[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for atum0:cfa.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1kp9A.bssp"
#ERROR : Can't open dsspfile "1l1eB.bssp"
#ERROR : Can't open dsspfile "1kpiA.bssp"
#ERROR : Can't open dsspfile "1l1eA.bssp"
#ERROR : Can't open dsspfile "1kphB.bssp"
#ERROR : Can't open dsspfile "1kphA.bssp"
#ERROR : Can't open dsspfile "2fk8A.bssp"
#ERROR : Can't open dsspfile "1tpyA.bssp"
#ERROR : Can't open dsspfile "2fk7A.bssp"
#ERROR : Can't open dsspfile "3ha7A.bssp"
#ERROR : Can't open dsspfile "1kpgD.bssp"
#ERROR : Can't open dsspfile "1kpgB.bssp"
#ERROR : Can't open dsspfile "1kpgA.bssp"
#ERROR : Can't open dsspfile "3dtnB.bssp"
#ERROR : Can't open dsspfile "3dtnA.bssp"
#ERROR : Can't open dsspfile "3f4kA.bssp"
#ERROR : Can't open dsspfile "3d2lC.bssp"
#ERROR : Can't open dsspfile "3d2lA.bssp"
#ERROR : Can't open dsspfile "3bkxA.bssp"
#ERROR : Can't open dsspfile "1nkvC.bssp"

## Summary of PDB Search
:418
    7e-35  37%  1kp9A  [c.66.1] CYCLOPROPANE-FATTY-ACYL-PHOSPHOLIPID SYNTHASE 1
    2e-34  35%  1l1eB  [c.66.1] MYCOLIC ACID SYNTHASE
    2e-34  37%  1kpiA  [c.66.1] CYCLOPROPANE-FATTY-ACYL-PHOSPHOLIPID SYNTHASE 2
    5e-33  35%  1l1eA  [c.66.1] MYCOLIC ACID SYNTHASE
    9e-33  34%  1kphB  [c.66.1] CYCLOPROPANE-FATTY-ACYL-PHOSPHOLIPID SYNTHASE 1
    9e-33  34%  1kphA  [c.66.1] CYCLOPROPANE-FATTY-ACYL-PHOSPHOLIPID SYNTHASE 1
    1e-31  35%  2fk8A  [x.x.x] METHOXY MYCOLIC ACID SYNTHASE 4
    4e-30  38%  1tpyA  [c.66.1] METHOXY MYCOLIC ACID SYNTHASE 2
    1e-29  35%  2fk7A  [x.x.x] METHOXY MYCOLIC ACID SYNTHASE 4
    3e-28  34%  3ha7A  [x.x.x] METHOXY MYCOLIC ACID SYNTHASE 4
    2e-25  33%  1kpgD  [c.66.1] CYCLOPROPANE-FATTY-ACYL-PHOSPHOLIPID SYNTHASE 1
    2e-25  33%  1kpgB  [c.66.1] CYCLOPROPANE-FATTY-ACYL-PHOSPHOLIPID SYNTHASE 1
    2e-25  33%  1kpgA  [c.66.1] CYCLOPROPANE-FATTY-ACYL-PHOSPHOLIPID SYNTHASE 1
    1e-05  25%  3dtnB  [x.x.x] PUTATIVE METHYLTRANSFERASE MM_2633
    1e-05  25%  3dtnA  [x.x.x] PUTATIVE METHYLTRANSFERASE MM_2633
    8e-05  25%  3f4kA  [x.x.x] PUTATIVE METHYLTRANSFERASE
    1e-04  33%  3d2lC  [x.x.x] SAM-DEPENDENT METHYLTRANSFERASE
    1e-04  33%  3d2lA  [x.x.x] SAM-DEPENDENT METHYLTRANSFERASE
    3e-04  38%  3bkxA  [x.x.x] SAM-DEPENDENT METHYLTRANSFERASE
    5e-04  31%  1nkvC  [c.66.1] HYPOTHETICAL PROTEIN YJHP
:418

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1kp9A           ----------------------------------------------------------------------
1l1eB           ----------------------------------------------------------------------
1kpiA           ----------------------------------------------------------------------
1l1eA           ----------------------------------------------------------------------
1kphB           ----------------------------------------------------------------------
1kphA           ----------------------------------------------------------------------
2fk8A           ----------------------------------------------------------------------
1tpyA           ----------------------------------------------------------------------
2fk7A           ----------------------------------------------------------------------
3ha7A           ----------------------------------------------------------------------
1kpgD           ----------------------------------------------------------------------
