[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for atum0:argB

[Show Plain Result]

#ERROR : Can't open dsspfile "1uvdA.bssp"
#ERROR : Can't open dsspfile "2bufH.bssp"
#ERROR : Can't open dsspfile "2bufG.bssp"
#ERROR : Can't open dsspfile "2bufC.bssp"
#ERROR : Can't open dsspfile "2bufB.bssp"
#ERROR : Can't open dsspfile "2bufL.bssp"
#ERROR : Can't open dsspfile "2bufD.bssp"
#ERROR : Can't open dsspfile "2v5hF.bssp"
#ERROR : Can't open dsspfile "2v5hD.bssp"
#ERROR : Can't open dsspfile "2v5hB.bssp"
#ERROR : Can't open dsspfile "2v5hA.bssp"
#ERROR : Can't open dsspfile "2jj4C.bssp"
#ERROR : Can't open dsspfile "2bufA.bssp"
#ERROR : Can't open dsspfile "2bufI.bssp"
#ERROR : Can't open dsspfile "2bufE.bssp"
#ERROR : Can't open dsspfile "2bufF.bssp"
#ERROR : Can't open dsspfile "2btyA.bssp"
#ERROR : Can't open dsspfile "2bufJ.bssp"
#ERROR : Can't open dsspfile "2bufK.bssp"
#ERROR : Can't open dsspfile "2rd5B.bssp"
#ERROR : Can't open dsspfile "2rd5A.bssp"
#ERROR : Can't open dsspfile "2ap9E.bssp"
#ERROR : Can't open dsspfile "2ap9B.bssp"
#ERROR : Can't open dsspfile "2ap9A.bssp"
#ERROR : Can't open dsspfile "2egxC.bssp"
#ERROR : Can't open dsspfile "2egxA.bssp"
#ERROR : Can't open dsspfile "1gs5A.bssp"
#ERROR : Can't open dsspfile "2r8vA.bssp"
#ERROR : Can't open dsspfile "3d2pA.bssp"
#ERROR : Can't open dsspfile "1gsjA.bssp"
#ERROR : Can't open dsspfile "2r98A.bssp"
#ERROR : Can't open dsspfile "2e9yB.bssp"
#ERROR : Can't open dsspfile "2e9yA.bssp"
#ERROR : Can't open dsspfile "2j5tD.bssp"

## Summary of PDB Search
:294
    2e-72  46%  1uvdA  [x.x.x] ACETYLGLUTAMATE KINASE
    2e-72  46%  2bufH  [x.x.x] ACETYLGLUTAMATE KINASE
    2e-72  46%  2bufG  [x.x.x] ACETYLGLUTAMATE KINASE
    2e-72  46%  2bufC  [x.x.x] ACETYLGLUTAMATE KINASE
    3e-71  46%  2bufB  [x.x.x] ACETYLGLUTAMATE KINASE
    5e-71  47%  2bufL  [x.x.x] ACETYLGLUTAMATE KINASE
    8e-71  47%  2bufD  [x.x.x] ACETYLGLUTAMATE KINASE
    1e-70  49%  2v5hF  [x.x.x] ACETYLGLUTAMATE KINASE
    1e-70  49%  2v5hD  [x.x.x] ACETYLGLUTAMATE KINASE
    1e-70  49%  2v5hB  [x.x.x] ACETYLGLUTAMATE KINASE
    1e-70  49%  2v5hA  [x.x.x] ACETYLGLUTAMATE KINASE
    1e-70  49%  2jj4C  [x.x.x] ACETYLGLUTAMATE KINASE
    1e-70  47%  2bufA  [x.x.x] ACETYLGLUTAMATE KINASE
    2e-70  47%  2bufI  [x.x.x] ACETYLGLUTAMATE KINASE
    2e-70  48%  2bufE  [x.x.x] ACETYLGLUTAMATE KINASE
    3e-70  47%  2bufF  [x.x.x] ACETYLGLUTAMATE KINASE
    7e-70  52%  2btyA  [x.x.x] ACETYLGLUTAMATE KINASE
