[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for atum0:fabI.2

[Show Plain Result]

#ERROR : Can't open dsspfile "3grkB.bssp"
#ERROR : Can't open dsspfile "3grkD.bssp"
#ERROR : Can't open dsspfile "3grkA.bssp"
#ERROR : Can't open dsspfile "3grkG.bssp"
#ERROR : Can't open dsspfile "3k2eA.bssp"
#ERROR : Can't open dsspfile "3k2eB.bssp"
#ERROR : Can't open dsspfile "2pd3A.bssp"
#ERROR : Can't open dsspfile "2qioA.bssp"
#ERROR : Can't open dsspfile "3ek2A.bssp"
#ERROR : Can't open dsspfile "3ek2C.bssp"
#ERROR : Can't open dsspfile "3ek2D.bssp"
#ERROR : Can't open dsspfile "3ek2B.bssp"
#ERROR : Can't open dsspfile "1qsgG.bssp"
#ERROR : Can't open dsspfile "1qsgA.bssp"
#ERROR : Can't open dsspfile "1qg6A.bssp"
#ERROR : Can't open dsspfile "2p91B.bssp"
#ERROR : Can't open dsspfile "1c14A.bssp"
#ERROR : Can't open dsspfile "2p91A.bssp"
#ERROR : Can't open dsspfile "2yw9B.bssp"
#ERROR : Can't open dsspfile "2fhsB.bssp"
#ERROR : Can't open dsspfile "2yw9C.bssp"
#ERROR : Can't open dsspfile "2yw9F.bssp"
#ERROR : Can't open dsspfile "2yw9A.bssp"
#ERROR : Can't open dsspfile "2yw9H.bssp"
#ERROR : Can't open dsspfile "2yw9E.bssp"
#ERROR : Can't open dsspfile "1lxcA.bssp"
#ERROR : Can't open dsspfile "2yw9D.bssp"
#ERROR : Can't open dsspfile "1i30A.bssp"
#ERROR : Can't open dsspfile "2p91D.bssp"
#ERROR : Can't open dsspfile "1dfiA.bssp"
#ERROR : Can't open dsspfile "2p91C.bssp"
#ERROR : Can't open dsspfile "1lx6A.bssp"
#ERROR : Can't open dsspfile "1uluB.bssp"
#ERROR : Can't open dsspfile "2jjyA.bssp"
#ERROR : Can't open dsspfile "2jjyD.bssp"
#ERROR : Can't open dsspfile "2jjyB.bssp"
#ERROR : Can't open dsspfile "2jjyC.bssp"
#ERROR : Can't open dsspfile "1uluC.bssp"
#ERROR : Can't open dsspfile "1uluA.bssp"
#ERROR : Can't open dsspfile "1uluD.bssp"
#ERROR : Can't open dsspfile "2o2sB.bssp"
#ERROR : Can't open dsspfile "2o2sA.bssp"
#ERROR : Can't open dsspfile "1enoA.bssp"
#ERROR : Can't open dsspfile "1d7oA.bssp"
#ERROR : Can't open dsspfile "1cwuA.bssp"
#ERROR : Can't open dsspfile "2o50A.bssp"
#ERROR : Can't open dsspfile "2o50B.bssp"
#ERROR : Can't open dsspfile "3fnfB.bssp"
#ERROR : Can't open dsspfile "2b35D.bssp"
#ERROR : Can't open dsspfile "3fnfD.bssp"
#ERROR : Can't open dsspfile "2b35C.bssp"
#ERROR : Can't open dsspfile "3fnfC.bssp"
#ERROR : Can't open dsspfile "3fneB.bssp"
#ERROR : Can't open dsspfile "2nv6A.bssp"
#ERROR : Can't open dsspfile "3fneC.bssp"
#ERROR : Can't open dsspfile "2aqkA.bssp"
#ERROR : Can't open dsspfile "2h7iA.bssp"
#ERROR : Can't open dsspfile "1enyA.bssp"
#ERROR : Can't open dsspfile "2op0B.bssp"
#ERROR : Can't open dsspfile "2oosA.bssp"
#ERROR : Can't open dsspfile "2aqiA.bssp"
#ERROR : Can't open dsspfile "2aqhA.bssp"
#ERROR : Can't open dsspfile "2aq8A.bssp"
#ERROR : Can't open dsspfile "2b36B.bssp"
#ERROR : Can't open dsspfile "1uh5A.bssp"
#ERROR : Can't open dsspfile "2oosB.bssp"
#ERROR : Can't open dsspfile "2ol4B.bssp"
#ERROR : Can't open dsspfile "3fneD.bssp"
#ERROR : Can't open dsspfile "2b37B.bssp"
#ERROR : Can't open dsspfile "2b35F.bssp"
#ERROR : Can't open dsspfile "2b35B.bssp"
#ERROR : Can't open dsspfile "2b35A.bssp"
#ERROR : Can't open dsspfile "2b35E.bssp"
#ERROR : Can't open dsspfile "1vrwA.bssp"
#ERROR : Can't open dsspfile "2o2yD.bssp"
#ERROR : Can't open dsspfile "2b37C.bssp"
#ERROR : Can't open dsspfile "1zxlA.bssp"
#ERROR : Can't open dsspfile "1zsnA.bssp"
#ERROR : Can't open dsspfile "2o2yC.bssp"
#ERROR : Can't open dsspfile "2o2yA.bssp"
#ERROR : Can't open dsspfile "2ol4A.bssp"
#ERROR : Can't open dsspfile "2ntvA.bssp"
#ERROR : Can't open dsspfile "1nhgA.bssp"
#ERROR : Can't open dsspfile "2ptgA.bssp"
#ERROR : Can't open dsspfile "1vl8B.bssp"
#ERROR : Can't open dsspfile "1vl8A.bssp"
#ERROR : Can't open dsspfile "1fmcA.bssp"
#ERROR : Can't open dsspfile "1ahhA.bssp"
#ERROR : Can't open dsspfile "2nm0A.bssp"
#ERROR : Can't open dsspfile "3gafF.bssp"
#ERROR : Can't open dsspfile "3gafH.bssp"
#ERROR : Can't open dsspfile "3gafA.bssp"
#ERROR : Can't open dsspfile "3gafE.bssp"
#ERROR : Can't open dsspfile "1i01E.bssp"
#ERROR : Can't open dsspfile "3gafG.bssp"
#ERROR : Can't open dsspfile "3gafD.bssp"
#ERROR : Can't open dsspfile "3gafC.bssp"
#ERROR : Can't open dsspfile "3gafB.bssp"
#ERROR : Can't open dsspfile "1q7bA.bssp"
#ERROR : Can't open dsspfile "3cxrA.bssp"
#ERROR : Can't open dsspfile "1q7cA.bssp"
#ERROR : Can't open dsspfile "1q7bB.bssp"
#ERROR : Can't open dsspfile "1hdcA.bssp"
#ERROR : Can't open dsspfile "1i01B.bssp"
#ERROR : Can't open dsspfile "1i01G.bssp"
#ERROR : Can't open dsspfile "1i01D.bssp"
#ERROR : Can't open dsspfile "3cxtA.bssp"
#ERROR : Can't open dsspfile "3i3oF.bssp"
#ERROR : Can't open dsspfile "3i3oE.bssp"
#ERROR : Can't open dsspfile "3i3oC.bssp"
#ERROR : Can't open dsspfile "3i3oB.bssp"
#ERROR : Can't open dsspfile "3i3oA.bssp"
#ERROR : Can't open dsspfile "1cydA.bssp"
#ERROR : Can't open dsspfile "1uzlA.bssp"
#ERROR : Can't open dsspfile "1i01H.bssp"
#ERROR : Can't open dsspfile "1i01F.bssp"
#ERROR : Can't open dsspfile "1zemA.bssp"
#ERROR : Can't open dsspfile "3ctmE.bssp"
#ERROR : Can't open dsspfile "3i3oH.bssp"
#ERROR : Can't open dsspfile "1xkqB.bssp"
#ERROR : Can't open dsspfile "1xkqA.bssp"
#ERROR : Can't open dsspfile "1i01A.bssp"
#ERROR : Can't open dsspfile "1ulsB.bssp"
#ERROR : Can't open dsspfile "1ulsA.bssp"
#ERROR : Can't open dsspfile "3ctmG.bssp"
#ERROR : Can't open dsspfile "3ctmC.bssp"
#ERROR : Can't open dsspfile "1uzlB.bssp"
#ERROR : Can't open dsspfile "1pr9A.bssp"
#ERROR : Can't open dsspfile "1i01C.bssp"
#ERROR : Can't open dsspfile "2p68A.bssp"
#ERROR : Can't open dsspfile "3ctmA.bssp"
#ERROR : Can't open dsspfile "1ulsC.bssp"
#ERROR : Can't open dsspfile "1g0nB.bssp"
#ERROR : Can't open dsspfile "1w6uA.bssp"
#ERROR : Can't open dsspfile "2p68B.bssp"
#ERROR : Can't open dsspfile "3i3oG.bssp"
#ERROR : Can't open dsspfile "3ftpA.bssp"
#ERROR : Can't open dsspfile "2a4kA.bssp"
#ERROR : Can't open dsspfile "1uznA.bssp"
#ERROR : Can't open dsspfile "3d3wA.bssp"
#ERROR : Can't open dsspfile "1ybvA.bssp"
#ERROR : Can't open dsspfile "1w6uD.bssp"
#ERROR : Can't open dsspfile "3ijrH.bssp"
#ERROR : Can't open dsspfile "3ijrF.bssp"
#ERROR : Can't open dsspfile "3ijrE.bssp"
#ERROR : Can't open dsspfile "3ijrB.bssp"
#ERROR : Can't open dsspfile "3ijrA.bssp"
#ERROR : Can't open dsspfile "1g0oC.bssp"
#ERROR : Can't open dsspfile "1g0oA.bssp"
#ERROR : Can't open dsspfile "1dohB.bssp"
#ERROR : Can't open dsspfile "1dohA.bssp"
#ERROR : Can't open dsspfile "1yxmC.bssp"
#ERROR : Can't open dsspfile "1k2wA.bssp"
#ERROR : Can't open dsspfile "1uznB.bssp"
#ERROR : Can't open dsspfile "1uzmA.bssp"
#ERROR : Can't open dsspfile "3ctmH.bssp"
#ERROR : Can't open dsspfile "2bgkA.bssp"
#ERROR : Can't open dsspfile "1w6uC.bssp"
#ERROR : Can't open dsspfile "2ntnA.bssp"
#ERROR : Can't open dsspfile "2hq1A.bssp"
#ERROR : Can't open dsspfile "3ctmF.bssp"
#ERROR : Can't open dsspfile "2ntnB.bssp"
#ERROR : Can't open dsspfile "3ftpD.bssp"
#ERROR : Can't open dsspfile "3ftpC.bssp"
#ERROR : Can't open dsspfile "3ctmD.bssp"
#ERROR : Can't open dsspfile "3ctmB.bssp"
#ERROR : Can't open dsspfile "1xhlA.bssp"
#ERROR : Can't open dsspfile "1uzmB.bssp"
#ERROR : Can't open dsspfile "3iccA.bssp"
#ERROR : Can't open dsspfile "1yxmD.bssp"
#ERROR : Can't open dsspfile "1w6uB.bssp"
#ERROR : Can't open dsspfile "2d1yB.bssp"
#ERROR : Can't open dsspfile "1spxA.bssp"
#ERROR : Can't open dsspfile "1ja9A.bssp"
#ERROR : Can't open dsspfile "2cfcA.bssp"
#ERROR : Can't open dsspfile "1x7gB.bssp"
#ERROR : Can't open dsspfile "2d1yD.bssp"
#ERROR : Can't open dsspfile "1yxmB.bssp"
#ERROR : Can't open dsspfile "1o5iA.bssp"
#ERROR : Can't open dsspfile "1h5qA.bssp"
#ERROR : Can't open dsspfile "2d1yA.bssp"
#ERROR : Can't open dsspfile "2d1yC.bssp"
#ERROR : Can't open dsspfile "3emkB.bssp"
#ERROR : Can't open dsspfile "3ezlA.bssp"
#ERROR : Can't open dsspfile "1xr3B.bssp"
#ERROR : Can't open dsspfile "1nffA.bssp"
#ERROR : Can't open dsspfile "1w4zB.bssp"
#ERROR : Can't open dsspfile "3i4fD.bssp"
#ERROR : Can't open dsspfile "1yxmA.bssp"
#ERROR : Can't open dsspfile "1w0cH.bssp"
#ERROR : Can't open dsspfile "2uvdA.bssp"
#ERROR : Can't open dsspfile "2q2qE.bssp"
#ERROR : Can't open dsspfile "3gvcA.bssp"
#ERROR : Can't open dsspfile "2q2vD.bssp"
#ERROR : Can't open dsspfile "2p8kB.bssp"
#ERROR : Can't open dsspfile "3i4fC.bssp"
#ERROR : Can't open dsspfile "2bfpD.bssp"
#ERROR : Can't open dsspfile "1e92D.bssp"
#ERROR : Can't open dsspfile "3bmoA.bssp"
#ERROR : Can't open dsspfile "2bfmC.bssp"
#ERROR : Can't open dsspfile "1w73A.bssp"
#ERROR : Can't open dsspfile "1w0cC.bssp"
#ERROR : Can't open dsspfile "1w0cB.bssp"
#ERROR : Can't open dsspfile "2q2qA.bssp"
#ERROR : Can't open dsspfile "3i4fA.bssp"
#ERROR : Can't open dsspfile "2ag5C.bssp"
#ERROR : Can't open dsspfile "2ag5B.bssp"
#ERROR : Can't open dsspfile "2ag5A.bssp"
#ERROR : Can't open dsspfile "2qhxC.bssp"
#ERROR : Can't open dsspfile "2q2qC.bssp"
#ERROR : Can't open dsspfile "2p8kD.bssp"
#ERROR : Can't open dsspfile "1e92B.bssp"
#ERROR : Can't open dsspfile "2bf7C.bssp"
#ERROR : Can't open dsspfile "2ae2A.bssp"
#ERROR : Can't open dsspfile "2rhrB.bssp"
#ERROR : Can't open dsspfile "2qhxA.bssp"
#ERROR : Can't open dsspfile "1p33D.bssp"
#ERROR : Can't open dsspfile "1p33A.bssp"
#ERROR : Can't open dsspfile "1e7wA.bssp"
#ERROR : Can't open dsspfile "3csdB.bssp"
#ERROR : Can't open dsspfile "2bfaC.bssp"