1kpgB           ----------------------------------------------------------------------
1kpgA           ----------------------------------------------------------------------
3dtnB           ----------------------------------------------------------------------
3dtnA           ----------------------------------------------------------------------
3f4kA           ----------------------------------------------------------------------
3d2lC           ----------------------------------------------------------------------
3d2lA           ----------------------------------------------------------------------
3bkxA           ----------------------------------------------------------------------
1nkvC           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSNVAHHYDLSAKLFDLFLDEDWQ
1kp9A           -------------------------------------------------------LSDDFFRLFLDPTQT
1l1eB           ----------------------------------------------------------------------
1kpiA           -------------------------------------------------VRSHYDKSNEFFKLWLDPSMT
1l1eA           ----------------------------------------------------------------------
1kphB           -----------------------------------------------ANVQAHYXXXXXXXXXXXXPTQT
1kphA           -----------------------------------------------ANVQAHYXXXXXXXXXXXXPTQT
2fk8A           ----------------------------------------------------HYDVSDDFFALFQDPTRT
1tpyA           ----------------------------------------------------------------------
2fk7A           ----------------------------------------------------HYDVSDDFFALFQDPTRT
3ha7A           -------------------------------------------------------VSDDFFALFQDPTRT
1kpgD           -----------------------------------------------ANVQAHYXXXXXXXXXXXXPTQT
1kpgB           -----------------------------------------------ANVQAHYXXXXXXXXXXXXPTQT
1kpgA           -----------------------------------------------ANVQAHYXXXXXXXXXXXXPTQT
3dtnB           ----------------------------------------------------------------------
3dtnA           ----------------------------------------------------------------------
3f4kA           -----------------------------------------------------------------DFDFS
3d2lC           ----------------------------------------------------------------------
3d2lA           ----------------------------------------------------------------------
3bkxA           ----------------------------------------------------------------------
1nkvC           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           YSCAYFNPPDIGLYEAQVAKKRHIAAKLMTEPGQSVLEIGSGWGGMAMYIAESAGADVTGITLSEEQLRV
1kp9A           YSCAYFERDDMTLQEAQIAKIDLALGKLGLQPGMTLLDVGCGWGATMMRAVEKYDVNVVGLTLSKNQANH
1l1eB           YSCAYFERDDMTLQEAQIAKIDLALGKLNLEPGMTLLDIGCGWGATMRRAIEKYDVNVVGLTLSENQAGH
1kpiA           YSCAYFERPDMTLEEAQYAKRKLALDKLNLEPGMTLLDIGCGWGSTMRHAVAEYDVNVIGLTLSENQ--Y
1l1eA           YSCAYFERDDMTLQEAQIAKIDLALGKLNLEPGMTLLDIGCGWGATMRRAIEKYDVNVVGLTLSENQAGH
1kphB           YSCAYFERDDMTLQEAQIAKIDLALGKLGLQPGMTLLDVGCGWGATMMRAVEKYDVNVVGLTLSKNQANH
1kphA           YSCAYFERDDMTLQEAQIAKIDLALGKLGLQPGMTLLDVGCGWGATMMRAVEKYDVNVVGLTLSKNQANH
2fk8A           YSCAYFEPPELTLEEAQYAXXXXXXXXXXXXPGMTLLDIGCGWGTTMRRAVERFDVNVIGLTLSKNQHAR
1tpyA           YSCAHFEREDMTLEEAQIAKIDLALGKLGLQPGMTLLDIGCGWGATMRRAIAQYDVNVVGLTLSKNQMDT