    3e-68  48%  2bufJ  [x.x.x] ACETYLGLUTAMATE KINASE
    7e-64  48%  2bufK  [x.x.x] ACETYLGLUTAMATE KINASE
    3e-58  46%  2rd5B  [x.x.x] ACETYLGLUTAMATE KINASE-LIKE PROTEIN
    3e-58  46%  2rd5A  [x.x.x] ACETYLGLUTAMATE KINASE-LIKE PROTEIN
    1e-32  34%  2ap9E  [x.x.x] ACETYLGLUTAMATE KINASE
    1e-32  34%  2ap9B  [x.x.x] ACETYLGLUTAMATE KINASE
    1e-32  34%  2ap9A  [x.x.x] ACETYLGLUTAMATE KINASE
    7e-27  32%  2egxC  [x.x.x] PUTATIVE ACETYLGLUTAMATE KINASE
    4e-26  32%  2egxA  [x.x.x] PUTATIVE ACETYLGLUTAMATE KINASE
    4e-20  29%  1gs5A  [c.73.1] ACETYLGLUTAMATE KINASE
    1e-16  28%  2r8vA  [x.x.x] PUTATIVE ACETYLGLUTAMATE SYNTHASE
    3e-16  26%  3d2pA  [x.x.x] PUTATIVE ACETYLGLUTAMATE SYNTHASE
    5e-15  29%  1gsjA  [c.73.1] ACETYLGLUTAMATE KINASE
    2e-12  28%  2r98A  [x.x.x] PUTATIVE ACETYLGLUTAMATE SYNTHASE
    1e-04  30%  2e9yB  [x.x.x] CARBAMATE KINASE
    1e-04  30%  2e9yA  [x.x.x] CARBAMATE KINASE
    8e-04  33%  2j5tD  [x.x.x] GLUTAMATE 5-KINASE
:294

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxSEIQARLLAQALPFMQKYENKTIVVKYGGHAMGDSTLGKAFAEDIALLKQSGINPIVVHGGGPQI
1uvdA           ---------AKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKAGFARDVVLMKAVGINPVVVHGGGPQI
2bufH           ---------AKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKAGFARDVVLMKAVGINPVVVHGGGPQI
2bufG           ---------AKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKAGFARDVVLMKAVGINPVVVHGGGPQI
2bufC           ---------AKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKAGFARDVVLMKAVGINPVVVHGGGPQI
2bufB           ---------AKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKAGFARDVVLMKAVGINPVVVHGGGPQI
2bufL           ---------AKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKAGFARDVVLMKAVGINPVVVHGGGPQI
2bufD           ---------AKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKAGFARDVVLMKAVGINPVVVHGGGPQI
2v5hF           --------RVRILSEALPYLQQFAGRTVVVKYGGAAMKQEELKEAVMRDIVFLACVGMRPVVVHGGGPEI
2v5hD           --------RVRILSEALPYLQQFAGRTVVVKYGGAAMKQEELKEAVMRDIVFLACVGMRPVVVHGGGPEI
2v5hB           --------RVRILSEALPYLQQFAGRTVVVKYGGAAMKQEELKEAVMRDIVFLACVGMRPVVVHGGGPEI
2v5hA           --------RVRILSEALPYLQQFAGRTVVVKYGGAAMKQEELKEAVMRDIVFLACVGMRPVVVHGGGPEI
2jj4C           --------RVRILSEALPYLQQFAGRTVVVKYGGAAMKQEELKEAVMRDIVFLACVGMRPVVVHGGGPEI
2bufA           ---------AKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKAGFARDVVLMKAVGINPVVVHGGGPQI
2bufI           ---------AKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKAGFARDVVLMKAVGINPVVVHGGGPQI
