[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for atum0:AAK86297.2

[Show Plain Result]

#ERROR : Can't open dsspfile "1a04A.bssp"
#ERROR : Can't open dsspfile "1rnlA.bssp"
#ERROR : Can't open dsspfile "1yioA.bssp"
#ERROR : Can't open dsspfile "3c3wB.bssp"
#ERROR : Can't open dsspfile "3c3wA.bssp"
#ERROR : Can't open dsspfile "1zlkA.bssp"
#ERROR : Can't open dsspfile "3eulC.bssp"
#ERROR : Can't open dsspfile "3eulB.bssp"
#ERROR : Can't open dsspfile "3eulA.bssp"
#ERROR : Can't open dsspfile "3c57A.bssp"
#ERROR : Can't open dsspfile "3c57B.bssp"
#ERROR : Can't open dsspfile "1x3uA.bssp"
#ERROR : Can't open dsspfile "2rnjA.bssp"
#ERROR : Can't open dsspfile "1zljA.bssp"
#ERROR : Can't open dsspfile "1fseE.bssp"
#ERROR : Can't open dsspfile "1fseD.bssp"
#ERROR : Can't open dsspfile "1fseB.bssp"
#ERROR : Can't open dsspfile "1fseA.bssp"
#ERROR : Can't open dsspfile "1zljD.bssp"
#ERROR : Can't open dsspfile "1zljB.bssp"
#ERROR : Can't open dsspfile "2qsjB.bssp"
#ERROR : Can't open dsspfile "1fspA.bssp"
#ERROR : Can't open dsspfile "1srrC.bssp"
#ERROR : Can't open dsspfile "1srrB.bssp"
#ERROR : Can't open dsspfile "1srrA.bssp"
#ERROR : Can't open dsspfile "1peyC.bssp"
#ERROR : Can't open dsspfile "2jviA.bssp"
#ERROR : Can't open dsspfile "1natA.bssp"
#ERROR : Can't open dsspfile "2jvjA.bssp"
#ERROR : Can't open dsspfile "2jvkA.bssp"
#ERROR : Can't open dsspfile "2qsjA.bssp"
#ERROR : Can't open dsspfile "2ftkE.bssp"
#ERROR : Can't open dsspfile "1dc8A.bssp"
#ERROR : Can't open dsspfile "1dc7A.bssp"
#ERROR : Can't open dsspfile "1p4wA.bssp"
#ERROR : Can't open dsspfile "2oqrA.bssp"
#ERROR : Can't open dsspfile "1udrB.bssp"
#ERROR : Can't open dsspfile "1udrA.bssp"
#ERROR : Can't open dsspfile "2ayzA.bssp"
#ERROR : Can't open dsspfile "2ayxA.bssp"
#ERROR : Can't open dsspfile "3cz5C.bssp"
#ERROR : Can't open dsspfile "3cz5B.bssp"
#ERROR : Can't open dsspfile "3cz5A.bssp"
#ERROR : Can't open dsspfile "1qmpA.bssp"
#ERROR : Can't open dsspfile "1dz3A.bssp"
#ERROR : Can't open dsspfile "1zh4A.bssp"
#ERROR : Can't open dsspfile "1zh2B.bssp"
#ERROR : Can't open dsspfile "1zh2A.bssp"
#ERROR : Can't open dsspfile "3hebA.bssp"

## Summary of PDB Search
:216
    1e-13  26%  1a04A  [c.23.1 - a.4.6] NITRATE/NITRITE RESPONSE REGULATOR PROTEIN
    3e-13  24%  1rnlA  [x.x.x] NITRATE/NITRITE RESPONSE REGULATOR PROTEIN NARL
    5e-13  34%  1yioA  [x.x.x] RESPONSE REGULATORY PROTEIN
    1e-11  34%  3c3wB  [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATORY PROTEIN
    1e-11  34%  3c3wA  [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATORY PROTEIN
    4e-10  48%  1zlkA  [x.x.x] DORMANCY SURVIVAL REGULATOR
    3e-09  28%  3eulC  [x.x.x] POSSIBLE NITRATE/NITRITE RESPONSE TRANSCRIPTIONAL
    3e-09  28%  3eulB  [x.x.x] POSSIBLE NITRATE/NITRITE RESPONSE TRANSCRIPTIONAL
    3e-09  28%  3eulA  [x.x.x] POSSIBLE NITRATE/NITRITE RESPONSE TRANSCRIPTIONAL
    4e-09  50%  3c57A  [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATORY PROTEIN
    1e-08  49%  3c57B  [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATORY PROTEIN
    1e-08  38%  1x3uA  [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
    3e-08  45%  2rnjA  [x.x.x] RESPONSE REGULATOR PROTEIN VRAR
    2e-07  45%  1zljA  [x.x.x] DORMANCY SURVIVAL REGULATOR