2fk7A           YSCAYFEPPELTLEEAQYAXXXXXXXXXXXXPGMTLLDIGCGWGTTMRRAVERFDVNVIGLTLSKNQHAR
3ha7A           YSCAYFEPPELTLEEAQYAXXXXXXXXXXXXPGMTLLDIGCGWGTTMRRAVERFDVNVIGLTLSKNQHAR
1kpgD           YSCAYFERDDT-LQEAQIAKIDLALGKLGLQPG-TLLDVGCGWG--ATRAVEKYDVNVVGLTLSKNQANH
1kpgB           YSCAYFERDDT-LQEAQIAKIDLALGKLGLQPG-TLLDVGCGWG--ATRAVEKYDVNVVGLTLSKNQANH
1kpgA           YSCAYFERDDT-LQEAQIAKIDLALGKLGLQPG-TLLDVGCGWG--ATRAVEKYDVNVVGLTLSKNQANH
3dtnB           -----------------------------------ILDLGAGTGLLSAFLMEKPEATFTLVDMSEKMLEI
3dtnA           -----------------------------------ILDLGAGTGLLSAFLMEKPEATFTLVDMSEKMLEI
3f4kA           FICNYFKLKRQGPGSPEATRKAVSFINELTDDAK-IADIGCGTGGQTLFLADYVKGQITGIDLFPDFIEI
3d2lC           ------------------------------EPGKRIADIGCGTGTATLLLADH--YEVTGVDLSEE-LEI
3d2lA           ------------------------------EPGKRIADIGCGTGTATLLLADH--YEVTGVDLSEE-LEI
3bkxA           ----------------QTAHRLAIAEAWQVKPGEKILEIGCGQGDLSAVLADQVGSSVTGIDIA------
1nkvC           --------------------------RVLRKPGTRILDLGSGSGELCTW-ARDHGITGTGIDSSLFTAQA


                         .         .         .         +         .         .         .:280
query           SRDRAAKRGLAGNVRFELQDYRYLPASKKYDRIVSVGMFEHVGPTHYRDYFDKVAEVLDDKGVMVLHSIG
1kp9A           VQQLVANSENLRSKRVLLAGWEQF--DEPVDRIVSIGAFEHFGHERYDAFFSLAHRLLPADGVMLLHTIT
1l1eB           VQKMFDQMDTPRSRRVLLEGWEKF--DEPVDRIVSIGAFEHFGHQRYHHFFEVTHRTLPADGKMLLHTIV
1kpiA           AHDKAMFDEVDSPRRKEVRIQGWEEFDEPVDRIVSLGAFEHAGFERYDTFFKKFYNLTPDDGRMLLHTIT
1l1eA           VQKMFDQMDTPRSRRVLLEGWEKF--DEPVDRIVSIGAFEHFGHQRYHHFFEVTHRTLPADGKMLLHTIV
1kphB           VQQLVANSENLRSKRVLLAGWEQF--DEPVDRIVSIGAFEHFGHERYDAFFSLAHRLLPADGVMLLHTIT
1kphA           VQQLVANSENLRSKRVLLAGWEQF--DEPVDRIVSIGAFEHFGHERYDAFFSLAHRLLPADGVMLLHTIT
2fk8A           CEQVLASIDTNRSRQVLLQGWE--DFAEPVDRIVSIEAFEHFGHENYDDFFKRCFNIMPADGRMTVQSSY
1tpyA           PRDRRVL--LAGWEQF----------NEPVDRIVSIGAFEHFGHDRHADFFARAHKILPPDGVLLLHTIG
2fk7A           CEQVLASIDTNRSRQVLLQGWE--DFAEPVDRIVSIEAFEH---ENYDDFFKRCFNIMPADGRMTVQSSY
3ha7A           CEQVLASIDTNRSRQVLLQGWE--DFAEPVDRIVSIEAFEHFGHENYDDFFKRCFNIMPADGRMTVQSSV
1kpgD           VQQLVANSENLRSKRVLLAGWEQF--DEPVDRIVSIGAFEHFGHERYDAFFSLAHRLLPADGVLLIHERG
1kpgB           VQQLVANSENLRSKRVLLAGWEQF--DEPVDRIVSIGAFEHFGHERYDAFFSLAHRLLPADGVLLIHERG
1kpgA           VQQLVANSENLRSKRVLLAGWEQF--DEPVDRIVSIGAFEHFGHERYDAFFSLAHRLLPADGVLLIHERG
3dtnB           AKNR-----FRGNVKYIEADYSKYDFEEKYDMVVSALSIHHLEDEDKKELYKRSYSILKESGIFI-----
3dtnA           AKNR-----FRGNVKYIEADYSKYDFEEKYDMVVSALSIHHLEDEDKKELYKRSYSILKESGIFI-----
3f4kA           FNENAVKANCADRVKGITGSMDNLPQNEELDLIWSEGAIYNIG---------------------------
3d2lC           AQEKAETN---RHVDFWVQD-RELELPEPVDAITILCDSLNYLQTEVKQTFDSAARLLTDGG-KLLFDVH
3d2lA           AQEKAETN---RHVDFWVQD-RELELPEPVDAITILCDSLNYLQTEVKQTFDSAARLLTDGG-KLLFDVH
3bkxA           ----------------------------------------------------------------------
1nkvC           KR-RAEELGVSERVHFIHNDAAGYVANEKCDVAACVGATWIAGGE------ELLAQSLKPGGIL----IG


                         .         *         .         .         .         .         +:350
query           QPYPALATNPFIEKYIFPGGYIPSLAEVLPAIQKSGLLVKDIEILPMHYAHTLRHWRERFVARKAEAVAL
1kp9A           GLHPKEIHEKFIVTEIFPGGRLPSIPMVQECASANGFTVTRVQSLQPHYAKTLDLWSAALQANKGQAIAL
1l1eB           RPFKLVHFTKFILAEIFPGGWLPSIPTVHEYAEKVGFRVTAVQSLQLHYARTLDMWATALEANKDQAIAI
