[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for atum0:cheD.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2f9zC.bssp"

## Summary of PDB Search
:181
    9e-25  43%  2f9zC  [x.x.x] PROTEIN (CHEMOTAXIS METHYLATION PROTEIN)
:181

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxGEYKVVSDPDVVMTTILGSCVAACLRDPVAGLGGMNHFLLPGTGNVTGGDATRYGVH
2f9zC           -------------GEYAVMKNPGVIVTLGLGSCVAVCMRDPVAKVGAMAHVMLPDSGGKTDKPG-KYADT


                         .         .         *         .         .         .         .:140
query           LMELLINGLLKQGARRDRLEAKVFGGAKTIASFSNVGEQNAIFAMQFLKDEGIPVISSSTGGDHGRKIEF
2f9zC           AVKTLVEELKKMGAKVERLEAKIAGGASMFESKGNIGARNVEAVKKHLKDFGIKLLAEDTGGNRARSVEY


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2f9zC           -----------------------------------------