    2e-07  38%  1fseE  [a.4.6] GERE
    2e-07  38%  1fseD  [a.4.6] GERE
    2e-07  38%  1fseB  [a.4.6] GERE
    2e-07  38%  1fseA  [a.4.6] GERE
    3e-07  50%  1zljD  [x.x.x] DORMANCY SURVIVAL REGULATOR
    3e-07  50%  1zljB  [x.x.x] DORMANCY SURVIVAL REGULATOR
    8e-07  28%  2qsjB  [x.x.x] DNA-BINDING RESPONSE REGULATOR, LUXR FAMILY
    2e-06  25%  1fspA  [c.23.1 (1puxA)] STAGE 0 SPORULATION PROTEIN F
    2e-06  27%  1srrC  [c.23.1] SPORULATION RESPONSE REGULATORY PROTEIN
    2e-06  27%  1srrB  [c.23.1] SPORULATION RESPONSE REGULATORY PROTEIN
    2e-06  27%  1srrA  [c.23.1] SPORULATION RESPONSE REGULATORY PROTEIN
    2e-06  27%  1peyC  [c.23.1] SPORULATION INITIATION PHOSPHOTRANSFERASE F
    2e-06  25%  2jviA  [x.x.x] SPORULATION INITIATION PHOSPHOTRANSFERASE F
    4e-06  27%  1natA  [x.x.x] SPORULATION RESPONSE REGULATORY PROTEIN
    4e-06  25%  2jvjA  [x.x.x] SPORULATION INITIATION PHOSPHOTRANSFERASE F
    6e-06  25%  2jvkA  [x.x.x] SPORULATION INITIATION PHOSPHOTRANSFERASE F
    8e-06  28%  2qsjA  [x.x.x] DNA-BINDING RESPONSE REGULATOR, LUXR FAMILY
    8e-06  27%  2ftkE  [x.x.x] SPORULATION INITIATION PHOSPHOTRANSFERASE F
    8e-06  26%  1dc8A  [c.23.1] NITROGEN REGULATION PROTEIN
    8e-06  25%  1dc7A  [c.23.1] NITROGEN REGULATION PROTEIN
    1e-05  34%  1p4wA  [a.4.6] RCSB
    2e-05  38%  2oqrA  [x.x.x] SENSORY TRANSDUCTION PROTEIN REGX3
    7e-05  24%  1udrB  [c.23.1] CHEY PROTEIN
    7e-05  24%  1udrA  [c.23.1] CHEY PROTEIN
    1e-04  24%  2ayzA  [x.x.x] SENSOR KINASE PROTEIN RCSC
    1e-04  24%  2ayxA  [x.x.x] SENSOR KINASE PROTEIN RCSC
    3e-04  29%  3cz5C  [x.x.x] TWO-COMPONENT RESPONSE REGULATOR, LUXR FAMILY
    3e-04  29%  3cz5B  [x.x.x] TWO-COMPONENT RESPONSE REGULATOR, LUXR FAMILY
    3e-04  29%  3cz5A  [x.x.x] TWO-COMPONENT RESPONSE REGULATOR, LUXR FAMILY
    3e-04  31%  1qmpA  [c.23.1] SPO0A
    3e-04  31%  1dz3A  [c.23.1] STAGE 0 SPORULATION PROTEIN A
    5e-04  34%  1zh4A  [x.x.x] KDP OPERON TRANSCRIPTIONAL REGULATORY PROTEIN
    5e-04  34%  1zh2B  [x.x.x] KDP OPERON TRANSCRIPTIONAL REGULATORY PROTEIN
    5e-04  34%  1zh2A  [x.x.x] KDP OPERON TRANSCRIPTIONAL REGULATORY PROTEIN
    5e-04  35%  3hebA  [x.x.x] RESPONSE REGULATOR RECEIVER DOMAIN PROTEIN
:216

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSELVIIIADDHPLFRGALKQAVAGLDGQQTIIEAGDFEAARHAATTRNXXXXXXXXXXXPGVSGFSGLM
1a04A           -----ILLIDDHPMLRTGVKQLISMAPDITVVGEASNGEQGIELAESLDPDLILLDLNM-PGMNGLETLD
1rnlA           -----ILLIDDHPMLRTGVKQLISMAPDITVVGEASNGEQGIELAESLDPDLILLDLNM-PGMNGLETLD
1yioA           ------------------------------------------------------------PGMSGIELQE
3c3wB           -----VFLVDDHEVVRRGLVDLLGADPELDVVGEAGSVAEAMXXXXXXXXXXXXXXXXLPDG----NGIE
3c3wA           -----VFLVDDHEVVRRGLVDLLGADPELDVVGEAGSVAEAMXXXXXXXXXXXXXXXXLPDG----NGIE
1zlkA           ----------------------------------------------------------------------
3eulC           -----VVVGDDHPLFREGVVRALS-LSGSVNVVGEADDGAAALELIKAHLPDVALLDYRMPGMDGAQVAA
3eulB           -----VVVGDDHPLFREGVVRALS-LSGSVNVVGEADDGAAALELIKAHLPDVALLDYRMPGMDGAQVAA
3eulA           -----VVVGDDHPLFREGVVRALS-LSGSVNVVGEADDGAAALELIKAHLPDVALLDYRMPGMDGAQVAA
3c57A           ----------------------------------------------------------------------
3c57B           ----------------------------------------------------------------------