#ERROR : Can't open dsspfile "2bf7D.bssp"
#ERROR : Can't open dsspfile "2bf7B.bssp"
#ERROR : Can't open dsspfile "2ae1A.bssp"
#ERROR : Can't open dsspfile "2zatA.bssp"
#ERROR : Can't open dsspfile "1x7hB.bssp"
#ERROR : Can't open dsspfile "1x7gA.bssp"
#ERROR : Can't open dsspfile "1w4zA.bssp"
#ERROR : Can't open dsspfile "2rhrA.bssp"
#ERROR : Can't open dsspfile "2rh4B.bssp"
#ERROR : Can't open dsspfile "2rh4A.bssp"
#ERROR : Can't open dsspfile "2q2vC.bssp"
#ERROR : Can't open dsspfile "2q2qH.bssp"
#ERROR : Can't open dsspfile "2q2qG.bssp"
#ERROR : Can't open dsspfile "2p8kA.bssp"
#ERROR : Can't open dsspfile "1iy8A.bssp"
#ERROR : Can't open dsspfile "3gvcD.bssp"
#ERROR : Can't open dsspfile "1ae1A.bssp"
#ERROR : Can't open dsspfile "1ydeP.bssp"
#ERROR : Can't open dsspfile "1ydeM.bssp"
#ERROR : Can't open dsspfile "1ydeI.bssp"
#ERROR : Can't open dsspfile "1ydeH.bssp"
#ERROR : Can't open dsspfile "1ydeG.bssp"
#ERROR : Can't open dsspfile "1ydeF.bssp"
#ERROR : Can't open dsspfile "1ydeD.bssp"
#ERROR : Can't open dsspfile "1ydeA.bssp"
#ERROR : Can't open dsspfile "3edmD.bssp"
#ERROR : Can't open dsspfile "3edmA.bssp"
#ERROR : Can't open dsspfile "1e7wB.bssp"
#ERROR : Can't open dsspfile "2zk7B.bssp"
#ERROR : Can't open dsspfile "2qhxD.bssp"
#ERROR : Can't open dsspfile "2q2wC.bssp"
#ERROR : Can't open dsspfile "2q2qF.bssp"
#ERROR : Can't open dsspfile "3grpA.bssp"
#ERROR : Can't open dsspfile "3edmB.bssp"
#ERROR : Can't open dsspfile "2dteA.bssp"
#ERROR : Can't open dsspfile "2bfoA.bssp"
#ERROR : Can't open dsspfile "2bfmB.bssp"
#ERROR : Can't open dsspfile "1w0cA.bssp"
#ERROR : Can't open dsspfile "2q2vA.bssp"
#ERROR : Can't open dsspfile "3gvcC.bssp"
#ERROR : Can't open dsspfile "3gvcB.bssp"
#ERROR : Can't open dsspfile "3ennD.bssp"
#ERROR : Can't open dsspfile "3ennC.bssp"
#ERROR : Can't open dsspfile "2c07A.bssp"
#ERROR : Can't open dsspfile "3bmfA.bssp"
#ERROR : Can't open dsspfile "2bfaB.bssp"
#ERROR : Can't open dsspfile "1ydeN.bssp"
#ERROR : Can't open dsspfile "1ydeB.bssp"
#ERROR : Can't open dsspfile "1xg5A.bssp"
#ERROR : Can't open dsspfile "2q2wD.bssp"
#ERROR : Can't open dsspfile "1p33C.bssp"
#ERROR : Can't open dsspfile "1p33B.bssp"
#ERROR : Can't open dsspfile "3bmdB.bssp"
#ERROR : Can't open dsspfile "2bfpB.bssp"
#ERROR : Can't open dsspfile "2bfoC.bssp"
#ERROR : Can't open dsspfile "2bfaA.bssp"
#ERROR : Can't open dsspfile "2bf7A.bssp"
#ERROR : Can't open dsspfile "1w73D.bssp"
#ERROR : Can't open dsspfile "1w73C.bssp"
#ERROR : Can't open dsspfile "3grpB.bssp"
#ERROR : Can't open dsspfile "3bmnD.bssp"
#ERROR : Can't open dsspfile "3bmkC.bssp"
#ERROR : Can't open dsspfile "2wd7C.bssp"
#ERROR : Can't open dsspfile "2vz0A.bssp"
#ERROR : Can't open dsspfile "2q2qB.bssp"
#ERROR : Can't open dsspfile "3imfB.bssp"
#ERROR : Can't open dsspfile "2ewmB.bssp"
#ERROR : Can't open dsspfile "2ewmA.bssp"
#ERROR : Can't open dsspfile "3ennA.bssp"
#ERROR : Can't open dsspfile "2dknA.bssp"
#ERROR : Can't open dsspfile "3bmoC.bssp"
#ERROR : Can't open dsspfile "3bmnC.bssp"
#ERROR : Can't open dsspfile "2wd7B.bssp"
#ERROR : Can't open dsspfile "2vz0B.bssp"
#ERROR : Can't open dsspfile "2p8kC.bssp"
#ERROR : Can't open dsspfile "2ew8A.bssp"
#ERROR : Can't open dsspfile "1e92C.bssp"
#ERROR : Can't open dsspfile "3bmoD.bssp"
#ERROR : Can't open dsspfile "3bmiB.bssp"
#ERROR : Can't open dsspfile "1ae1B.bssp"
#ERROR : Can't open dsspfile "2a4kB.bssp"
#ERROR : Can't open dsspfile "3imfA.bssp"
#ERROR : Can't open dsspfile "3emkD.bssp"
#ERROR : Can't open dsspfile "2c7vA.bssp"
#ERROR : Can't open dsspfile "3bmqA.bssp"
#ERROR : Can't open dsspfile "2bfaD.bssp"
#ERROR : Can't open dsspfile "2q2wA.bssp"
#ERROR : Can't open dsspfile "2q2vB.bssp"
#ERROR : Can't open dsspfile "2gdzA.bssp"
#ERROR : Can't open dsspfile "3bmfD.bssp"
#ERROR : Can't open dsspfile "3bmeA.bssp"
#ERROR : Can't open dsspfile "2ztuD.bssp"
#ERROR : Can't open dsspfile "1x1tA.bssp"
#ERROR : Can't open dsspfile "1x1eA.bssp"
#ERROR : Can't open dsspfile "1w0cE.bssp"
#ERROR : Can't open dsspfile "2p8kG.bssp"
#ERROR : Can't open dsspfile "2ekpA.bssp"
#ERROR : Can't open dsspfile "3bmoB.bssp"
#ERROR : Can't open dsspfile "3bmnA.bssp"
#ERROR : Can't open dsspfile "3bmfB.bssp"
#ERROR : Can't open dsspfile "2b4qB.bssp"
#ERROR : Can't open dsspfile "2b4qA.bssp"
#ERROR : Can't open dsspfile "1w73B.bssp"
#ERROR : Can't open dsspfile "1w0cF.bssp"
#ERROR : Can't open dsspfile "3imfC.bssp"
#ERROR : Can't open dsspfile "3grpC.bssp"
#ERROR : Can't open dsspfile "1e92A.bssp"
#ERROR : Can't open dsspfile "2z1nB.bssp"
#ERROR : Can't open dsspfile "2p8kH.bssp"
#ERROR : Can't open dsspfile "2ew8B.bssp"
#ERROR : Can't open dsspfile "2ztvC.bssp"
#ERROR : Can't open dsspfile "2ztmD.bssp"
#ERROR : Can't open dsspfile "2ztuC.bssp"
#ERROR : Can't open dsspfile "2ztuB.bssp"
#ERROR : Can't open dsspfile "2z1nA.bssp"
#ERROR : Can't open dsspfile "1xg5C.bssp"
#ERROR : Can't open dsspfile "1w0cG.bssp"
#ERROR : Can't open dsspfile "3grpD.bssp"
#ERROR : Can't open dsspfile "3gk3C.bssp"
#ERROR : Can't open dsspfile "3gk3A.bssp"
#ERROR : Can't open dsspfile "3emkA.bssp"
#ERROR : Can't open dsspfile "2ekqD.bssp"
#ERROR : Can't open dsspfile "3edmC.bssp"
#ERROR : Can't open dsspfile "3bmeC.bssp"
#ERROR : Can't open dsspfile "2ztvB.bssp"
#ERROR : Can't open dsspfile "3gk3D.bssp"
#ERROR : Can't open dsspfile "3gk3B.bssp"
#ERROR : Can't open dsspfile "3ennB.bssp"
#ERROR : Can't open dsspfile "3emkC.bssp"
#ERROR : Can't open dsspfile "1xg5B.bssp"
#ERROR : Can't open dsspfile "2japC.bssp"
#ERROR : Can't open dsspfile "2japA.bssp"
#ERROR : Can't open dsspfile "2ztuA.bssp"
#ERROR : Can't open dsspfile "3bmqC.bssp"
#ERROR : Can't open dsspfile "3bmnB.bssp"
#ERROR : Can't open dsspfile "3bmfC.bssp"
#ERROR : Can't open dsspfile "3bmeB.bssp"
#ERROR : Can't open dsspfile "2ztmC.bssp"
#ERROR : Can't open dsspfile "2yz7A.bssp"
#ERROR : Can't open dsspfile "2c7vB.bssp"
#ERROR : Can't open dsspfile "2ztvD.bssp"
#ERROR : Can't open dsspfile "2ztlA.bssp"
#ERROR : Can't open dsspfile "2c7vD.bssp"
#ERROR : Can't open dsspfile "2c7vC.bssp"
#ERROR : Can't open dsspfile "3bmjD.bssp"
#ERROR : Can't open dsspfile "1nhgC.bssp"
#ERROR : Can't open dsspfile "2ztmB.bssp"
#ERROR : Can't open dsspfile "2ztmA.bssp"
#ERROR : Can't open dsspfile "3f9iA.bssp"
#ERROR : Can't open dsspfile "2ph3A.bssp"
#ERROR : Can't open dsspfile "1nfrA.bssp"
#ERROR : Can't open dsspfile "3f9iB.bssp"
#ERROR : Can't open dsspfile "3g1tA.bssp"
#ERROR : Can't open dsspfile "1rwbA.bssp"
#ERROR : Can't open dsspfile "2pd6B.bssp"
#ERROR : Can't open dsspfile "2zk7A.bssp"
#ERROR : Can't open dsspfile "1g6kA.bssp"
#ERROR : Can't open dsspfile "1geeA.bssp"
#ERROR : Can't open dsspfile "1gcoA.bssp"
#ERROR : Can't open dsspfile "2vr2A.bssp"

## Summary of PDB Search
:272
    e-105  74%  3grkB  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE (NADH)
    e-105  74%  3grkD  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE (NADH)
    e-103  73%  3grkA  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE (NADH)
    e-102  73%  3grkG  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE (NADH)
    3e-95  62%  3k2eA  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE
    4e-93  62%  3k2eB  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE
    2e-79  52%  2pd3A  [c.2.1 (1jvfA)] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    5e-75  55%  2qioA  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE
    1e-71  54%  3ek2A  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE (NADH)
    3e-71  54%  3ek2C  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE (NADH)
    1e-70  54%  3ek2D  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE (NADH)
    2e-70  54%  3ek2B  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE (NADH)
    2e-69  50%  1qsgG  [c.2.1] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    4e-69  51%  1qsgA  [c.2.1] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    4e-69  51%  1qg6A  [c.2.1] PROTEIN (ENOYL-[ACYL-CARRIER PROTEIN] REDUCTASE)
    4e-69  51%  2p91B  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    4e-69  51%  1c14A  [c.2.1] ENOYL REDUCTASE
    1e-68  50%  2p91A  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    7e-66  47%  2yw9B  [x.x.x] ENOYL-[ACYL CARRIER PROTEIN] REDUCTASE
    1e-64  50%  2fhsB  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE, NADH-
    2e-64  48%  2yw9C  [x.x.x] ENOYL-[ACYL CARRIER PROTEIN] REDUCTASE
    4e-64  49%  2yw9F  [x.x.x] ENOYL-[ACYL CARRIER PROTEIN] REDUCTASE
    4e-64  48%  2yw9A  [x.x.x] ENOYL-[ACYL CARRIER PROTEIN] REDUCTASE
    5e-64  47%  2yw9H  [x.x.x] ENOYL-[ACYL CARRIER PROTEIN] REDUCTASE
    5e-64  48%  2yw9E  [x.x.x] ENOYL-[ACYL CARRIER PROTEIN] REDUCTASE
    5e-64  50%  1lxcA  [c.2.1] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    1e-63  47%  2yw9D  [x.x.x] ENOYL-[ACYL CARRIER PROTEIN] REDUCTASE
    2e-63  50%  1i30A  [c.2.1] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    2e-63  52%  2p91D  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    1e-62  50%  1dfiA  [c.2.1] ENOYL ACYL CARRIER PROTEIN REDUCTASE
    1e-61  52%  2p91C  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    5e-61  50%  1lx6A  [c.2.1] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    7e-61  48%  1uluB  [c.2.1] ENOYL-ACYL CARRIER PROTEIN REDUCTASE
