFETAKKTQALPKMNSKR
2ddoB           ------------------------------LLPLAQGITPNIFELEILTGKNCRDLDSAIAAAKSLLSDT
2ddwB           ------------------------------LLPLAQGITPNIFELEILTGKNCRDLDSAIAAAKSLLSDT
1lhpA           -----------------------------KVVPVADIITPNQFEAELLTGRKIHSQEEALEVMDMLHSMG
2ddmB           ------------------------------LLPLAQGITPNIFELEILTGKNCRDLDSAIAAAKSLLSDT
2c4eA           ----------------------------------------------------------------------
2c49B           ----------------------------------------------------------------------
2c49A           ----------------------------------------------------------------------
2yxuA           -----------------------------KVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMG
2yxtA           -----------------------------KVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMG
1yhjA           -----------------------------KVVPVADIITPNQFEAELLTGRKIHSQEEALEVMDMLHSMG
1rfuA           -----------------------------KVVPVADIITPNQFEAELLTGRKIHSQEEALEVMDMLHSMG
1lhpB           -----------------------------KVVPVADIITPNQFEAELLTGRKIHSQEEALEVMDMLHSMG
2i6bA           -----------------------------------DILFGNETEAATFAREQGFETAKKTQALPKMNSKR
3julA           -----------------------------------DFIKPNEDEVIAILDEK---TNSLEENIRTLAEKI
2ajpA           -----------------------------KVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMG
1lhrA           -----------------------------KVVPVADIITPNQFEAELLTGRKIHSQEEALEVMDMLHSMG
2i6bB           -----------------------------------DILFGNETEAATFAREQGFETAKKTQALPKMNSKR
3fhxA           -----------------------------KVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMG


                         .         .         .         +         .         .         .:280
query           GQTLIVTLGADGVIAMRNGKVFSASGLKIEPVDTVGAGDTFCGYLAASLDQGMDFEKALKRAAVAGSLAC
1rkdA           IRTVLITLGSRGVWASVNGEGQRVPGFRVQAVDTIAAGDTFNGALITALLEEKPLPEXXXXXXXXXXXXV
1gqtB           IRTVLITLGSRGVWASVNGEGQRVPGFRVQAVDTIAAGDTFNGALITALLEEKPLPEXXXXXXXXXXXXV
1gqtA           IRTVLITLGSRGVWASVNGEGQRVPGFRVQAVDTIAAGDTFNGALITALLEEKPLPEXXXXXXXXXXXXV
2fv7A           CQVVIITLGAEGVLSQTEPEPKHIPTEKVKAVDTTGAGDSFVGALAFYLAPNLSLEDMLNRSNFIAAVSV
1vm7B           VKNVIVKLGDKGVLLVNKNEKKHFPTFKVKAVDTTAAGDVFNGAFAVALSEGKNPEEAVIFGTAAAAISV
1vm7A           VKNVIVKLGDKGVLLVNKNEKKHFPTFKVKAVDTTAAGDVFNGAFAVALSEGKNPEEAVIFGTAAAAISV
3ikhC           VKTLVITQGAAGAWLVQEGQRQFCPAVPAEALDTTGAGDTFLAVLASALLRGV-----------------
3ikhA           VKTLVITQGAAGAWLVQEGQRQFCPAVPAEALDTTGAGDTFLAVLASALLRGV-----------------
3i3yB           VKTLVITQGAAGAWLVQEGQRQFCPAVPAEALDTTGAGDTFLAVLASALLRGV-----------------
3ikhB           VKTLVITQGAAGAWLVQEGQRQFCPAVPAEALDTTGAGDTFLAVLASALLRGV-----------------
1v19A           APEVVLKRGAKGAWAFVDGRRVEGSAFAVEAVDPVGAGDAFAGYLAGAV-WGLPVEERLRLANLLGASVA
1v1bA           APEVVLKRGAKGAWAFVDGRRVEGSAFAVEAVDPVGAGDAFAGYLAGAV-WGLPVEERLRLANLLGASVA
2qcvA           PELIVIKHGVEGSFAYKAGEAYRGYAYKTKVLKTFGAGDSYASAFLYALISGKGIETALKYGSASASIVV
3cqdB           AKRVVVSLGPQGALGVDSENCIQVVPPPVKSQSTVGAGDSMVGAMTLKLAENASLEEMVRFGVAAGSAAT
1tz6B           CDTTIISLGADGALLITAEGEFHFPAPRVDVVDTTGAGDAFVGGLLFTLSRANCWDHALLAEAISGAMAV
1tz6A           CDTTIISLGADGALLITAEGEFHFPAPRVDVVDTTGAGDAFVGGLLFTLSRANCWDHALLAEAISGAMAV
3cqdA           AKRVVVSLGPQGALGVDSENCIQVVPPPVKSQSTVGAGDSMVGAMTLKLAENASLEEMVRFGVAAGSAA-
1tz3B           CDTTIISLGADGALLITAEGEFHFPAPRVDVVDTTGAGDAFVGGLLFTLSRANCWDHALLAEAISNANAC