1x3uA           ----------------------------------------------------------------------
2rnjA           ----------------------------------------------------------------------
1zljA           ----------------------------------------------------------------------
1fseE           ----------------------------------------------------------------------
1fseD           ----------------------------------------------------------------------
1fseB           ----------------------------------------------------------------------
1fseA           ----------------------------------------------------------------------
1zljD           ----------------------------------------------------------------------
1zljB           ----------------------------------------------------------------------
2qsjB           ----VVLIVDDHHLIRAGAKNLLEGVEGAETVSDALAFLEADNTVDLILLDV------------AIDGLV
1fspA           MNEKILIVDDQYGI--RILLNEVFNKEGYQTFQAANGLQALD--IVTKERPDLVLLDMKIPGMDGIEILK
1srrC           -----ILIVDDQSGIRILLNE-VFNKEGYQTFQAANGLQALD--IVTKERPDLVLLDMKIPGMDGIEILK
1srrB           -----ILIVDDQSGIRILLNE-VFNKEGYQTFQAANGLQALD--IVTKERPDLVLLDMKIPGMDGIEILK
1srrA           -----ILIVDDQSGIRILLNE-VFNKEGYQTFQAANGLQALD--IVTKERPDLVLLDMKIPGMDGIEILK
1peyC           -----ILIVDDQSGIRILLNE-VFNKEGYQTFQAANGLQALD--IVTKERPDLVLLDMKIPGMDGIEILK
2jviA           MNEKILIVDDQYGI--RILLNEVFNKEGYQTFQAANGLQALD--IVTKERPDLVLLDMKIPGMDGIEILK
1natA           -----ILIVDDQYGIRILLNE-VFNKEGYQTFQAANGLQALD--IVTKERPDLVLLDMKIPGMDGIEILK
2jvjA           MNEKILIVDDQYGI--RILLNEVFNKEGYQTFQAANGLQALD--IVTKERPDLVLLDMKIPGMDGIEILK
2jvkA           MNEKILIVDDQYGI--RILLNEVFNKEGYQTFQAANGLQALD--IVTKERPDLVLLDMKIPGMDGIEIAK
2qsjA           ----VVLIVDDHHLIRAGAKNLLEGVEGAETVSDALAFLEADNTVDLILLDV------------AIDGLV
2ftkE           -----ILIVDDQSGIRILLNE-VFNKEGYQTFQAANGLQALDIVTKER---PDLVLLMKIPGMDGIEILK
1dc8A           MQRGIVWVVDDDSSIRWVLERALAGAGLTCTTFENGNEVLAALASKTPDVLLSIRM----PGMDGLALLK
1dc7A           MQRGIVWVVDDDSSIRWVLERALAGAGLTCTTFENGNEVLAALASKTPDVLLSDIRM---PGMDGLALLK
1p4wA           ----------------------------------------------------------------------
2oqrA           ------------------------------------------------------------PGMSGTDVCK
1udrB           --ELKFLVVDDFSTMRRIVRNLLKEL-GFNNVEEAEDGVDALNKLQA-GGYGFVISDWNMPNMDGLELLK
1udrA           --ELKFLVVDDFSTMRRIVRNLLKEL-GFNNVEEAEDGVDALNKLQA-GGYGFVISDWNMPNMDGLELLK
2ayzA           --DMMILVVDDHPINRRLLADQLGSL-GYQCKTANDGVDALN--VLSKNHIDIVLSDVNMPNMDGYRLTQ
2ayxA           --DMMILVVDDHPINRRLLADQLGSL-GYQCKTANDGVDALN--VLSKNHIDIVLSDVNMPNMDGYRLTQ
3cz5C           ------------------------------------------------------------PGPGGIEATR
3cz5B           ------------------------------------------------------------PGPGGIEATR
3cz5A           ------------------------------------------------------------PGPGGIEATR
1qmpA           ------------------------------------------------------------PHLDGLAVLE
1dz3A           ------------------------------------------------------------PHLDGLAVLE
1zh4A           -----VLIVEDEQAIRRFLRTALEG-DGMR-VFEAETLQRGLLEAATRKXXXXXXXXXXXXXXXX-EFIR
1zh2B           -----VLIVEDEQAIRRFLRTALEG-DGMR-VFEAETLQRGLLEAATRKXXXXXXXXXXXXXXXX-EFIR
1zh2A           -----VLIVEDEQAIRRFLRTALEG-DGMR-VFEAETLQRGLLEAATRKXXXXXXXXXXXXXXXX-EFIR