    1e-59  50%  2jjyA  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    2e-59  50%  2jjyD  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    2e-59  51%  2jjyB  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    5e-58  50%  2jjyC  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    9e-58  48%  1uluC  [c.2.1] ENOYL-ACYL CARRIER PROTEIN REDUCTASE
    2e-57  49%  1uluA  [c.2.1] ENOYL-ACYL CARRIER PROTEIN REDUCTASE
    2e-57  48%  1uluD  [c.2.1] ENOYL-ACYL CARRIER PROTEIN REDUCTASE
    2e-38  43%  2o2sB  [x.x.x] ENOYL-ACYL CARRIER REDUCTASE
    5e-38  43%  2o2sA  [x.x.x] ENOYL-ACYL CARRIER REDUCTASE
    8e-35  38%  1enoA  [x.x.x] ENOYL ACYL CARRIER PROTEIN REDUCTASE
    8e-35  38%  1d7oA  [c.2.1] ENOYL-[ACYL-CARRIER PROTEIN] REDUCTASE (NADH)
    2e-34  37%  1cwuA  [c.2.1] ENOYL ACP REDUCTASE
    6e-33  41%  2o50A  [x.x.x] ENOYL-ACYL CARRIER REDUCTASE
    4e-32  41%  2o50B  [x.x.x] ENOYL-ACYL CARRIER REDUCTASE
    7e-32  38%  3fnfB  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    2e-31  38%  2b35D  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    6e-31  39%  3fnfD  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    7e-31  38%  2b35C  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    2e-30  39%  3fnfC  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    4e-30  38%  3fneB  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    6e-30  39%  2nv6A  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH
    6e-30  39%  3fneC  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    6e-30  39%  2aqkA  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    1e-29  39%  2h7iA  [c.2.1 (1bvrA)] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    1e-29  39%  1enyA  [x.x.x] ENOYL-ACYL CARRIER PROTEIN (ACP) REDUCTASE
    2e-29  40%  2op0B  [x.x.x] ENOYL-ACYL CARRIER REDUCTASE
    2e-29  40%  2oosA  [x.x.x] ENOYL-ACYL CARRIER REDUCTASE
    2e-29  38%  2aqiA  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    2e-29  38%  2aqhA  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    2e-29  39%  2aq8A  [x.x.x] ENOYL-ACYL-CARRIER-PROTEIN REDUCTASE
    2e-29  36%  2b36B  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    3e-29  41%  1uh5A  [c.2.1] ENOYL-ACP REDUCTASE
    3e-29  41%  2oosB  [x.x.x] ENOYL-ACYL CARRIER REDUCTASE
    3e-29  41%  2ol4B  [x.x.x] ENOYL-ACYL CARRIER REDUCTASE
    3e-29  38%  3fneD  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    3e-29  38%  2b37B  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    3e-29  38%  2b35F  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    3e-29  37%  2b35B  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    3e-29  37%  2b35A  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    4e-29  37%  2b35E  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    7e-29  40%  1vrwA  [x.x.x] ENOYL-ACYL CARRIER REDUCTASE
    7e-29  41%  2o2yD  [x.x.x] ENOYL-ACYL CARRIER REDUCTASE
    1e-28  35%  2b37C  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    3e-28  40%  1zxlA  [x.x.x] ENOYL-ACYL CARRIER REDUCTASE
    3e-28  40%  1zsnA  [x.x.x] ENOYL-ACYL CARRIER REDUCTASE
    3e-28  40%  2o2yC  [x.x.x] ENOYL-ACYL CARRIER REDUCTASE
    3e-28  40%  2o2yA  [x.x.x] ENOYL-ACYL CARRIER REDUCTASE
    1e-26  40%  2ol4A  [x.x.x] ENOYL-ACYL CARRIER REDUCTASE
    2e-25  35%  2ntvA  [x.x.x] ENOYL-[ACP] REDUCTASE
    3e-20  43%  1nhgA  [c.2.1] ENOYL-ACYL CARRIER REDUCTASE
    8e-19  37%  2ptgA  [x.x.x] ENOYL-ACYL CARRIER REDUCTASE
    7e-18  27%  1vl8B  [c.2.1] GLUCONATE 5-DEHYDROGENASE
    7e-18  27%  1vl8A  [c.2.1] GLUCONATE 5-DEHYDROGENASE
    2e-17  29%  1fmcA  [c.2.1] 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE
    2e-17  29%  1ahhA  [c.2.1] 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE
    1e-15  30%  2nm0A  [x.x.x] PROBABLE 3-OXACYL-(ACYL-CARRIER-PROTEIN)
    2e-15  28%  3gafF  [x.x.x] 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    1e-14  28%  3gafH  [x.x.x] 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    1e-14  28%  3gafA  [x.x.x] 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    2e-14  28%  3gafE  [x.x.x] 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    2e-14  32%  1i01E  [c.2.1] BETA-KETOACYL [ACP] REDUCTASE
    2e-14  28%  3gafG  [x.x.x] 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    2e-14  28%  3gafD  [x.x.x] 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    2e-14  28%  3gafC  [x.x.x] 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    4e-14  28%  3gafB  [x.x.x] 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    5e-14  31%  1q7bA  [c.2.1] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    5e-14  26%  3cxrA  [x.x.x] DEHYDROGENASE WITH DIFFERENT SPECIFICITIES
    6e-14  30%  1q7cA  [c.2.1] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    8e-14  31%  1q7bB  [c.2.1] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    8e-14  33%  1hdcA  [c.2.1] 3-ALPHA, 20 BETA-HYDROXYSTEROID DEHYDROGENASE
    1e-13  31%  1i01B  [c.2.1] BETA-KETOACYL [ACP] REDUCTASE
    1e-13  33%  1i01G  [c.2.1] BETA-KETOACYL [ACP] REDUCTASE
    3e-13  33%  1i01D  [c.2.1] BETA-KETOACYL [ACP] REDUCTASE
    3e-13  28%  3cxtA  [x.x.x] DEHYDROGENASE WITH DIFFERENT SPECIFICITIES
    4e-13  28%  3i3oF  [x.x.x] SHORT CHAIN DEHYDROGENASE
    4e-13  28%  3i3oE  [x.x.x] SHORT CHAIN DEHYDROGENASE
    4e-13  28%  3i3oC  [x.x.x] SHORT CHAIN DEHYDROGENASE
    4e-13  28%  3i3oB  [x.x.x] SHORT CHAIN DEHYDROGENASE
    4e-13  28%  3i3oA  [x.x.x] SHORT CHAIN DEHYDROGENASE
    4e-13  27%  1cydA  [c.2.1] CARBONYL REDUCTASE
    5e-13  27%  1uzlA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    7e-13  33%  1i01H  [c.2.1] BETA-KETOACYL [ACP] REDUCTASE
    7e-13  32%  1i01F  [c.2.1] BETA-KETOACYL [ACP] REDUCTASE
    9e-13  29%  1zemA  [x.x.x] XYLITOL DEHYDROGENASE
    1e-12  30%  3ctmE  [x.x.x] CARBONYL REDUCTASE
    2e-12  30%  3i3oH  [x.x.x] SHORT CHAIN DEHYDROGENASE
    2e-12  27%  1xkqB  [c.2.1] SHORT-CHAIN REDUCTASE FAMILY MEMBER (5D234)
    2e-12  27%  1xkqA  [c.2.1] SHORT-CHAIN REDUCTASE FAMILY MEMBER (5D234)
    2e-12  32%  1i01A  [c.2.1] BETA-KETOACYL [ACP] REDUCTASE
    3e-12  37%  1ulsB  [c.2.1] PUTATIVE 3-OXOACYL-ACYL CARRIER PROTEIN
    3e-12  37%  1ulsA  [c.2.1] PUTATIVE 3-OXOACYL-ACYL CARRIER PROTEIN
    3e-12  30%  3ctmG  [x.x.x] CARBONYL REDUCTASE
    3e-12  30%  3ctmC  [x.x.x] CARBONYL REDUCTASE
    3e-12  27%  1uzlB  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    4e-12  24%  1pr9A  [c.2.1] L-XYLULOSE REDUCTASE
    6e-12  33%  1i01C  [c.2.1] BETA-KETOACYL [ACP] REDUCTASE
    7e-12  29%  2p68A  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    1e-11  28%  3ctmA  [x.x.x] CARBONYL REDUCTASE
    1e-11  37%  1ulsC  [c.2.1] PUTATIVE 3-OXOACYL-ACYL CARRIER PROTEIN
    1e-11  26%  1g0nB  [c.2.1] TRIHYDROXYNAPHTHALENE REDUCTASE
    2e-11  29%  1w6uA  [c.2.1] 2,4-DIENOYL-COA REDUCTASE, MITOCHONDRIAL
    2e-11  30%  2p68B  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    2e-11  30%  3i3oG  [x.x.x] SHORT CHAIN DEHYDROGENASE
    3e-11  28%  3ftpA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    4e-11  34%  2a4kA  [x.x.x] 3-OXOACYL-[ACYL CARRIER PROTEIN] REDUCTASE
    5e-11  25%  1uznA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    5e-11  24%  3d3wA  [x.x.x] L-XYLULOSE REDUCTASE
    6e-11  26%  1ybvA  [c.2.1] TRIHYDROXYNAPHTHALENE REDUCTASE
    6e-11  29%  1w6uD  [c.2.1] 2,4-DIENOYL-COA REDUCTASE, MITOCHONDRIAL
    6e-11  29%  3ijrH  [x.x.x] OXIDOREDUCTASE, SHORT CHAIN
    6e-11  29%  3ijrF  [x.x.x] OXIDOREDUCTASE, SHORT CHAIN
    6e-11  29%  3ijrE  [x.x.x] OXIDOREDUCTASE, SHORT CHAIN
    6e-11  29%  3ijrB  [x.x.x] OXIDOREDUCTASE, SHORT CHAIN
    6e-11  29%  3ijrA  [x.x.x] OXIDOREDUCTASE, SHORT CHAIN
    6e-11  26%  1g0oC  [c.2.1] TRIHYDROXYNAPHTHALENE REDUCTASE
    6e-11  26%  1g0oA  [c.2.1] TRIHYDROXYNAPHTHALENE REDUCTASE
    6e-11  26%  1dohB  [c.2.1] TRIHYDROXYNAPHTHALENE REDUCTASE
    6e-11  26%  1dohA  [c.2.1] TRIHYDROXYNAPHTHALENE REDUCTASE
    8e-11  31%  1yxmC  [x.x.x] PEROXISOMAL TRANS 2-ENOYL COA REDUCTASE
    8e-11  27%  1k2wA  [c.2.1] SORBITOL DEHYDROGENASE
    1e-10  27%  1uznB  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    1e-10  26%  1uzmA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    1e-10  28%  3ctmH  [x.x.x] CARBONYL REDUCTASE
    1e-10  30%  2bgkA  [x.x.x] RHIZOME SECOISOLARICIRESINOL DEHYDROGENASE
    1e-10  29%  1w6uC  [c.2.1] 2,4-DIENOYL-COA REDUCTASE, MITOCHONDRIAL
    1e-10  29%  2ntnA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    1e-10  29%  2hq1A  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    1e-10  29%  3ctmF  [x.x.x] CARBONYL REDUCTASE
    2e-10  30%  2ntnB  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    2e-10  30%  3ftpD  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    3e-10  29%  3ftpC  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    3e-10  28%  3ctmD  [x.x.x] CARBONYL REDUCTASE
    3e-10  28%  3ctmB  [x.x.x] CARBONYL REDUCTASE
    4e-10  29%  1xhlA  [c.2.1] SHORT-CHAIN DEHYDROGENASE/REDUCTASE FAMILY
    5e-10  29%  1uzmB  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    5e-10  24%  3iccA  [x.x.x] PUTATIVE 3-OXOACYL-(ACYL CARRIER PROTEIN)
    7e-10  23%  1yxmD  [x.x.x] PEROXISOMAL TRANS 2-ENOYL COA REDUCTASE
    7e-10  29%  1w6uB  [c.2.1] 2,4-DIENOYL-COA REDUCTASE, MITOCHONDRIAL
    1e-09  32%  2d1yB  [x.x.x] HYPOTHETICAL PROTEIN TT0321