2bufE           ---------AKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKAGFARDVVLMKAVGINPVVVHGGGPQI
2bufF           ---------AKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKAGFARDVVLMKAVGINPVVVHGGGPQI
2btyA           -----------VLLEALPYIKEFYGKTFVIKFGGSAMKQENAKKAFIQDIILLKYTGIKPIIVHGGGPAI
2bufJ           ---------AKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKAGFARDVVLMKAVGINPVVVHGGGPQI
2bufK           ---------AKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKAGFARDVVLMKAVGINPVVVHGGGPQI
2rd5B           ------DYRVEILSESLPFIQKFRGKTIVVKYGGAAMTSPELKXXXXXXXXXXACVGLRPILVHGGGPDI
2rd5A           ------DYRVEILSESLPFIQKFRGKTIVVKYGGAAMTSPELKXXXXXXXXXXACVGLRPILVHGGGPDI
2ap9E           -----THIKAQVLAEALPWLKQLHGKVVVVKYGGNXXXXXXXXXXXXXXXXX--NCGIXXXXXXXXXXQI
2ap9B           -----THIKAQVLAEALPWLKQLHGKVVVVKYGGNXXXXXXXXXXXXXXXXX--NCGIXXXXXXXXXXQI
2ap9A           -----THIKAQVLAEALPWLKQLHGKVVVVKYGGNXXXXXXXXXXXXXXXXX--NCGIXXXXXXXXXXQI
2egxC           ---------------------------IVVKVGG---AEGINYEAVAKDAASLWKEGVKLLLVHGGSAET
2egxA           ---------------------------IVVKVGG---AEGINYEAVAKDAASLWKEGVKLLLVHGGSAET
1gs5A           ---------------------------LIIKLGGVLLDSEEALERLFSALVNYRESHQRPLVVHGGGCVV
2r8vA           --------------EAAPYIRQMRGTTLVAGIDGRLLEGGTLNK-LAADIGLLSQLGIRLVLIHGAYHFL
3d2pA           --------------EAAPYIRQMRGTTLVAGIDGRLLEGGTLNK-LAADIGLLSQLGIRLVLIHGAYHFL
1gsjA           ---------------------------LIIKLGGVLLDSEEALERLFSALVNYRESHQRPLVVHGGGCVV
2r98A           --------------EAAPYIRQ-RGTTLVAGIDGRLLEGGTLNK-LAADIGLLSQLGIRLVLIHGAYHFL
2e9yB           ----------------------------------------------------------------------
2e9yA           ----------------------------------------------------------------------
2j5tD           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GAMLSKMGIESKFEGGLRVTDAKTVEIVEMVLAGSINKEIVALINQTGEWAIGLCGKDGNMVFAEKAKKT
1uvdA           GDLLKRLSIESHFIDGMRVTDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAELIRAKKLTVT
2bufH           GDLLKRLSIESHFIDGMRVTDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAELIRAKKLTVT
2bufG           GDLLKRLSIESHFIDGMRVTDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAELIRAKKLTVT
2bufC           GDLLKRLSIESHFIDGMRVTDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAELIRAKKLTVT
2bufB           GDLLKRLSIESHFIDGMRVTDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAELIRAKKL--T
2bufL           GDLLKRLSIESHFIDGMRVTDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAELIRAKKLTVT
2bufD           GDLLKRLSIESHFIDGMRVTDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAELI---RAKKL
2v5hF           NAWLGRVGIEPQFHNGLRVTDADTMEVVEMVLVGRVNKDIVSRINTTGGRAVGFCGTDGRLVLARPHDQE
2v5hD           NAWLGRVGIEPQFHNGLRVTDADTMEVVEMVLVGRVNKDIVSRINTTGGRAVGFCGTDGRLVLARPHDQE
2v5hB           NAWLGRVGIEPQFHNGLRVTDADTMEVVEMVLVGRVNKDIVSRINTTGGRAVGFCGTDGRLVLARPHDQE
2v5hA           NAWLGRVGIEPQFHNGLRVTDADTMEVVEMVLVGRVNKDIVSRINTTGGRAVGFCGTDGRLVLARPHDQE
2jj4C           NAWLGRVGIEPQFHNGLRVTDADTMEVVEMVLVGRVNKDIVSRINTTGGRAVGFCGTDGRLVLARPHDQE
2bufA           GDLLKRLSIESHFIDGMRVTDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAELIRAKKLTVT
2bufI           GDLLKRLSIESHFIDGMRVTDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAELIRAKKLTVT
2bufE           GDLLKRLSIESHFIDGMRVTDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAELIRAKKLTVT
2bufF           GDLLKRLSIESHFIDGMRVTDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAELI---RAKKL
2btyA           SQMMKDLGIEPVFKNGHRVTDEKTMEIVEMVLVGKINKEIVMNLNLHGGRAVGICGKDSKLIVAEKETKH
2bufJ           GDLLKRLSIESHFIDGMRVTDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAELIRAKK----
2bufK           GDLLKRLSIESH-----RVTDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAELIRAKKLT--
2rd5B           NRYLKQLNIPAEFRDGLRVTDATTMEIVSMVLVGKVNKNLVSLINAAGATAVGLSGHDGRLLTARPV---
2rd5A           NRYLKQLNIPAEFRDGLRVTDATTMEIVSMVLVGKVNKNLVSLINAAGATAVGLSGHDGRLLTARPV---
2ap9E           TA-LRRLGIEGDFKGGFRVTTPEVLDVAR-VLFGQVGRELVNLINAHGPYAVGITGEDAQLFTAVRRSVT
2ap9B           TA-LRRLGIEGDFKGGFRVTTPEVLDVAR-VLFGQVGRELVNLINAHGPYAVGITGEDAQLFTAVRRSVT
2ap9A           TA-LRRLGIEGDFKGGFRVTTPEVLDVAR-VLFGQVGRELVNLINAHGPYAVGITGEDAQLFTAVRRSVT
2egxC           NKVAEALGHPPRFPGGQRLTDRKTLEIFEMVYCGLVNKRLVELLQKEGANAIGLSGLDGRL-FVGRRKTA
2egxA           NKVAEALGHPPRFVS--RLTDRKTLEIFEMVYCGLVNKRLVELLQKEGANAIGLSGLDGRLFVGRRK---
1gs5A           DELMKGLNLPVKKKNGLRVTPADQIDIITGALAGTANKTLLAWAKKHQIAAVGLFLGDGDSV-----KVT
2r8vA           DRLAAAQGRTPHYCRGLRVTDETSLGQAQQ-FAGTVRSRFEA----------ALCGSSVPLVFLTARPIG
3d2pA           DRLAAAQGRTPHYCRGLRVTDETSLGQAQQ-FAGTVRSRFEA----------ALCGSVSG--FARAPSVP
1gsjA           DE-LKGLNLPVKKKNGLRVTPADQIDIITGALAGTANKTLLAWAKKHQIAAVGLFLGDGDSV-----KVT
2r98A           DRLAAAQGRTPHYCRGLRVTDETSLGQAQQ-FAGTVRSRFEA----------ALCGSSVPLVFLTARPIG
2e9yB           ----------------------------------------------------------------------
2e9yA           ----------------------------------------------------------------------