3hebA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ALRAEFSSLPIVIVSATDDATTVRRSIELGASGFISKSSGIDDIRDGIRAVLEGDVWIPSGHQGEKEQDP
1a04A           KLREKSLSGRIVVFSVSNHEEDVVTALKRGADGYLLKDMEPEDLLKALHQAAAGEMVL------SEALTP
1rnlA           KLREKSLSGRIVVFSVSNHEEDVVTALKRGADGYLLKDMEPEDLLKALHQAAAGEMVLSEA---------
1yioA           QLTAISDGIPIVFITAHGDIPMTVRAMKAGAIEFLPKPFEEQALLDAIEQGLQLNA--------ERRQAR
3c3wB           LCRDLLSRMPLILTSYTSDEAMLD-AILAGASGYVVKDIKGMELARAVKDVGAGXXXXXXXXXXXEKQDP
3c3wA           LCRDLLSRMPLILTSYTSDEAMLD-AILAGASGYVVKDIKGMELARAVKDVGAGXXXXXXXXXXXEKQDP
1zlkA           ----------------------------------------------------------------------
3eulC           AVRSYELPTRVLLISAHDEPAIVYQALQQGAAGFLLKDSTRTEI---VKAVLD-----------------
3eulB           AVRSYELPTRVLLISAHDEPAIVYQALQQGAAGFLLKDSTRTEI---VKAVLD-----------------
3eulA           AVRSYELPTRVLLISAHDEPAIVYQALQQGAAGFLLKDSTRTEI---VKAVLD-----------------
3c57A           ----------------------------------------------------------------------
3c57B           ----------------------------------------------------------------------
1x3uA           ----------------------------------------------------------------------
2rnjA           ----------------------------------------------------------------------
1zljA           ----------------------------------------------------------------------
1fseE           ----------------------------------------------------------------------
1fseD           ----------------------------------------------------------------------
1fseB           ----------------------------------------------------------------------
1fseA           ----------------------------------------------------------------------
1zljD           ----------------------------------------------------------------------
1zljB           ----------------------------------------------------------------------
2qsjB           RLKRFDPSNAVALISGEHEL--IRAALEAGADGFIPKSADPQVLIHAVSLILEGEIFLPRSY--------
1fspA           RMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYL------------------
1srrC           RMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYL------------------
1srrB           RMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYL------------------
1srrA           RMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYL------------------
1peyC           RMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYL------------------
2jviA           RMKVIDENIRVIIMTAYGELDMIQESKELGALTAFAKPFDIDEIRDAVKKYL------------------
1natA           RMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYL------------------
2jvjA           RMKVIDENIRVIIMTAYGELDMAQESKELGALTHFAKPFDIDEIRDAVKKYL------------------
2jvkA           RMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYL------------------
2qsjA           RLKRFDPSNAVALIHEL-----IRAALEAGADGFIPKSADPQVLIHAVSLILEGEIFLPRSY--------
2ftkE           RMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYL------------------
1dc8A           QIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDE---------------------------
1dc7A           QIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDE---------------------------
1p4wA           ----------------------------------------------------------------------
2oqrA           QLRAR-SSVPVIMVTARDSEIDKVVGLELGADDYVTKPYSARELIARIRAVL------------------