    2e-09  27%  1spxA  [c.2.1] SHORT-CHAIN REDUCTASE FAMILY MEMBER (5L265)
    2e-09  28%  1ja9A  [c.2.1] 1,3,6,8-TETRAHYDROXYNAPHTHALENE REDUCTASE
    2e-09  23%  2cfcA  [x.x.x] 2-(R)-HYDROXYPROPYL-COM DEHYDROGENASE
    3e-09  25%  1x7gB  [c.2.1] PUTATIVE KETOACYL REDUCTASE
    3e-09  33%  2d1yD  [x.x.x] HYPOTHETICAL PROTEIN TT0321
    5e-09  27%  1yxmB  [x.x.x] PEROXISOMAL TRANS 2-ENOYL COA REDUCTASE
    5e-09  23%  1o5iA  [c.2.1] 3-OXOACYL-(ACYL CARRIER PROTEIN) REDUCTASE
    6e-09  27%  1h5qA  [c.2.1] NADP-DEPENDENT MANNITOL DEHYDROGENASE
    6e-09  33%  2d1yA  [x.x.x] HYPOTHETICAL PROTEIN TT0321
    8e-09  33%  2d1yC  [x.x.x] HYPOTHETICAL PROTEIN TT0321
    1e-08  29%  3emkB  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    1e-08  25%  3ezlA  [x.x.x] ACETOACETYL-COA REDUCTASE
    2e-08  24%  1xr3B  [x.x.x] ACTINORHODIN POLYKETIDE KETOREDUCTASE
    2e-08  26%  1nffA  [c.2.1] PUTATIVE OXIDOREDUCTASE RV2002
    3e-08  24%  1w4zB  [c.2.1] KETOACYL REDUCTASE
    3e-08  24%  3i4fD  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    4e-08  23%  1yxmA  [x.x.x] PEROXISOMAL TRANS 2-ENOYL COA REDUCTASE
    4e-08  31%  1w0cH  [c.2.1] PTERIDINE REDUCTASE
    4e-08  26%  2uvdA  [x.x.x] 3-OXOACYL-(ACYL-CARRIER-PROTEIN) REDUCTASE
    4e-08  26%  2q2qE  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    4e-08  27%  3gvcA  [x.x.x] PROBABLE SHORT-CHAIN TYPE
    5e-08  26%  2q2vD  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    5e-08  29%  2p8kB  [x.x.x] PTERIDINE REDUCTASE 1
    5e-08  24%  3i4fC  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    5e-08  30%  2bfpD  [x.x.x] PTERIDINE REDUCTASE 1
    7e-08  31%  1e92D  [c.2.1] PTERIDINE REDUCTASE 1
    7e-08  27%  3bmoA  [x.x.x] PTERIDINE REDUCTASE
    7e-08  31%  2bfmC  [x.x.x] PTERIDINE REDUCTASE 1
    9e-08  29%  1w73A  [c.2.1] 2,4-DIENOYL-COA REDUCTASE
    9e-08  30%  1w0cC  [c.2.1] PTERIDINE REDUCTASE
    9e-08  30%  1w0cB  [c.2.1] PTERIDINE REDUCTASE
    9e-08  26%  2q2qA  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    9e-08  25%  3i4fA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    9e-08  31%  2ag5C  [x.x.x] DEHYDROGENASE/REDUCTASE (SDR FAMILY) MEMBER 6
    9e-08  31%  2ag5B  [x.x.x] DEHYDROGENASE/REDUCTASE (SDR FAMILY) MEMBER 6
    9e-08  31%  2ag5A  [x.x.x] DEHYDROGENASE/REDUCTASE (SDR FAMILY) MEMBER 6
    1e-07  28%  2qhxC  [x.x.x] PTERIDINE REDUCTASE 1
    1e-07  26%  2q2qC  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    1e-07  29%  2p8kD  [x.x.x] PTERIDINE REDUCTASE 1
    1e-07  30%  1e92B  [c.2.1] PTERIDINE REDUCTASE 1
    1e-07  29%  2bf7C  [x.x.x] PTERIDINE REDUCTASE 1
    1e-07  23%  2ae2A  [c.2.1] PROTEIN (TROPINONE REDUCTASE-II)
    1e-07  24%  2rhrB  [x.x.x] ACTINORHODIN POLYKETIDE KETOREDUCTASE
    1e-07  28%  2qhxA  [x.x.x] PTERIDINE REDUCTASE 1
    1e-07  31%  1p33D  [c.2.1] PTERIDINE REDUCTASE 1
    1e-07  30%  1p33A  [c.2.1] PTERIDINE REDUCTASE 1
    1e-07  28%  1e7wA  [c.2.1] PTERIDINE REDUCTASE
    1e-07  24%  3csdB  [x.x.x] PUTATIVE KETOACYL REDUCTASE
    1e-07  32%  2bfaC  [x.x.x] PTERIDINE REDUCTASE 1
    1e-07  32%  2bf7D  [x.x.x] PTERIDINE REDUCTASE 1
    1e-07  28%  2bf7B  [x.x.x] PTERIDINE REDUCTASE 1
    1e-07  22%  2ae1A  [x.x.x] TROPINONE REDUCTASE-II
    2e-07  26%  2zatA  [x.x.x] DEHYDROGENASE/REDUCTASE SDR FAMILY MEMBER 4
    2e-07  25%  1x7hB  [c.2.1] PUTATIVE KETOACYL REDUCTASE
    2e-07  25%  1x7gA  [c.2.1] PUTATIVE KETOACYL REDUCTASE
    2e-07  25%  1w4zA  [c.2.1] KETOACYL REDUCTASE
    2e-07  25%  2rhrA  [x.x.x] ACTINORHODIN POLYKETIDE KETOREDUCTASE
    2e-07  25%  2rh4B  [x.x.x] ACTINORHODIN POLYKETIDE KETOREDUCTASE
    2e-07  25%  2rh4A  [x.x.x] ACTINORHODIN POLYKETIDE KETOREDUCTASE
    2e-07  26%  2q2vC  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    2e-07  26%  2q2qH  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    2e-07  26%  2q2qG  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    2e-07  29%  2p8kA  [x.x.x] PTERIDINE REDUCTASE 1
    2e-07  24%  1iy8A  [c.2.1] LEVODIONE REDUCTASE
    2e-07  26%  3gvcD  [x.x.x] PROBABLE SHORT-CHAIN TYPE
    2e-07  23%  1ae1A  [c.2.1] TROPINONE REDUCTASE-I
    2e-07  27%  1ydeP  [x.x.x] RETINAL DEHYDROGENASE/REDUCTASE 3
    2e-07  27%  1ydeM  [x.x.x] RETINAL DEHYDROGENASE/REDUCTASE 3
    2e-07  27%  1ydeI  [x.x.x] RETINAL DEHYDROGENASE/REDUCTASE 3
    2e-07  27%  1ydeH  [x.x.x] RETINAL DEHYDROGENASE/REDUCTASE 3
    2e-07  27%  1ydeG  [x.x.x] RETINAL DEHYDROGENASE/REDUCTASE 3
    2e-07  27%  1ydeF  [x.x.x] RETINAL DEHYDROGENASE/REDUCTASE 3
    2e-07  27%  1ydeD  [x.x.x] RETINAL DEHYDROGENASE/REDUCTASE 3
    2e-07  27%  1ydeA  [x.x.x] RETINAL DEHYDROGENASE/REDUCTASE 3
    2e-07  30%  3edmD  [x.x.x] SHORT CHAIN DEHYDROGENASE
    2e-07  30%  3edmA  [x.x.x] SHORT CHAIN DEHYDROGENASE
    2e-07  30%  1e7wB  [c.2.1] PTERIDINE REDUCTASE
    3e-07  24%  2zk7B  [x.x.x] GLUCOSE 1-DEHYDROGENASE RELATED PROTEIN
    3e-07  30%  2qhxD  [x.x.x] PTERIDINE REDUCTASE 1
    3e-07  26%  2q2wC  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    3e-07  26%  2q2qF  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    3e-07  30%  3grpA  [x.x.x] 3-OXOACYL-(ACYL CARRIERPROTEIN) REDUCTASE
    3e-07  30%  3edmB  [x.x.x] SHORT CHAIN DEHYDROGENASE
    3e-07  24%  2dteA  [x.x.x] GLUCOSE 1-DEHYDROGENASE RELATED PROTEIN
    3e-07  30%  2bfoA  [x.x.x] PTERIDINE REDUCTASE 1
    3e-07  29%  2bfmB  [x.x.x] PTERIDINE REDUCTASE 1
    4e-07  29%  1w0cA  [c.2.1] PTERIDINE REDUCTASE
    4e-07  25%  2q2vA  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    4e-07  27%  3gvcC  [x.x.x] PROBABLE SHORT-CHAIN TYPE
    4e-07  27%  3gvcB  [x.x.x] PROBABLE SHORT-CHAIN TYPE
    4e-07  29%  3ennD  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    4e-07  29%  3ennC  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    4e-07  26%  2c07A  [x.x.x] 3-OXOACYL-(ACYL-CARRIER PROTEIN) REDUCTASE
    4e-07  27%  3bmfA  [x.x.x] PTERIDINE REDUCTASE
    4e-07  30%  2bfaB  [x.x.x] PTERIDINE REDUCTASE 1
    6e-07  27%  1ydeN  [x.x.x] RETINAL DEHYDROGENASE/REDUCTASE 3
    6e-07  27%  1ydeB  [x.x.x] RETINAL DEHYDROGENASE/REDUCTASE 3
    6e-07  27%  1xg5A  [c.2.1] ARPG836
    6e-07  26%  2q2wD  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    6e-07  28%  1p33C  [c.2.1] PTERIDINE REDUCTASE 1
    6e-07  28%  1p33B  [c.2.1] PTERIDINE REDUCTASE 1
    6e-07  26%  3bmdB  [x.x.x] PTERIDINE REDUCTASE
    6e-07  29%  2bfpB  [x.x.x] PTERIDINE REDUCTASE 1
    6e-07  30%  2bfoC  [x.x.x] PTERIDINE REDUCTASE 1
    6e-07  30%  2bfaA  [x.x.x] PTERIDINE REDUCTASE 1
    6e-07  29%  2bf7A  [x.x.x] PTERIDINE REDUCTASE 1
    7e-07  30%  1w73D  [c.2.1] 2,4-DIENOYL-COA REDUCTASE
    7e-07  29%  1w73C  [c.2.1] 2,4-DIENOYL-COA REDUCTASE
    7e-07  29%  3grpB  [x.x.x] 3-OXOACYL-(ACYL CARRIERPROTEIN) REDUCTASE
    7e-07  28%  3bmnD  [x.x.x] PTERIDINE REDUCTASE
    7e-07  27%  3bmkC  [x.x.x] PTERIDINE REDUCTASE
    9e-07  27%  2wd7C  [x.x.x] PTERIDINE REDUCTASE
    9e-07  27%  2vz0A  [x.x.x] PTERIDINE REDUCTASE
    9e-07  26%  2q2qB  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    9e-07  32%  3imfB  [x.x.x] SHORT CHAIN DEHYDROGENASE
    9e-07  32%  2ewmB  [x.x.x] (S)-1-PHENYLETHANOL DEHYDROGENASE
    9e-07  32%  2ewmA  [x.x.x] (S)-1-PHENYLETHANOL DEHYDROGENASE
    9e-07  28%  3ennA  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    9e-07  31%  2dknA  [x.x.x] 3-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    9e-07  27%  3bmoC  [x.x.x] PTERIDINE REDUCTASE
    9e-07  26%  3bmnC  [x.x.x] PTERIDINE REDUCTASE
    1e-06  25%  2wd7B  [x.x.x] PTERIDINE REDUCTASE
    1e-06  25%  2vz0B  [x.x.x] PTERIDINE REDUCTASE
    1e-06  30%  2p8kC  [x.x.x] PTERIDINE REDUCTASE 1
    1e-06  32%  2ew8A  [x.x.x] (S)-1-PHENYLETHANOL DEHYDROGENASE
    1e-06  31%  1e92C  [c.2.1] PTERIDINE REDUCTASE 1
    1e-06  26%  3bmoD  [x.x.x] PTERIDINE REDUCTASE
    1e-06  26%  3bmiB  [x.x.x] PTERIDINE REDUCTASE
    1e-06  22%  1ae1B  [c.2.1] TROPINONE REDUCTASE-I
    1e-06  42%  2a4kB  [x.x.x] 3-OXOACYL-[ACYL CARRIER PROTEIN] REDUCTASE
    2e-06  32%  3imfA  [x.x.x] SHORT CHAIN DEHYDROGENASE
    2e-06  28%  3emkD  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    2e-06  29%  2c7vA  [x.x.x] PTERIDINE REDUCTASE
    2e-06  29%  3bmqA  [x.x.x] PTERIDINE REDUCTASE
    2e-06  31%  2bfaD  [x.x.x] PTERIDINE REDUCTASE 1
    2e-06  26%  2q2wA  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    2e-06  26%  2q2vB  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    2e-06  25%  2gdzA  [x.x.x] NAD+-DEPENDENT 15-HYDROXYPROSTAGLANDIN
    2e-06  27%  3bmfD  [x.x.x] PTERIDINE REDUCTASE
    2e-06  27%  3bmeA  [x.x.x] PTERIDINE REDUCTASE
    3e-06  24%  2ztuD  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    3e-06  24%  1x1tA  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    3e-06  27%  1x1eA  [x.x.x] 2-DEOXY-D-GLUCONATE 3-DEHYDROGENASE
    3e-06  30%  1w0cE  [c.2.1] PTERIDINE REDUCTASE
    3e-06  31%  2p8kG  [x.x.x] PTERIDINE REDUCTASE 1
    3e-06  27%  2ekpA  [x.x.x] 2-DEOXY-D-GLUCONATE 3-DEHYDROGENASE
    3e-06  26%  3bmoB  [x.x.x] PTERIDINE REDUCTASE
    3e-06  28%  3bmnA  [x.x.x] PTERIDINE REDUCTASE
    3e-06  26%  3bmfB  [x.x.x] PTERIDINE REDUCTASE
    3e-06  24%  2b4qB  [x.x.x] RHAMNOLIPIDS BIOSYNTHESIS 3-OXOACYL-[ACYL-
    3e-06  22%  2b4qA  [x.x.x] RHAMNOLIPIDS BIOSYNTHESIS 3-OXOACYL-[ACYL-
    4e-06  29%  1w73B  [c.2.1] 2,4-DIENOYL-COA REDUCTASE