2j5tD           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           VIDPDSNIERVLDLGFVGEVVEVDRTLLDLLAKSEMIPVIAPVAPGRDGATYNINADTFAGAIAGALHAT
1uvdA           RQTPEMTKPEIIDIGHVGEVTGVNVGLLNMLVKGDFIPVIAPIGVGSNGESYNINADXXXXXXXXXXXXX
2bufH           RQTPEMTKPEIIDIGHVGEVTGVNVGLLNMLVKGDFIPVIAPIGVGSNGESYNINADXXXXXXXXXXXXX
2bufG           RQTPEMTKPEIIDIGHVGEVTGVNVGLLNMLVKGDFIPVIAPIGVGSNGESYNINADXXXXXXXXXXXXX
2bufC           RQTPEMTKPEIIDIGHVGEVTGVNVGLLNMLVKGDFIPVIAPIGVGSNGESYNINADXXXXXXXXXXXXX
2bufB           VTRQEMTKPEIIDIGHVGEVTGVNVGLLNMLVKGDFIPVIAPIGVGSNGESYNINADXXXXXXXXXXXXX
2bufL           RQKPE-----IIDIGHVGEVTGVNVGLLNMLVKGDFIPVIAPIGVGSNGESYNINADXXXXXXXXXXXXX
2bufD           TVTRQTKPE-IIDIGHVGEVTGVNVGLLNMLVKGDFIPVIAPIGVGSNGESYNINADXXXXXXXXXXXXX
2v5hF           ------------GIGFVGEVNSVNSEVIEPLLERGYIPVISSVAADENGQSFNINADTVAGEIAAALNAE
2v5hD           ------------GIGFVGEVNSVNSEVIEPLLERGYIPVISSVAADENGQSFNINADTVAGEIAAALNAE
2v5hB           ------------GIGFVGEVNSVNSEVIEPLLERGYIPVISSVAADENGQSFNINADTVAGEIAAALNAE
2v5hA           ------------GIGFVGEVNSVNSEVIEPLLERGYIPVISSVAADENGQSFNINADTVAGEIAAALNAE
2jj4C           ------------GIGFVGEVNSVNSEVIEPLLERGYIPVISSVAADENGQSFNINADTVAGEIAAALNAE
2bufA           --------RQIIDIGHVGEVTGVNVGLLNMLVKGDFIPVIAPIGVGSNGESYNINADXXXXXXXXXXXXX
2bufI           --------REIIDIGHVGEVTGVNVGLLNMLVKGDFIPVIAPIGVGSNGESYNINADXXXXXXXXXXXXX
2bufE           II----------DIGHVGEVTGVNVGLLNMLVKGDFIPVIAPIGVGSNGESYNINADXXXXXXXXXXXXX
2bufF           TV---TRQPEIIDIGHVGEVTGVNVGLLNMLVKGDFIPVIAPIGVGSNGESYNINADXXXXXXXXXXXXX
2btyA           G-----------DIGYVGKVKKVNPEILHALIENDYIPVIAPVGIGEDGHSYNINADTAAAEIAKSLMAE
2bufJ           -------------LGHVGEVTGVNVGLLNMLVKGDFIPVIAPIGVGSNGESYNINADXXXXXXXXXXXXX
2bufK           ----------------VGEVTGVNVGLLNMLVKGDFIPVIAPIGVGSNGESYNINADXXXXXXXXXXXXX
2rd5B           ---PNS-----AQLGFVGEVARVDPSVLRPLVDYGYIPVIASVAADDSGQAYNINADTVXXXXXXXXXXX
2rd5A           ---PNS-----AQLGFVGEVARVDPSVLRPLVDYGYIPVIASVAADDSGQAYNINADTVXXXXXXXXXXX
2ap9E           VDGVAT------DIGLVGDVDQVNTAALDLVAAGR-IPVVSTLAPDADGVVHNINXXXXXXXXXXXXXXX
2ap9B           VDGVAT------DIGLVGDVDQVNTAALDLVAAGR-IPVVSTLAPDADGVVHNINXXXXXXXXXXXXXXX
2ap9A           VDGVAT------DIGLVGDVDQVNTAALDLVAAGR-IPVVSTLAPDADGVVHNINXXXXXXXXXXXXXXX
2egxC           VKYVKVKVHRG---DYTGTVEEVNKAXXXXXXQAGYLPVLTPPALSYENEAINTDGDQIAALLATLYGAE
2egxA           --------------DYTGTVEEVNKAXXXXXXQAGYLPVLTPPALSYENEAINTDGDQIAALLATLYGAE
1gs5A           QLDE--------ELGHVGLAQPGSPKLINSLLENGYLPVVSSIGVTDEGQLMNVN-XXXXXXXXXXXXXX