1udrB           TIRADMSALPVLMVTAEADAENIKALAQAGASGYVVKPFTAATLEEKLNKIFE-----------------
1udrA           TIRADMSALPVLMVTAEADAENIKALAQAGASGYVVKPFTAATLEEKLNKIFE-----------------
2ayzA           RIRQLGLTLPVIGVTANALAEEKQRCLESGMDSCLSKPVTLDVIKQTLTLYAE-----------------
2ayxA           RIRQLGLTLPVIGVTANALAEEKQRCLESGMDSCLSKPVTLDVIKQTLTLYAE-----------------
3cz5C           HIRQWDGAARILIFTMHQGSAFALKAFEAGASGYVTKSSDPAELVQAIEAIL----------AGRRAMSP
3cz5B           HIRQWDGAARILIFTMHQGSAFALKAFEAGASGYVTKSSDPAELVQAIEAIL----------AGRRAMSP
3cz5A           HIRQWDGAARILIFTMHQGSAFALKAFEAGASGYVTKSSDPAELVQAIEAIL----------AGRRAMSP
1qmpA           RIRAGFEHQPVIMLTAFGQEDVTKKAVELGASYFILKPFDMENLAHHIRQV-------------------
1dz3A           RIRAGFEHQPVIMLTAFGQEDVTKKAVELGASYFILKPFDMENLAHHIRQV-------------------
1zh4A           DLR-QWSAVPVIVLSARSEESDKIAALDAGADDYLSKPFGIGELQARLRVAL------------------
1zh2B           DLR-QWSAVPVIVLSARSEESDKIAALDAGADDYLSKPFGIGELQARLRVAL------------------
1zh2A           DLR-QWSAVPVIVLSARSEESDKIAALDAGADDYLSKPFGIGELQARLRVAL------------------
3hebA           ---------PVVILTTTDDQREIQRCYDLGANVYITKPVNYENFANAIR---------------------


                         +         .         .         .         .         *         .:210
query           DVADLIGRLRTLTPQQSRVLGMLAEGLLNKQIAYELNVSEATIKAHVSAILLKLKVDSRTQAVIQLAKIN
1a04A           VLAASLERVNQLTPRERDILKLIAQGLPNKMIARRLDITESTVXXXXXXXXXXXXXXSRVEAAV------
1rnlA           -LTPVLAASLQLTPRERDILKLIAQGLPNKMIARRLDITESTVXXXXXXXXXXXXXXSRVEAAV------
1yioA           ETQDQLEQLSSLTGREQQVLQLTIRGLMNKQIAGELGIAEVTVKVHRHNIMQKLNVRSLANLV-------
3c3wB           --------LSGLTDQERTLLGLLSEGLTNKQIADRMFLAEKTVKNYVSRLLAKLGMERRTQAAVFATELK
3c3wA           --------LSGLTDQERTLLGLLSEGLTNKQIADRMFLAEKTVKNYVSRLLAKLGMERRTQAAVFATELK
1zlkA           --------LSGLTDQERTLLGLLSEGLTNKQIADRMFLAEKTVKNYVSRLLAKLGMERRTQAAV------
3eulC           ----------------------------------------------------------------------
3eulB           ----------------------------------------------------------------------
3eulA           ----------------------------------------------------------------------
3c57A           -----------LTDQERTLLGLLSEGLTNKQIADRMFLAEKTVKNYVSRLLAKLGMERRTQ---------
3c57B           ------------TDQERTLLGLLSEGLTNKQIADRMFLAEKTVKNYVSRLLAKLGMERRTQ---------
1x3uA           DANDIRARLQTLSERERQVLSAVVAGLPNKSIAYDLDISPRTVEVHRANVMAKMKAKS------------
2rnjA           -----------LTEREMEILLLIAKGYSNQEIASASHITIKTVKTHVSNILSKLEVQDRTQAVI------
1zljA           --------LSGLTDQERTLLGLLSEGLTNKQIA-DRFLAEKTVKNYVSRLLAKLG-ERRTQAAVFATELK
1fseE           -----------LTKREREVFELLVQDKTTKEIASELFISEKTVRNHISNAMQKLGVKGRSQAVVELLRM-
1fseD           -----------LTKREREVFELLVQDKTTKEIASELFISEKTVRNHISNAMQKLGVKGRSQAVVELLRM-
1fseB           -----------LTKREREVFELLVQDKTTKEIASELFISEKTVRNHISNAMQKLGVKGRSQAVVELLRM-
1fseA           -----------LTKREREVFELLVQDKTTKEIASELFISEKTVRNHISNAMQKLGVKGRSQAVVELLRM-
1zljD           --------LSGLTDQERTLLGLLSEGLTNKQIA-DRFLAEKTVKNYVSRLLAKLG-ERRTQAAV------
1zljB           --------LSGLTDQERTLLGLLSEGLTNKQIA-DRFLAEKTVKNYVSRLLAKLG-ERRTQAAV------
2qsjB           ----------------------------------------------------------------------
1fspA           ----------------------------------------------------------------------
1srrC           ----------------------------------------------------------------------