    4e-06  30%  1w0cF  [c.2.1] PTERIDINE REDUCTASE
    4e-06  33%  3imfC  [x.x.x] SHORT CHAIN DEHYDROGENASE
    4e-06  36%  3grpC  [x.x.x] 3-OXOACYL-(ACYL CARRIERPROTEIN) REDUCTASE
    4e-06  30%  1e92A  [c.2.1] PTERIDINE REDUCTASE 1
    5e-06  23%  2z1nB  [x.x.x] DEHYDROGENASE
    5e-06  30%  2p8kH  [x.x.x] PTERIDINE REDUCTASE 1
    5e-06  32%  2ew8B  [x.x.x] (S)-1-PHENYLETHANOL DEHYDROGENASE
    6e-06  22%  2ztvC  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    6e-06  22%  2ztmD  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    8e-06  23%  2ztuC  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    8e-06  23%  2ztuB  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    8e-06  24%  2z1nA  [x.x.x] DEHYDROGENASE
    8e-06  25%  1xg5C  [c.2.1] ARPG836
    8e-06  30%  1w0cG  [c.2.1] PTERIDINE REDUCTASE
    8e-06  38%  3grpD  [x.x.x] 3-OXOACYL-(ACYL CARRIERPROTEIN) REDUCTASE
    8e-06  23%  3gk3C  [x.x.x] ACETOACETYL-COA REDUCTASE
    8e-06  23%  3gk3A  [x.x.x] ACETOACETYL-COA REDUCTASE
    8e-06  27%  3emkA  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    8e-06  29%  2ekqD  [x.x.x] 2-DEOXY-D-GLUCONATE 3-DEHYDROGENASE
    8e-06  29%  3edmC  [x.x.x] SHORT CHAIN DEHYDROGENASE
    8e-06  28%  3bmeC  [x.x.x] PTERIDINE REDUCTASE
    1e-05  23%  2ztvB  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    1e-05  22%  3gk3D  [x.x.x] ACETOACETYL-COA REDUCTASE
    1e-05  22%  3gk3B  [x.x.x] ACETOACETYL-COA REDUCTASE
    1e-05  27%  3ennB  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    1e-05  29%  3emkC  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    1e-05  27%  1xg5B  [c.2.1] ARPG836
    1e-05  23%  2japC  [x.x.x] CLAVALDEHYDE DEHYDROGENASE
    1e-05  23%  2japA  [x.x.x] CLAVALDEHYDE DEHYDROGENASE
    2e-05  23%  2ztuA  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    2e-05  27%  3bmqC  [x.x.x] PTERIDINE REDUCTASE
    2e-05  27%  3bmnB  [x.x.x] PTERIDINE REDUCTASE
    2e-05  26%  3bmfC  [x.x.x] PTERIDINE REDUCTASE
    2e-05  27%  3bmeB  [x.x.x] PTERIDINE REDUCTASE
    2e-05  22%  2ztmC  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    2e-05  22%  2yz7A  [x.x.x] D-3-HYDROXYBUTYRATE DEHYDROGENASE
    2e-05  29%  2c7vB  [x.x.x] PTERIDINE REDUCTASE
    3e-05  23%  2ztvD  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    3e-05  22%  2ztlA  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    3e-05  28%  2c7vD  [x.x.x] PTERIDINE REDUCTASE
    3e-05  28%  2c7vC  [x.x.x] PTERIDINE REDUCTASE
    3e-05  28%  3bmjD  [x.x.x] PTERIDINE REDUCTASE
    4e-05  37%  1nhgC  [c.2.1] ENOYL-ACYL CARRIER REDUCTASE
    5e-05  23%  2ztmB  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    9e-05  22%  2ztmA  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    9e-05  27%  3f9iA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    1e-04  25%  2ph3A  [x.x.x] 3-OXOACYL-[ACYL CARRIER PROTEIN] REDUCTASE
    1e-04  29%  1nfrA  [c.2.1] PUTATIVE OXIDOREDUCTASE RV2002
    2e-04  32%  3f9iB  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    3e-04  22%  3g1tA  [x.x.x] SHORT CHAIN DEHYDROGENASE
    3e-04  20%  1rwbA  [c.2.1] GLUCOSE 1-DEHYDROGENASE
    3e-04  24%  2pd6B  [x.x.x] ESTRADIOL 17-BETA-DEHYDROGENASE 8
    4e-04  25%  2zk7A  [x.x.x] GLUCOSE 1-DEHYDROGENASE RELATED PROTEIN
    4e-04  20%  1g6kA  [c.2.1] GLUCOSE 1-DEHYDROGENASE
    6e-04  20%  1geeA  [c.2.1] GLUCOSE 1-DEHYDROGENASE
    6e-04  20%  1gcoA  [c.2.1] GLUCOSE DEHYDROGENASE
    0.001  40%  2vr2A  [x.x.x] DIHYDROPYRIMIDINASE
:272

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxQASGLMAGKRGLIMGVANNRSIAWGIAKACADAGAELALTWQGDALKKRVEPLAQELGAFMAGHCDVT
3grkB           -----GLLQGKRGLILGVANNRSXXXXXXXXXXXXXXXXXFTYQGDALKKRVEPLAEELGAFVAGHCDVA
3grkD           -----GLLQGKRGLILGVANNRSXXXXXXXXXXXXXXXXXFTYQGDALKKRVEPLAEELGAFVAGHCDVA
3grkA           -----GLLQGKRGLILGVANNRSXXXXXXXXXXXXXXXXXFTYQGDALKKRVEPLAEELGAFVAGHCDVA
3grkG           -----GLLQGKRGLILGVANNRSXXXXXXXXXXXXXXXXXFTYQGDALKKRVEPLAEELGAFVAGHCDVA
3k2eA           ------LMEGKKGVIIGVANDKSLAWGIAKAVCAQGAEVALTYLSETFKKRVDPLAESLGVKLTVPCDVS
3k2eB           ------LMEGKKGVIIGVANDKSLAWGIAKAVCAQGAEVALTYLSETFKKRVDPLAESLGVKLTVPCDVS
2pd3A           -----GFLKGKKGLIVGVANNKSIAYGIAQSCFNQGATLAFTYLNESLEKRVRPIAQELNSPYVYELDVS
2qioA           ------LLQGKTFVVMGVANQRSIAWGIARSLHNAGAKLIFTYAGERLERNVRELADTLEGSLVLPCDVT
3ek2A           -----GFLDGKRILLTGLLSNRSIAYGIAKACKREGAELAFTYVGDRFKDRITEFAAEFGSELVFPCDVA
3ek2C           -----GFLDGKRILLTGLLSNRSIAYGIAKACKREGAELAFTYVGDRFKDRITEFAAEFGSELVFPCDVA
3ek2D           -----GFLDGKRILLTGLLSNRSIAYGIAKACKREGAELAFTYVGDRFKDRITEFAAEFGSELVFPCDVA
3ek2B           -----GFLDGKRILLTGLLSNRSIAYGIAKACKREGAELAFTYVGDRFKDRITEFAAEFGSELVFPCDVA
1qsgG           -----GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVA
1qsgA           -----GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVA
1qg6A           -----GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVA
2p91B           -----GLLEGKRALITGVANERSIAYGIAKSFHREGAQLAFTYATPKLEKRVREIAKGFGSDLVVKCDVS
1c14A           -----GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVA
2p91A           -----GLLEGKRALITGVANERSIAYGIAKSFHREGAQLAFTYATPKLEKRVREIAKGFGSDLVVKCDVS
2yw9B           -------LSGKKALVMGVTNQRSLGFAIAAKLKEAGAEVALSYQAERLRPXXXXXXXXXXXXXXFRADVT
2fhsB           -----GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVA
2yw9C           -------LSGKKALVMGVTNQRSLGFAIAAKLKEAGAEVALSYQAERLRPXXXXXXXXXXXXXXFRADVT
2yw9F           -------LSGKKALVMGVTNQRSLGFAIAAKLKEAGAEVALSYQAERLRPXXXXXXXXXXXXXXFRADVT
2yw9A           -------LSGKKALVMGVTNQRSLGFAIAAKLKEAGAEVALSYQAERLRPXXXXXXXXXXXXXXFRADVT
2yw9H           -------LSGKKALVMGVTNQRSLGFAIAAKLKEAGAEVALSYQAERLRPXXXXXXXXXXXXXXFRADVT
2yw9E           -------LSGKKALVMGVTNQRSLGFAIAAKLKEAGAEVALSYQAERLRPXXXXXXXXXXXXXXFRADVT
1lxcA           -----GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVA
2yw9D           -------LSGKKALVMGVTNQRSLGFAIAAKLKEAGAEVALSYQAERLRPXXXXXXXXXXXXXXFRADVT
1i30A           -----GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVA
2p91D           -----GLLEGKRALITGVANERSIAYGIAKSFHREGAQLAFTYATPKLEKRVREIAKGFGSDLVVKCDVS
1dfiA           -----GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVA
2p91C           ------LLEGKRALITGVANERSIAYGIAKSFHREGAQLAFTYATPKLEKRVREIAKGFGSDLVVKCDVS
1lx6A           -----GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVA
1uluB           -------LSGKKALV-GVTNQRSLGFAIAAKLKEAGAEVALSYQAERLRPXXXXXXXXXXXXXXFRADVT
2jjyA           -----GFLAGKKILITGLLSNKSIAYGIAKAMHREGAELAFTYVGQ-FKDRVEKLCAEFNPAAVLPCDVI
2jjyD           -----GFLAGKKILITGLLSNKSIAYGIAKAMHREGAELAFTYVGQ-FKDRVEKLCAEFNPAAVLPCDVI
2jjyB           -----GFLAGKKILITGLLSNKSIAYGIAKAMHREGAELAFTYVGQ-FKDRVEKLCAEFNPAAVLPCDVI
2jjyC           -----GFLAGKKILITGLLSNKSIAYGIAKAMHREGAELAFTYVGQ-FKDRVEKLCAEFNPAAVLPCDVI
1uluC           -------LSGKKALV-GVTNQRSLGFAIAAKLKEAGAEVALSYQAERLRPXXXXXXXXXXXXXXFRADVT
1uluA           -------LSGKKALV-GVTNQRSLGFAIAAKLKEAGAEVALSYQAERLRPXXXXXXXXXXXXXXFRADVT
1uluD           -------LSGKKALV-GVTNQRSLGFAIAAKLKEAGAEVALSYQAERLRPXXXXXXXXXXXXXXFRADVT
2o2sB           -------LRGQTAFVAGVADSHGYGWAIAKHLASAGARVALTWPPDAAFDKPEDVPQDINKRYAG----V
2o2sA           -------LRGQTAFVAGVADSHGYGWAIAKHLASAGARVALTWPPDAAFDKPEDVPQDINKRYAG----V
1enoA           -------LRGKRAFIAGIADDNGYGWAVAKSLAAAGAEILVTWRGKFDQSRVLPKVYPLDAVFDNPEDVP
1d7oA           -------LRGKRAFIAGIADDNGYGWAVAKSLAAAGAEILVTWRGKFDQSRVLPKVYPLDAVFDNPEDVP
1cwuA           -------LRGKRAFIAGIADDNGYGWAVAKSLAAAGAEILVTWRGKFDQSRVLPKVYPLDAVFDNPEDVP
2o50A           -------LRGQTAFVAGVADSHGYGWAIAKHLASAGARVALTWPPDAAFDKPEDVPQDINKRYAG----V
2o50B           -------LRGQTAFVAGVADSHGYGWAIAKHLASAGARVALTWPPDAAFDKPEDVPQDINKRYAG----V
3fnfB           ----TGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLT--GFDRLRLIQRITDRLPAKAPLELDVQ
2b35D           ----TGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLT--GFDRLRLIQRITDRLPAKAPLELDVQ
3fnfD           ----TGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLT--GFDRLRLIQRITDRLPAKAPLELDVQ
2b35C           ----TGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLT--GFDRLRLIQRITDRLPAKAPLELDVQ
3fnfC           ----TGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLT--GFDRLRLIQRITDRLPAKAPLELDVQ
3fneB           ----TGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLT--GFDRLRLIQRITDRLPAKAPLELDVQ
2nv6A           ----AGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLT--GFDRLRLIQRITDRLPAKAPLELDVQ
3fneC           ----TGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLT--GFDRLRLIQRITDRLPAKAPLELDVQ
2aqkA           ----TGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLT--GFDRLRLIQRITDRLPAKAPLELDVQ
2h7iA           ----TGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLT--GFDRLRLIQRITDRLPAKAPLELDVQ
1enyA           ----AGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLT--GFDRLRLIQRITDRLPAKAPLELDVQ
2op0B           ----------------------------------------------------------------------
2oosA           ----------------------------------------------------------------------
2aqiA           ----TGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLTFDRLRLTQRITDRLPAKAPLL--ELDVQ
2aqhA           ----TGLLDGKRILVSGIITDSSVAFHIARVAQEQGAQLVLT--GFDRLRLIQRITDRLPAKAPLELDVQ
2aq8A           -----GLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLT--GFDRLRLIQRITDRLPAKAPLELDVQ
2b36B           ----TGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLT--GFDRLRLIQRITDRLPAKAPLELDVQ