2r8vA           VIDG-------TDMEYAGVIRKTDTAALRFQLDAGNIVWMPPLGHSYGGKTFNLDMXXXXXXXXXXXXXE
3d2pA           LVSGNFLTARPIDMEYAGVIRKTDTAALRFQLDAGNIVWMPPLGHSYGGKTFNLDMXXXXXXXXXXXXXE
1gsjA           QLDE--------ELGHVGLAQPGSPKLINSLLENGYLPVVSSIGVTDEG-QLNVN-XXXXXXXXXXXXXX
2r98A           VIDGTDE--------YAGVIRKTDTAALRFQLDAGNI-VWPPLGHSYGGKTFNLD-XXXXXXXXXXXXXE
2e9yB           -----------------------------------------------------VDKDLASSLLATQLNAD
2e9yA           -----------------------------------------------------VDKDLASSLLATQLNAD
2j5tD           ------------------------RDTLRALLDNNVVPVINEVATAEIKVGDNDNLSALAAILAGA---D


                         .         .         .         +         .         .         .:280
query           RLLFLTDVPGVLDKNKELIKELTVSEARALIKDGTISGGMIPKVETCIDAIKAGVQGVVILNGKTPHSVL
1uvdA           XXXXXTNIAGLMDKQGQVLTGLSTEQVNELIADGTIYGGMLPKIRCALEAVQGGVTSAHIIDGRVPNAVL
2bufH           XXXXXTNIAGLMDKQGQVLTGLSTEQVNELIADGTIYGGMLPKIRCALEAVQGGVTSAHIIDGRVPNAVL
2bufG           XXXXXTNIAGLMDKQGQVLTGLSTEQVNELIADGTIYGGMLPKIRCALEAVQGGVTSAHIIDGRVPNAVL
2bufC           XXXXXTNIAGLMDKQGQVLTGLSTEQVNELIADGTIYGGMLPKIRCALEAVQGGVTSAHIIDGRVPNAVL
2bufB           XXXXXTNIAGLMDKQGQVLTGLSTEQVNELIADGTIYGGMLPKIRCALEAVQGGVTSAHIIDGRVPNAVL
2bufL           XXXXXTNIAGLMDKQGQVLTGLSTEQVNELIADGTIYGGMLPKIRCALEAVQGGVTSAHIIDGRVPNAVL
2bufD           XXXXXTNIAGLMDKQGQVLTGLSTEQVNELIADGTIYGGMLPKIRCALEAVQGGVTSAHIIDGRVPNAVL
2v5hF           KLILLTDTRGILEDPKSLIPRLNIPQSRELIAQGIVGGGMIPKVDCCIRSLAQGVRAAHIIDGRIPHALL
2v5hD           KLILLTDTRGILEDPKSLIPRLNIPQSRELIAQGIVGGGMIPKVDCCIRSLAQGVRAAHIIDGRIPHALL
2v5hB           KLILLTDTRGILEDPKSLIPRLNIPQSRELIAQGIVGGGMIPKVDCCIRSLAQGVRAAHIIDGRIPHALL
2v5hA           KLILLTDTRGILEDPKSLIPRLNIPQSRELIAQGIVGGGMIPKVDCCIRSLAQGVRAAHIIDGRIPHALL
2jj4C           KLILLTDTRGILEDPKSLIPRLNIPQSRELIAQGIVGGGMIPKVDCCIRSLAQGVRAAHIIDGRIPHALL
2bufA           XXXXXTNIAGLMDKQGQVLTGLSTEQVNELIADGTIYGGMLPKIRCALEAVQGGVTSAHIIDGRVPNAVL
2bufI           XXXXXTNIAGLMDKQGQVLTGLSTEQVNELIADGTIYGGMLPKIRCALEAVQGGVTSAHIIDGRVPNAVL
2bufE           XXXXXTNIAGLMDKQGQVLTGLSTEQVNELIADGTIYGGMLPKIRCALEAVQGGVTSAHIIDGRVPNAVL
2bufF           XXXXXTNIAGLMDKQGQVLTGLSTEQVNELIADGTIYGGMLPKIRCALEAVQGGVTSAHIIDGRVPNAVL
2btyA           KLILLTDVDGVL-KDGKLISTLTPDEAEELIRDGTVTGGMIPKVECXXXXXXXXXXXXHIINGGLEHAIL
2bufJ           XXXXXTNIAGLMDKQGQVLTGLSTEQVNELIADGTIYGGMLPKIRCALEAVQGGVTSAHIIDGRVPNAVL
2bufK           XXXXXTNIAGLMDKQGQVLTGLSTEQVNELIADGTIYGGMLPKIRCALEAVQGGVTSAHIIDGRVPNAVL