1kpiA           IPDKEEATSPFILTEIFPGGRLPRISQVDYYSSNAGWKVERYHRIGANYVPTLNAWADALQAHKDEAIAL
1l1eA           RPHELVHFTKFILAEIFPGGWLPSIPTVHEYAEKVGFRVTAVQSLQLHYARTLDMWATALEANKDQAIAI
1kphB           GLHPKEIHEKFIVTEIFPGGRLPSIPMVQECASANGFTVTRVQSLQPHYAKTLDLWSAALQANKGQAIAL
1kphA           GLHPKEIHEKFIVTEIFPGGRLPSIPMVQECASANGFTVTRVQSLQPHYAKTLDLWSAALQANKGQAIAL
2fk8A           HPYEMAARGKFIVTEIFPGGRLPSTEMMVEHGEKAGFTVPEPLSLRPHYIKTLRIWGDTLQSNKDKAIEV
1tpyA           LPLTLWLARKFIATEIFPGGQPPTIEMVEEQSAKTGFTLTRRQSLQPHYARTLDLWAEALQEHKSEAIAI
2fk7A           HPYEMAARGKFIVTEIFPGGRLPSTEMMVEHGEKAGFTVPEPLSLRPHYIKTLRIWGDTLQSNKDKAIEV
3ha7A           SYHPYEARGKFIVTEIFPGGRLPSTEMMVEHGEKAGFTVPEPLSLRPHYIKTLRIWGDTLQSNKDKAIEV
1kpgD           LPSFTFARFKFIVTEIFPGGRLPSIP-VQECASANGFTVTRVQSLQPHYAKTLDLWSAALQANKGQAIAL
1kpgB           LPSFTFARFKFIVTEIFPGGRLPSIP-VQECASANGFTVTRVQSLQPHYAKTLDLWSAALQANKGQAIAL
1kpgA           LPSFTFARFKFIVTEIFPGGRLPSIP-VQECASANGFTVTRVQSLQPHYAKTLDLWSAALQANKGQAIAL
3dtnB           ----------------------------------------------------------------------
3dtnA           ----------------------------------------------------------------------
3f4kA           ----------------------------------------------------------------------
3d2lC           SPY-------------------------------------------------------------------
3d2lA           SPY-------------------------------------------------------------------
3bkxA           ----------------------------------------------------------------------
1nkvC           EPY-------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           YDERFFRMWEFYLAGSEMAFTHENFHIFQIQLAKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1kp9A           QSEEVYERYMKYLTGCAEMF------------------------------------------------
1l1eB           QSQTVYDRYMKYLTGCAKLFRQGYTDVDQFTLEK----------------------------------
1kpiA           KGQETCDIYMHYLRGCSDLFRDKYTDVCQFTLVK----------------------------------
1l1eA           QSQTVYDRYMKYLTGCAKLFRQGYTDVDQFTLEK----------------------------------
1kphB           QSEEVYERYMKYLTGCAEMF------------------------------------------------
1kphA           QSEEVYERYMKYLTGCAEMF------------------------------------------------
2fk8A           TSEEVYNRYMKYLRGCEHYFTDE---------------------------------------------
1tpyA           QSEEVYERYMKYLTGCAKLFRVGYIDVNQFTLAK----------------------------------
2fk7A           TSEEVYNRYMKYLRGCEHYFTDE---------------------------------------------
3ha7A           --EEVYNRYMKYLRGCEHYFTDE---------------------------------------------
1kpgD           QSEEVYERYKYLTGCAEFRIGYIDVNQFTCQ-------------------------------------
1kpgB           QSEEVYERYKYLTGCAEFRIGYIDVNQFTCQ-------------------------------------
1kpgA           QSEEVYERYKYLTGCAEFRIGYIDVNQFTCQ-------------------------------------
3dtnB           --------------------------------------------------------------------
3dtnA           --------------------------------------------------------------------
3f4kA           --------------------------------------------------------------------
3d2lC           --------------------------------------------------------------------
3d2lA           --------------------------------------------------------------------
3bkxA           --------------------------------------------------------------------
1nkvC           --------------------------------------------------------------------