1uh5A           ----------------------------------------------------------------------
2oosB           ----------------------------------------------------------------------
2ol4B           ----------------------------------------------------------------------
3fneD           ----TGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLT--GFDRLRLIQRITDRLPAKAPLELDVQ
2b37B           ----TGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLT--GFDRLRLIQRITDRLPAKAPLELDVQ
2b35F           ----TGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLT--GFDRLRLIQRITDRLPAKAPLELDVQ
2b35B           ----TGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLT--GFDRLRLIQRITDRLPAKAPLELDVQ
2b35A           ----TGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLT--GFDRLRLIQRITDRLPAKAPLELDVQ
2b35E           ----TGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLT--GFDRLRLIQRITDRLPAKAPLELDVQ
1vrwA           ----------------------------------------------------------------------
2o2yD           ----------------------------------------------------------------------
2b37C           ----TGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLT--GFDRLRLIQRITDRLPAKAPLELDVQ
1zxlA           ----------------------------------------------------------------------
1zsnA           ----------------------------------------------------------------------
2o2yC           ----------------------------------------------------------------------
2o2yA           ----------------------------------------------------------------------
2ol4A           ----------------------------------------------------------------------
2ntvA           ----AGLLEGKRILVSGIITDSSIAFHIAKVAQEAGAQLVLT--GFDRLRLIQRIADRLDKAPLIELDVQ
1nhgA           ----------------------------------------------------------------------
2ptgA           -------LRGKTAFVAGVADSNGYGWAICKLLRAAGARVLVTWPPDAVFDTPQDVPPEVSSNYAGVGGFT
1vl8B           -------LRGRVALVTG--GSRGLGFGIAQGLAEAGCSVVVASRNEEASEAAQKLTEKYGVTMAFRCDVS
1vl8A           -------LRGRVALVTG--GSRGLGFGIAQGLAEAGCSVVVASRNEEASEAAQKLTEKYGVTMAFRCDVS
1fmcA           --------------------------------ATAGASVVVSINADAANHVVDEIQQLGGQAFACRCDIT
1ahhA           --------------------------------ATAGASVVVSINADAANHVVDEIQQLGGQAFACRCDIT
2nm0A           --------------VLVTGGNRGIGLAIARAFADAGDKVAITYRSG------EPPE----GFLAVKCDIT
3gafF           ----------------------------------AGASVVVTLKSEGAEAVAAAIRQAGGKAIGLECNVT
3gafH           ----------------------------------AGASVVVTLKSEGAEAVAAAIRQAGGKAIGLECNVT
3gafA           ----------------------------------AGASVVVTLKSEGAEAVAAAIRQAGGKAIGLECNVT
3gafE           ----------------------------------AGASVVVTLKSEGAEAVAAAIRQAGGKAIGLECNVT
1i01E           ---------GKIALVTGAS--RGIGRAIAETLAARGAKVIGTATSE---NGAQAISDYLGANGKGMLNVT
3gafG           ----------------------------------AGASVVVTLKSEGAEAVAAAIRQAGGKAIGLECNVT
3gafD           ----------------------------------AGASVVVTLKSEGAEAVAAAIRQAGGKAIGLECNVT
3gafC           ----------------------------------AGASVVVTLKSEGAEAVAAAIRQAGGKAIGLECNVT
3gafB           ----------------------------------AGASVVVTLKSEGAEAVAAAIRQAGGKAIGLECNVT
1q7bA           ---------GKIALVTGAS--RGIGRAIAETLAARGAKVIGTATSE---NGAQAISDYLGANGKGMLNVT
3cxrA           -------LKGKIALVTGASYG--IGFAIASAYAKAGATIVFNDINQELVDRGMAAYKAAGINAHGYCDVT
1q7cA           ---------GKIALVTGAS--RGIGRAIAETLAARGAKVIGTATSE---NGAQAISDYLGANGKGMLNVT
1q7bB           ---------GKIALVTGAS--RGIGRAIAETLAARGAKVIGTATSE---NGAQAISDYLGANGKGMLNVT
1hdcA           -------------------------------------------------------ARELGAARYQHLDVT
1i01B           ---------GKIALVTGAS--RGIGRAIAETLAARGAKVIGTATSE---NGAQAISDYLGANGKGMLNVT
1i01G           ---------GKIALVTGAS--RGIGRAIAETLAARGAKVIGTATSE---NGAQAISDYLGANGKGMLNVT
1i01D           ---------GKIALVTGAS--RGIGRAIAETLAARGAKVIGTATSE---NGAQAISDYLGANGKGMLNVT
3cxtA           -------LKGKIALVTGASYG--IGFAIASAYAKAGATIVFNDINQELVDRGMAAYKAAGINAHGYCDVT
3i3oF           --KGSEKLKGKNVLITG--GDSGIGRAVSIAFAKEGANIAIAYEGDATKQYVEKEGVKC-VLLPG--DLS
3i3oE           --KGSEKLKGKNVLITG--GDSGIGRAVSIAFAKEGANIAIAYEGDATKQYVEKEGVKC-VLLPG--DLS
3i3oC           --KGSEKLKGKNVLITG--GDSGIGRAVSIAFAKEGANIAIAYEGDATKQYVEKEGVKC-VLLPG--DLS
3i3oB           --KGSEKLKGKNVLITG--GDSGIGRAVSIAFAKEGANIAIAYEGDATKQYVEKEGVKC-VLLPG--DLS
3i3oA           --KGSEKLKGKNVLITG--GDSGIGRAVSIAFAKEGANIAIAYEGDATKQYVEKEGVKC-VLLPG--DLS
1cydA           --------SGLRALVTGAG--KGIGRDTVKALHASGAKVVAVTRTNS---DLVSLAKECPGIEPVCVDLG
1uzlA           --------------VLVTGGNRGIGLAIAQRLAADGHKVAVTHRGSGAPK----------GLFGVECDVT
1i01H           ---------GKIALVTGAS--RGIGRAIAETLAARGAKVIGTATSE---NGAQAISDYLGANGKGMLNVT
1i01F           ---------GKIALVTGAS--RGIGRAIAETLAARGAKVIGTATSE---NGAQAISDYLGANGKGMLNVT
1zemA           ---------GKVCLVTGAGGNIGLA--TALRLAEEGTAIALLDMNREALEKAEASVREKGVEARSYCDVT
3ctmE           -------LKGKVASVTG--SSGGIGWAVAEAYAQAGADVAIWYNSHPADEKAEHLQKTYGVHSKAYCNIS
3i3oH           --KGSEKLKGKNVLITG--GDSGIGRAVSIAFAKEGANIAIAYEGDATKQYVEKEGVKC-VLLPG--DLS
1xkqB           -------------------------------------------------------------------DVT
1xkqA           -------------------------------------------------------------------DVT
1i01A           ---------GKIALVTGAS--RGIGRAIAETLAARGAKVIGTATSE---NGAQAISDYLGANGKGMLNVT
1ulsB           -------------------------------------------------------------------DVA
1ulsA           -------------------------------------------------------------------DVA
3ctmG           -------LKGKVASVTG--SSGGIGWAVAEAYAQAGADVAIWYNSHPADEKAEHLQKTYGVHSKAYCNIS
3ctmC           -------LKGKVASVTG--SSGGIGWAVAEAYAQAGADVAIWYNSHPADEKAEHLQKTYGVHSKAYCNIS
1uzlB           --------------VLVTGGNRGIGLAIAQRLAADGHKVAVTHRGSGAPK----------GLFGVECDVT
1pr9A           -------LAGRRVLVTGAG--KGIGRGTVQALHATGARVVAVSRTQA---DLDSLVRECPGIEPVCVDLG
1i01C           ---------GKIALVTGAS--RGIGRAIAETLAARGAKVIGTATSE---NGAQAISDYLGANGKGL--ML
2p68A           -------LQGKVSLVTG--STRGIGRAIAEKLASAGSTVIITGSGERAKAVAEEIANKYGVKAHGEMNLL
3ctmA           -------LKGKVASVTG--SSGGIGWAVAEAYAQAGADVAIWYNSHPADEKAEHLQKTYGVHSKAYCNIS
1ulsC           -------------------------------------------------------------------DVA
1g0nB           ----SASLEGKVALVTGAG--RGIGREMAMELGRRGCKVIVNYANESAEEVVAAIKKNGSDAACVKANVG
1w6uA           ---------------------------------------------DVLKATAEQISSQTGNKVAIQCDVR
2p68B           -------LQGKVSLVTG--STRGIGRAIAEKLASAGSTVIITGSGERAKAVAEEIANKYGVKAHGEMNLL
3i3oG           --KGSEKLKGKNVLITG--GDSGIGRAVSIAFAKEGANIAIAYEGDATKQYVEKEGVKC-VLLPG--DLS
3ftpA           -------------------------------------------------------------------NVN
2a4kA           ----------------------------------------------------------------------
1uznA           --------------VLVTGGNRGIGLAIAQRLAADGHKVAVTHRGSGAPK----------GLFGVEVDVT
3d3wA           -------LAGRRVLVTGAG--KGIGRGTVQALHATGARVVAVSRTQA---DLDSLVRECPGIEPVCVDLG
1ybvA           ----SASLEGKVALVTGAG--RGIGREMAMELGRRGCKVIVNYANESAEEVVAAIKKNGSDAACVKANVG
1w6uD           ---------------------------------------------DVLKATAEQISSQTGNKVAIQCDVR
3ijrH           --KGSEKLKGKNVLITG--GDSGIGRAVSIAFAKEGANIAIAYEGDATKQYVEKEGVKC-VLLPG--DLS
3ijrF           --KGSEKLKGKNVLITG--GDSGIGRAVSIAFAKEGANIAIAYEGDATKQYVEKEGVKC-VLLPG--DLS
3ijrE           --KGSEKLKGKNVLITG--GDSGIGRAVSIAFAKEGANIAIAYEGDATKQYVEKEGVKC-VLLPG--DLS
3ijrB           --KGSEKLKGKNVLITG--GDSGIGRAVSIAFAKEGANIAIAYEGDATKQYVEKEGVKC-VLLPG--DLS
3ijrA           --KGSEKLKGKNVLITG--GDSGIGRAVSIAFAKEGANIAIAYEGDATKQYVEKEGVKC-VLLPG--DLS
1g0oC           ----SASLEGKVALVTGAG--RGIGREMAMELGRRGCKVIVNYANESAEEVVAAIKKNGSDAACVKANVG
1g0oA           ----SASLEGKVALVTGAG--RGIGREMAMELGRRGCKVIVNYANESAEEVVAAIKKNGSDAACVKANVG
1dohB           ----SASLEGKVALVTGAG--RGIGREMAMELGRRGCKVIVNYANESAEEVVAAIKKNGSDAACVKANVG
1dohA           ----SASLEGKVALVTGAG--RGIGREMAMELGRRGCKVIVNYANESAEEVVAAIKKNGSDAACVKANVG
1yxmC           ---APGLLQGQVAIVTGGATG--IGKAIVKELLELGSNVVIASRKERLKSAADELQANLARVIPIQCNIR
1k2wA           ---------GKTALITGSA--RGIGRAFAEAYVREGARVAIA--DINLEAARXXXXXXXXXXXXXXLDVT
1uznB           --------------VLVTGGNRGIGLAIAQRLAADGHKVAVTHRGSGAPK----------GLFGVEVDVT
1uzmA           --------------VLVTGGNRGIGLAIAQRLAADGHKVAVTHRGSGAPK----------GLFGVEVDVT
3ctmH           -------LKGKVASVTG--SSGGIGWAVAEAYAQAGADVAIWYNSHPADEKAEHLQKTYGVHSKAYCNIS
2bgkA           -----------------------------------------------------------------HCDVT
1w6uC           ---------------------------------------------DVLKATAEQISSQTGNKVAIQCDVR
2ntnA           --------------VLVTGGNRGIGLAIAQRLAADGHKVAVTHRGSGAPK----------GLFGVEVDVT
2hq1A           -------LKGKTAIVTG--SSRGLGKAIAWKLGNMGANIVLN--GSPASTSLDATAEEFKAVVVAKGDVK
3ctmF           -------LKGKVASVTG--SSGGIGWAVAEAYAQAGADVAIWYNSHPADEKAEHLQKTYGVHSKAYCNIS
2ntnB           --------------VLVTGGNRGIGLAIAQRLAADGHKVAVTHRGSGAPK----------GLFGVEVDVT
3ftpD           -------------------------------------------------------------------NVN
3ftpC           -------------------------------------------------------------------NVN
3ctmD           -------LKGKVASVTG--SSGGIGWAVAEAYAQAGADVAIWYNSHPADEKAEHLQKTYGVHSKAYCNIS
3ctmB           -------LKGKVASVTG--SSGGIGWAVAEAYAQAGADVAIWYNSHPADEKAEHLQKTYGVHSKAYCNIS
1xhlA           --------SGKSVIITGSSNG--IGRSAAVIFAKEGAQVTITGRNDRLEETKQQIAEKINAVVA---DVT
1uzmB           --------------VLVTGGNRGIGLAIAQRLAADGHKVAVTHRGSGAPK----------GLFGVEVDVT
3iccA           -------LKGKVALVTGAS--RGIGRAIAKRLANDGALVAIHYRKEEAEETVYEIQSNGGSAFSIGANLE
1yxmD           ---APGLLQGQVAIVTGGATG--IGKAIVKELLELGSNVVIASRKERLKSAADELQANLARVIPIQCNIR