2rd5B           XXXXXTDVAGILE-NKELIKEIDIKGVKKMIEDGKVAGGMIPKVKCCIRSLAQGVKTASIIDGRRQHSLL
2rd5A           XXXXXTDVAGILE-NKELIKEIDIKGVKKMIEDGKVAGGMIPKVKCCIRSLAQGVKTASIIDGRRQHSLL
2ap9E           XXXX-TDIDGLYTRRDSLVSEIDTGTLAQLLP--TLELG-VPKVEACLRAVIGGVPSAHIIDGRVTHCVL
2ap9B           XXXX-TDIDGLYTRRDSLVSEIDTGTLAQLLP--TLELG-VPKVEACLRAVIGGVPSAHIIDGRVTHCVL
2ap9A           XXXX-TDIDGLYTRRDSLVSEIDTGTLAQLLP--TLELG-VPKVEACLRAVIGGVPSAHIIDGRVTHCVL
2egxC           ALVYLSNVPGLLAREASLVREIPVERIEDPEYLALAQGRMKRKVMGAVEAVKGGVKRVVFADGRVENPIR
2egxA           ALVYLSNVPGLL---ASLVREIPVERIEDPEYLALAQGRMKRKVMGAVEAVKGGVKRVVFADGRVENPIR
1gs5A           XXXXXSDVSGILDGKGQRIAEMTAAKAEQLIEQGIITDGMIVKVNAALDAAR------------------
2r8vA           KLVYLTLSDGISRPDGTLAETLSAQEAQSLAEHAASETRRL--ISSAVAALEGGVHRVQILNGAADGSLL
3d2pA           KLVYLTLSDGISRPDGTLAETLSAQEAQSLAEHAASETRRL--ISSAVAALEGGVHRVQILNGAADGSLL
1gsjA           XXXXXSDVSGILDGKGQRIAE-TAAKAEQLIEQGIITDGIV-KVNAALDAARTLGRPVDIASWR--HAEQ
2r98A           KLVYLTLSDGISRPDGTLAETLSAQEAQSLAEHAASETRRL--ISSAVAALEGGVHRVQILNGAADGSLL
2e9yB           LLVILTDVPGVAREGERWLRRAAASELKKYLREGHFPGSMGPKVEAAISFVERTGKPAVIGSLEEARQVL
2e9yA           LLVILTDVPGVAREGERWLRRAAASELKKYLREGHFPGSMGPKVEAAISFVERTGKPAVIGSLEEARQVL
2j5tD           KLLLLTDQKGLYNPQAELIKDVYIDDALRAIAGDSVSGGMSTKLQAADVACRAGIDTIIAAGSK------


                         .         *         .         .         .         .         +:350
query           LEIFTEGAGTLIVx
1uvdA           LEIFTDGVGTLI--
2bufH           LEIFTDGVGTLI--
2bufG           LEIFTDGVGTLI--
2bufC           LEIFTDGVGTLI--
2bufB           LEIFTDGVGTLI--
2bufL           LEIFTDGVGTLI--
2bufD           LEIFTDGVGTLI--
2v5hF           LEIFTDGIGTMIV-
2v5hD           LEIFTDGIGTMIV-
2v5hB           LEIFTDGIGTMIV-
2v5hA           LEIFTDGIGTMIV-
2jj4C           LEIFTDGIGTMIV-
2bufA           LEIFTDGVGTLI--
2bufI           LEIFTDGVGTLI--
2bufE           LEIFTDGVGTLI--
2bufF           LEIFTDGVGTLI--
2btyA           LEIFSKGIGTMI--
2bufJ           LEIFTDGVGTLI--
2bufK           LEIFTDGVGTLI--
2rd5B           HEIMSEGAGTMI--
2rd5A           HEIMSEGAGTMI--
2ap9E           VELFTDGTGTKVV-
2ap9B           VELFTDGTGTKVV-
2ap9A           VELFTDGTGTKVV-
2egxC           RALSGEG-------
2egxA           RALSGEG-------
1gs5A           --------------
2r8vA           QELFTNGIGTSI--
3d2pA           QELFTNGIGTSI--
1gsjA           LPALFNGPGTRIL-
2r98A           QELFTNGIGTSI--
2e9yB           ----SLQAGTVVM-
2e9yA           ----SLQAGTVVM-
2j5tD           --------------