1tyyB           CDTTIISLGADGALLITAEGEFHFPAPRVDVVDTTGAGDAFVGGLLFTLSRANCWDHALLAEAISNANAC
1tz3A           CDTTIISLGADGALLITAEGEFHFPAPRVDVVDTTGAGDAFVGGLLFTLSRANCWDHALLAEAISNANAC
1tyyA           CDTTIISLGADGALLITAEGEFHFPAPRVDVVDTTGAGDAFVGGLLFTLSRANCWDHALLAEAISNANAC
2jg5A           AQSVIVSLGGDGAIYIDKEISIKAVNPQGKVVNTVGSGDSTVAGMVAGIASGLSIEKAFQQAVACGT---
2qhpA           ---LILTCGINGSYVFTPGVVSFQETPKVPVADTVGAGDSFTAAFCASILNGKSVPEAHKLAVEVSAYVC
3iq0B           VKEVIVKRGNQGASYYSANEQFHVESYPVEEVDPTGAGDCFGGAWIACRQLGFDAHRALQYANACGALAV
2abqA           IESILVSFAGDGAL-FASAEGFHVNVPSGEVRNSVGAGDSVVAGFLAALQEGKSLEDAVPFAVAAGS---
3iq0A           ---VIVKRGNQGASYYSANEQFHVESYPVEEVDPTGAGDCFGGAWIACRQLGFDAHRALQYANACGALAV
2hqqA           GAVLVCAWAEEGADALGDGKLLHSDAFPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVAGKKC
1j5vD           RKYNFKTVGITWSVVFENGQPHFSNRYEIHIVDRVGAGDSFAGALIYG-SLGFDSQKKAEFAAAASCLKH
2afbB           RKYNFKTVGITWSVVFENGQPHFSNRYEIHIVDRVGAGDSFAGALIYG-SLGFDSQKKAEFAAAASCLKH
1j5vB           RKYNFKTVGITWSVVFENGQPHFSNRYEIHIVDRVGAGDSFAGALIYG-SLGFDSQKKAEFAAAASCLKH
1wyeA           -EIIVMKLGPKGAIVXXXXXXXXXXXXQVPVEDVTGAGDALGGTFLSLYYKGFEMEKALDYAIVASTLNV
2dcnA           -EIIVMKLGPKGAIVXXXXXXXXXXXXQVPVEDVTGAGDALGGTFLSLYYKGFEMEKALDYAIVASTLNV
1j5vA           GITLRESISATWSVVFENGQPHFSNRYEIHIVDRVGAGDSFAGALIYG-SLGFDSQKKAEFAAAASCLKH
3in1A           GKTVVIKTGKDGCFIKRGDKVPAVAG--ITAIDTIGAGDNFASGFIAALLEGKNLRECARFANATAAISV
3ie7A           PY-LVVSLGAKGSICAHNGKLYQVIPPKVQERNDTGAGDVFVGAFIAGL---------------------
3hicA           PY-LVVSLGAKGSICAHNGKLYQVIPPKVQERNDTGAGDVFVGAFIAGL---------------------
2afbA           RKYNFKTVGITWSVVFENGQPHFSNRYEIHIVDRVGAGDSFAGALIYG-SLGFDSQKKAEFAAAASCLKH
2hlzD           GAVLVCAWAEEGADALGDGKLLHSDAFPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVAGKKC
2hlzC           GAVLVCAWAEEGADALGDGKLLHSDAFPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVAGKKC
2hlzA           GAVLVCAWAEEGADALGDGKLLHSDAFPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVAGKKC
3h49A           GKTVVIKTGKDGCFIKRGDKVPAVAG--ITAIDTIGAGDNFASGFIAALLEGKNLRECARFANATAAISV
2v78A           -KVLLYKLGSKGAIAYKDNVKAFKDAYKVPVEDPTGAGDAMAGTFVSLYLQGKDIEYSLAHGIAASTLVI
3b3lA           GAVLVCAWAEEGADALGDGKLLHSDAFPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVAGKKC
3ih0A           GSLTAITLGPKGFRLIKNETVVDVPSYNVNPLDTTGAGDAF-----------------------------
3gbuA           GSLTAITLGPKGFRLIKNETVVDVPSYNVNPLDTTGAGDAF-----------------------------
3ewmA           GSLTAITLGPKGCRLIKNETVVDVPSYNVNPLDTTGAGDAF-----------------------------
2i6aA           QRIVIFTQGRDDTIMATESEVTAFAVLQKEIIDTNGAGDAFVGGFLSQLVSDKPLTECIRAGHYAASIII
1bx4A           QRIVIFTQGRDDTIMATESEVTAFAVLQKEIIDTNGAGDAFVGGFLSQLVSDKPLTECIRAGHYAASIII
2ddoB           LKWVVVTSASENVVTADSVNVISHSRVK---TDLKGTGDLFCAQLISGLLKGKALTDAVHRAGL------
2ddwB           LKWVVVTSASGNVVTADSVNVISHSRVK---TDLKGTGDLFCAQLISGLLKGKALTDAVHRAGL------
1lhpA           PDTVVITRGSDYLMALRGSVVTQRIRMEMHKVDAVGTGDLFAAMLLA-----------------------
2ddmB           LKWVVVT-SASGVVTADSVNVISHSRVK---TDLKGTGDLFCAQLISGLLKGKALTDAVHRAGL------
2c4eA           ---LIVTKGSKGSVIYTKDKKIEIPCIKAKVIDPTGAGDSYAGFLSAYV-KGYDLEKCGLIGAATASFVV
2c49B           ---LIVTKGSKGSVIYTKDKKIEIPCIKAKVIDPTGAGDSYAGFLSAYV-KGYDLEKCGLIGAATASFVV
2c49A           ---LIVTKGSKGSVIYTKDKKIEIPCIKAKVIDPTGAGDSYAGFLSAYV-KGYDLEKCGLIGAATASFVV
2yxuA           PDTVVITQGSNYLIVLRGSVVMERIRMDIRKVDAVGTGDLFAAMLLA-----------------------