1w6uB           ---------------------------------------------DVLKATAEQISSQTGNKVAIQCDVR
2d1yB           ----------------------------------------------------------------------
1spxA           --------AEKVAIITGSSNG--IGRATAVLFAREGAKVTITGRH---AERLEETRQQILA--AGVSE--
1ja9A           --------------------------------------------GSSSKAAEEVVAEKLGAQVAIQADIS
2cfcA           -------------------------------------------------------------------DVA
1x7gB           ---------------------------IARRLGKEGLRVFVCARGEEGLRTTLKELREAGVEADGRCDVR
2d1yD           ----------------------------------------------------------------------
1yxmB           ---APGLLQGQVAIVTGGATG--IGKAIVKELLELGSNVVIASRADELQANLPPTKQ--ARVIPIQCNIR
1o5iA           --------------VLVLAASRGIGRAVADVLSQEGAEVTICARNEELLKR------------SGHCDLR
1h5qA           ----------------------------------------------------EKVGKEFGVTKAYQCDVS
2d1yA           ----------------------------------------------------------------------
2d1yC           ----------------------------------------------------------------------
3emkB           -------LTGRKALVTGATGGLGEA--IARALHAQGAIVGLHGTRE-LKELAAELGERIFVFPA---NLS
3ezlA           -------------------------------------------------------------FYASEGNVG
1xr3B           ---------------------------IARRLGKEGLRVFVCARGEEGLRTTLKELREAGVEADGRCDVR
1nffA           ----SGRLTGKVALVSGGA--RGMGASHVRAMVAEGAKVVF---GDILDEEGKAMAAELAAARYVHLDVT
1w4zB           ---------------------------IARRLGKEGLRVFVCARGEEGLRTTLKELREAGVEADGRCDVR
3i4fD           ------------------AGTKGLGKQVTEKLLAKGYSVTVTYHTTAMETMKETYKDVEERLQFVQADVT
1yxmA           ---APGLLQGQVAIVTGGATG--IGKAIVKELLELGSNVVIASRADELQANLPPTKQ--ARVIPIQCNIR
1w0cH           ----------------------------------------------------------------------
2uvdA           ------MLKGKVALVTGAS--RGIGRAIAIDLAKQGANVVVNYAGNEQKNEVVDEIKKLGSAIAVRADVA
2q2qE           -------LKGKTALVTG--STSGIGLGIAQVLARAGANIVLNGFGDPAPALAE-IARHGVKAVHHPADLS
3gvcA           -------------------------------------------------------------------DVS
2q2vD           -------LKGKTALVTG--STSGIGLGIAQVLARAGANIVLNGFGDPAPALAE-IARHGVKAVHHPADLS
2p8kB           ---------------------------------------AITVQADLSNVATAPVGAD------GSAPVT
3i4fC           ------------------AGTKGLGKQVTEKLLAKGYSVTVTYHTTAMETMKETYKDVEERLQFVQADVT
2bfpD           ---------------------------------------AITVQADLSNVATAPVAP-----------VT
1e92D           ----------------------------------------------------------------------
3bmoA           ----------------------------------------------------------------------
2bfmC           ----------------------------------------------------------------------
1w73A           ------------------------------------AQCVIASRKDVLKATAEQISSQTGNKVAIQCDVR
1w0cC           ---------------------------------------AITVQADLSNVATAPVSG------AGSAPVT
1w0cB           ---------------------------------------AITVQADLSNVATAPVS---GA--DGSAPVT
2q2qA           -------LKGKTALVTG--STSGIGLGIAQVLARAGANIVLNGFGDPAPALAE-IARHGVKAVHHPADLS
3i4fA           ------------------AGTKGLGKQVTEKLLAKGYSVTVTYHSDTMKETYKDVEERLQFVQA---DVT
2ag5C           -------------------------------------------------------------------DVT
2ag5B           -------------------------------------------------------------------DVT
2ag5A           -------------------------------------------------------------------DVT
2qhxC           ----------------------------------------------------------------------
2q2qC           -------LKGKTALVTG--STSGIGLGIAQVLARAGANIVLNGFGDPAPALAE-IARHGVKAVHHPADLS
2p8kD           ---------------------------------------AITVQADLSNVATAPVAP-----------VT
1e92B           ----------------------------------------------------------------------
2bf7C           ----------------------------------------------------------------------
2ae2A           -------LEGCTALVTG--GSRGIGYGIVEELASLGASVYTCSRNQKLNDCLTQWRSKGFKVEASVCDLS
2rhrB           ---------------------------IARRLGKEGLRVFVCARGEEGLRTTLKELREAGVEADGRCDVR
2qhxA           ----------------------------------------------------------------------
1p33D           ---------------------------------------------------------------ASSVPVT
1p33A           ---------------------------------------------------------------ASSVPVT
1e7wA           ----------------------------------------------------------------------
3csdB           ---------------------------IARRLGKEGLRVFVCARGEEGLRTTLKELREAGVEADGRCDVR
2bfaC           ----------------------------------------------------------------------
2bf7D           ----------------------------------------------------------------------
2bf7B           ----------------------------------------------------------------------
2ae1A           -------LEGCTALVTG--GSRGIGYGIVEELASLGASVYTCSRNQKLNDCLTQWRSKGFKVEASVCDLS
2zatA           ------------------ASTDGIGLAIARRLAQDGAHVVVSSRKQENVDRTVATLQGEGLSVTGTCHVG
1x7hB           ---------------------------IARRLGKEGLRVFVCARGEEGLRTTLKELREAGVEADGRCDVR
1x7gA           ---------------------------IARRLGKEGLRVFVCARGEEGLRTTLKELREAGVEADGRCDVR
1w4zA           ---------------------------IARRLGKEGLRVFVCARGEEGLRTTLKELREAGVEADGRCDVR
2rhrA           ---------------------------IARRLGKEGLRVFVCARGEEGLRTTLKELREAGVEADGRCDVR
2rh4B           ---------------------------IARRLGKEGLRVFVCARGEEGLRTTLKELREAGVEADGRCDVR
2rh4A           ---------------------------IARRLGKEGLRVFVCARGEEGLRTTLKELREAGVEADGRCDVR
2q2vC           -------LKGKTALVTG--STSGIGLGIAQVLARAGANIVLNGFGDPAPALAE-IARHGVKAVHHPADLS
2q2qH           -------LKGKTALVTG--STSGIGLGIAQVLARAGANIVLNGFGDPAPALAE-IARHGVKAVHHPADLS
2q2qG           -------LKGKTALVTG--STSGIGLGIAQVLARAGANIVLNGFGDPAPALAE-IARHGVKAVHHPADLS
2p8kA           ---------------------------------------AITVQADLSNVATAPVAD-------GSAPVT
1iy8A           -------------------------------------------------------------------DVS
3gvcD           -------------------------------------------------------------------DVS
1ae1A           -------LKGTTALVTG--GSKGIGYAIVEELAGLGARVYTCSRNEKELDECLEIWREKGLNVEGSCDLL
1ydeP           ------------------------------------------------------LEQELPGAVFILCDVT
1ydeM           ------------------------------------------------------LEQELPGAVFILCDVT
1ydeI           ------------------------------------------------------LEQELPGAVFILCDVT
1ydeH           ------------------------------------------------------LEQELPGAVFILCDVT
1ydeG           ------------------------------------------------------LEQELPGAVFILCDVT
1ydeF           ------------------------------------------------------LEQELPGAVFILCDVT
1ydeD           ------------------------------------------------------LEQELPGAVFILCDVT
1ydeA           ------------------------------------------------------LEQELPGAVFILCDVT
3edmD           ---------------------------IGRACAQEGANVVLTYNGAEGAATAVAEIEKLGSALAIKADLT
3edmA           ---------------------------IGRACAQEGANVVLTYNXXXXXXXXXXXXEKLGSALAIKADLT
1e7wB           ----------------------------------------------------------------------
2zk7B           ------------------------------------------------------------------CDVT
2qhxD           ----------------------------------------------------------------------
2q2wC           -------LKGKTALVTG--STSGIGLGIAQVLARAGANIVLNGFGDPAPALAE-IARHGVKAVHHPADLS
2q2qF           -------LKGKTALVTG--STSGIGLGIAQVLARAGANIVLNGFGDPAPALAE-IARHGVKAVHHPADLS
3grpA           ---------------------------------------------DKLKEIAADLGKDVFVFSA---NLS
3edmB           ---------------------------IGRACAQEGANVVLTYNXXXXXXXXXXXXEKLGSALAIKADLT
2dteA           ------------------------------------------------------------------CDVT
2bfoA           ---------------------------------------AITVQADLSNVATAPVAP-----------VT
2bfmB           ---------------------------------------AITVQADLSNVATAPVAP-----------VT
1w0cA           ---------------------------------------AITVQADLSNVATAPVS---GA--DGSAPVT
2q2vA           -------LKGKTALVTG--STSGIGLGIAQVLARAGANIVLNGFGDPAPALAE-IARHGVKAVHHPADLS
3gvcC           -------------------------------------------------------------------DVS
3gvcB           -------------------------------------------------------------------DVS
3ennD           -------------------------------------------------------------------NLS
3ennC           -------------------------------------------------------------------NLS
2c07A           ---------GENKVALVTGAGRGIGREIAKMLAKSVSHVICI---SRTQKSCDSVVDEIKSFSSGYADVS
3bmfA           ----------------------------------------------------------------------
2bfaB           ----------------------------------------------------------------------
1ydeN           ------------------------------------------------------LEQELPGAVFILCDVT
1ydeB           ------------------------------------------------------LEQELPGAVFILCDVT
1xg5A           --------------------------GIGAAVARALVQQGLKVVGCARTVNIEELAAECGTLIPYRCDLS
2q2wD           -------LKGKTALVTG--STSGIGLGIAQVLARAGANIVLNGFGDPAPALAE-IARHGVKAVHHPADLS
1p33C           ---------------------------------------------------------------ASSVPVT
1p33B           ---------------------------------------------------------------ASSVPVT
3bmdB           ----------------------------------------------------------------------
2bfpB           ----------------------------------------------------------------------
2bfoC           ----------------------------------------------------------------------
2bfaA           ----------------------------------------------------------------------
2bf7A           ----------------------------------------------------------------------