1srrB           ----------------------------------------------------------------------
1srrA           ----------------------------------------------------------------------
1peyC           ----------------------------------------------------------------------
2jviA           ----------------------------------------------------------------------
1natA           ----------------------------------------------------------------------
2jvjA           ----------------------------------------------------------------------
2jvkA           ----------------------------------------------------------------------
2qsjA           ----------------------------------------------------------------------
2ftkE           ----------------------------------------------------------------------
1dc8A           ----------------------------------------------------------------------
1dc7A           ----------------------------------------------------------------------
1p4wA           ---------KRLSPKESEVLRLFAEGFLVTEIAKKLNRSIKTISSQKKSAMMKLGVDNDIALLNYLSSVS
2oqrA           ----------------------------------------------------------------------
1udrB           ----------------------------------------------------------------------
1udrA           ----------------------------------------------------------------------
2ayzA           ----------------------------------------------------------------------
2ayxA           ----------------------------------------------------------------------
3cz5C           DIAQEIAEER------------------------------------------------------------
3cz5B           DIAQEIAEER------------------------------------------------------------
3cz5A           DIAQEIAEER------------------------------------------------------------
1qmpA           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
1zh4A           ----------------------------------------------------------------------
1zh2B           ----------------------------------------------------------------------
1zh2A           ----------------------------------------------------------------------
3hebA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           TSxxxx
1a04A           ------
1rnlA           ------
1yioA           ------
3c3wB           RS----
3c3wA           RS----
1zlkA           ------
3eulC           ------
3eulB           ------
3eulA           ------
3c57A           ------
3c57B           ------
1x3uA           ------
2rnjA           ------
1zljA           RS----
1fseE           ------
1fseD           ------
1fseB           ------
1fseA           ------
1zljD           ------
1zljB           ------
2qsjB           ------
1fspA           ------
1srrC           ------
1srrB           ------
1srrA           ------
1peyC           ------
2jviA           ------
1natA           ------
2jvjA           ------
2jvkA           ------
2qsjA           ------
2ftkE           ------
1dc8A           ------
1dc7A           ------
1p4wA           ------
2oqrA           ------
1udrB           ------
1udrA           ------
2ayzA           ------
2ayxA           ------
3cz5C           ------
3cz5B           ------
3cz5A           ------
1qmpA           ------
1dz3A           ------
1zh4A           ------
1zh2B           ------
1zh2A           ------
3hebA           ------