2yxtA           PDTVVITQGSNYLIVLRGSVVMERIRMDIRKVDAVGTGDLFAAMLLA-----------------------
1yhjA           PDTVVITRGSDYLMALGSQRTRAPDGMEMHKVDAVGTGDLFAAMLLA-----------------------
1rfuA           PDTVVITRGSDYLMALGSQRTRAPDGMEMHKVDAVGTGDLFAAMLLA-----------------------
1lhpB           PDTVVITRGSDYLMALGSQRTRAPDGMEMHKVDAVGTGDLFAAMLLA-----------------------
2i6bA           QRIVIFTQGRDDTIMATESEVTAFAVLQKEIIDTNGAGDAFVGGFLSQLVSDKPLTECIRAGHYAASI--
3julA           PY-LVVSLGAKGSICAHNGKLY-------QVIPPTGAGDVFVGAFIAGL---------------------
2ajpA           PDTVVITQGSNYLIVLRRRVVMERIRMDIRKVDAVGTGDLFAAMLLA-----------------------
1lhrA           PDTVVITRGSDYLMALGSQRVTQRIRMEMHKVDAVGTGDLFAAMLLA-----------------------
2i6bB           QRIVIFTQGRDDTIMATESEVTAFAVLQKEIIDTNGAGDAFVGGFLSQLVSDKPLTECIRAGHYAAS---
3fhxA           PDTVVITQGSNYLIVLRNSVVMERIRMDIRKVDAVGTGALFAAMLLA-----------------------


                         .         *         .         .         .         .         +:350
query           TRAGAQPSIPQAAEVDAAL
1rkdA           TRKGAQPSVPWREEIDAFL
1gqtB           TRKGAQPSVPWREEIDAFL
1gqtA           TRKGAQPSVPWREEIDAFL
2fv7A           QAAGTQSSYPYKKDLPLTL
1vm7B           TRLGAQSSIPAREEVEAFL
1vm7A           TRLGAQSSIPAREEVEAFL
3ikhC           -------------------
3ikhA           -------------------
3i3yB           -------------------
3ikhB           -------------------
1v19A           ASRGDHEGAPYREDLEVLL
1v1bA           ASRGDHEGAPYREDLE---
2qcvA           SKAPSVEEIEALIEKDETI
3cqdB           LNQGTR-------------
1tz6B           TAKGAMTALP---------
1tz6A           TAKGAMTALP---------
3cqdA           -------------------
1tz3B           GAA----------------
1tyyB           GAA----------------
1tz3A           GAA----------------
1tyyA           GAA----------------
2jg5A           -------------------
2qhpA           TQSGA-PELP---------
3iq0B           TRRGPE-------------
2abqA           -------------------
3iq0A           TRRGPE-------------
2hqqA           GLQG---------------
1j5vD           TIPG---------------
2afbB           TIPG---------------
1j5vB           TIPG---------------
1wyeA           MIRGDQENLPTTKDIETFL
2dcnA           MIRGDQENLPTTKDIETFL
1j5vA           TIPG---------------
3in1A           LSVGATTGVKNRKLVEQLL
3ie7A           -------------------
3hicA           -------------------
2afbA           TIPG---------------
2hlzD           GLQG---------------
2hlzC           GLQG---------------
2hlzA           GLQG---------------
3h49A           LSVGATTGV----------
2v78A           TVRGDNELTPTLEDAERFL
3b3lA           GLQG---------------
3ih0A           -------------------
3gbuA           -------------------
3ewmA           -------------------
2i6aA           RRTG---------------
1bx4A           RRTG---------------
2ddoB           -------------------
2ddwB           -------------------
1lhpA           -------------------
2ddmB           -------------------
2c4eA           EAKGCQTNLP---------
2c49B           EAKGCQTNLP---------
2c49A           EAKGCQTNLP---------
2yxuA           -------------------
2yxtA           -------------------
1yhjA           -------------------
1rfuA           -------------------
1lhpB           -------------------
2i6bA           -------------------
3julA           -------------------
2ajpA           -------------------
1lhrA           -------------------
2i6bB           -------------------
3fhxA           -------------------