1w73D           ------------------------------------AQCVIASRKDVLKATAEQISSQTGNKVAIQCDVR
1w73C           ------------------------------------AQCVIASRKDVLKATAEQISSQTGNKVAIQCDVR
3grpB           ---------------------------------------------DKLKEIAADLGKDVFVFSA---NLS
3bmnD           ----------------------------------------------------------------------
3bmkC           ----------------------------------------------------------------------
2wd7C           ----------------------------------------------------------------------
2vz0A           ----------------------------------------------------------------------
2q2qB           -------LKGKTALVTG--STSGIGLGIAQVLARAGANIVLNGFGDPAPALAE-IARHGVKAVHHPADLS
3imfB           --------------------------------------------------------------------VQ
2ewmB           ----------KLAVITGGANG--IGRAIAERFAVEGADIAIADLVPA--PEAEAAIRNLGRVLTVKCDVS
2ewmA           ----------KLAVITGGANG--IGRAIAERFAVEGADIAIADLVPA--PEAEAAIRNLGRVLTVKCDVS
3ennA           -------------------------------------------------------------------NLS
2dknA           ----------------------------------------------------------------------
3bmoC           ----------------------------------------------------------------------
3bmnC           ----------------------------------------------------------------------
2wd7B           ----------------------------------------------------------------------
2vz0B           ----------------------------------------------------------------------
2p8kC           ----------------------------------------------------------------------
2ew8A           ----------KLAVITGGANG--IGRAIAERFAVEGADIAIADLVPA--PEAEAAIRNLGRVLTVKCDVS
1e92C           ----------------------------------------------------------------------
3bmoD           ----------------------------------------------------------------------
3bmiB           ----------------------------------------------------------------------
1ae1B           -------LKGTTALVTG--GSKGIGYAIVEELAGLGARVYTCSRNEKELDECLEIWREKGLNVEGSCDLL
2a4kB           ----------------------------------------------------------------------
3imfA           --------------------------------------------------------------------VQ
3emkD           -------------------------------------------------------------------NLS
2c7vA           ----------------------------------------------------------------------
3bmqA           ----------------------------------------------------------------------
2bfaD           ----------------------------------------------------------------------
2q2wA           -------LKGKTALVTG--STSGIGLGIAQVLARAGANIVLNGFGDPAPALAE-IARHGVKAVHHPADLS
2q2vB           -------LKGKTALVTG--STSGIGLGIAQVLARAGANIVLNGFGDPAPALAE-IARHGVKAVHHPADLS
2gdzA           ------------------------------------------------------------------CDVA
3bmfD           ----------------------------------------------------------------------
3bmeA           ----------------------------------------------------------------------
2ztuD           -------------------------------------DIVLNGFGDAAKVRAGLAAQHGVKVLYDGADLS
1x1tA           -------------------------------------DIVLNGFGDAAKVRAGLAAQHGVKVLYDGADLS
1x1eA           ----------RKALVTG--GSRGIGRAIAEALVARGYRVAIA------SRNPEEAAQSLGAVPLP----T
1w0cE           ----------------------------------------------------------------------
2p8kG           ----------------------------------------------------------------------
2ekpA           ----------RKALVTG--GSRGIGRAIAEALVARGYRVAIA------SRNPEEAAQSLGAVPLP----T
3bmoB           ----------------------------------------------------------------------
3bmnA           ----------------------------------------------------------------------
3bmfB           ----------------------------------------------------------------------
2b4qB           -------LAGRIALVTG--GSRGIGQMIAQGLLEAGARVFICAR-DA--EACADTATRLSAY--GDCQAI
2b4qA           -------LAGRIALVTG--GSRGIGQMIAQGLLEAGARVFICARDAEACADTATRLSAYGDCQAIPADLS
1w73B           ------------------------------------AQCVIASRKDVLKATAEQISSQTGNKVAIQCDVR
1w0cF           ----------------------------------------------------------------------
3imfC           --------------------------------------------------------------------VQ
3grpC           ----------------------------------------------------------------------
1e92A           ----------------------------------------------------------------------
2z1nB           -------------LAVVTAGSSGLGFASALELARNGARLLLFSRN---REKLEAAASRIASLVSGAQDIR
2p8kH           ----------------------------------------------------------------------
2ew8B           ----------KLAVITGGANG--IGRAIAERFAVEGADIAIADLVPA--PEAEAAIRNLGRVLTVKCDVS
2ztvC           -------------------------------------DIVLNGFGDAAKVRAGLAAQHGVKVLYDGADLS
2ztmD           -------------------------------------DIVLNGFGDAAKVRAGLAAQHGVKVLYDGADLS
2ztuC           -------------------------------------DIVLNGFGDAAKVRAGLAAQHGVKVLYDGADLS
2ztuB           ----------------------------------------------------------LNGFLYDGADLS
2z1nA           -------------LAVVTAGSSGLGFASALELARNGARLLLFSRN---REKLEAAASRIASLVSGAQDIR
1xg5C           --------------------------GIGAAVARALVQQGLKVVGCARTVNIEELAAECGTLIPYRCDLS
1w0cG           ----------------------------------------------------------------------
3grpD           ----------------------------------------------------------------------
3gk3C           -------------------------------------------------------------FKAYAVDVA
3gk3A           -------------------------------------------------------------FKAYAVDVA
3emkA           -------------------------------------------------------------------NLS
2ekqD           ----------RKALVTG--GSRGIGRAIAEALVARGYRVAIA------SRNPEEAAQSLGAVPLP----T
3edmC           ---------------------------IGRACAQEGANVVLTYNXXXXXXXXXXXXEKLGSALAIKADLT
3bmeC           ----------------------------------------------------------------------
2ztvB           -------------------------------------DIVLNGFGDAAKVRAGLAAQHGVKVLYDGADLS
3gk3D           -------------------------------------------------------------FKAYAVDVA
3gk3B           -------------------------------------------------------------FKAYAVDVA
3ennB           -------------------------------------------------------------------NLS
3emkC           -------------------------------------------------------------------NLS
1xg5B           --------------------------GIGAAVARALVQQGLKVVGCARTVNIEELAAECGTLIPYRCDLS
2japC           -------------------------------------------------------------------DVA
2japA           -------------------------------------------------------------------DVA
2ztuA           -------------------------------------DIVLNGFGDAAKVRAGLAAQHGVKVLYDGADLS
3bmqC           ----------------------------------------------------------------------
3bmnB           ----------------------------------------------------------------------
3bmfC           ----------------------------------------------------------------------
3bmeB           ----------------------------------------------------------------------
2ztmC           -------------------------------------DIVLNGFGDAAKVRAGLAAQHGVKVLYDGADLS
2yz7A           ------MLKGKKAVVTGSTSGIGLA--MATELAKAGADVVINGFGEDIERERSTLESKFGAYYL-NADLS
2c7vB           ----------------------------------------------------------------------
2ztvD           -------------------------------------DIVLNGFGDAAKVRAGLAAQHGVKVLYDGADLS
2ztlA           -------------------------------------DIVLNGFGDAAKVRAGLAAQHGVKVLYDGADLS
2c7vD           ----------------------------------------------------------------------
2c7vC           ----------------------------------------------------------------------
3bmjD           ----------------------------------------------------------------------
1nhgC           ----------------------------------------------------------------------
2ztmB           -------------------------------------------------------------------DLS
2ztmA           -------------------------------------DIVLNGFGDAAKVRAGLAAQHGVKVLYDGADLS
3f9iA           ----------------------------------------------------------------------
2ph3A           ----------------------------------------------------------------------
1nfrA           ----------------------------------------------------------------------
3f9iB           ----------------------------------------------------------------------
3g1tA           ----------------------------------------------------------------------
1rwbA           -------LEGKVVVITGSSTGLGKSMAIRFATEKAKVVVNYRSKEDEANSVLEEIKKVGGEAIAVKGDVT
2pd6B           ----------------------------------------------------------LGNHAAFQADVS
2zk7A           ------------------------------------------------------------------CDVT
1g6kA           -------LEGKVVVITGSSTGLGKSMAIRFATEKAKVVVNYRSKEDEANSVLEEIKKVGGEAIAVKGDVT
1geeA           -------LEGKVVVITGSSTGLGKSMAIRFATEKAKVVVNYRSKEDEANSVLEEIKKVGGEAIAVKGDVT
1gcoA           -------LEGKVVVITGSSTGLGKSMAIRFATEKAKVVVNYRSKEDEANSVLEEIKKVGGEAIAVKGDVT
2vr2A           ------------------------SWADPKVCCDYSLHVAVTWWSDQVKEEMKILVQDKGVFMA-YKDVT


                         .         .         *         .         .         .         .:140
query           DLETIDSVFASLEQHWGKIDFVVHAIAFSDKDELTGRYLDTSRDNFNRTMDISVFSLAAVAKRAEPIMND
3grkB           DAASIDAVFETLEKKWGKLDFLVHAIGFSDKDELTGRYIDTSEANFTNTMLISVYSLTAVSRRAEKLMAD
3grkD           DAASIDAVFETLEKKWGKLDFLVHAIGFSDKDELTGRYIDTSEANFTNTMLISVYSLTAVSRRAEKLMAD
3grkA           DAASIDAVFETLEKKWGKLDFLVHAIGFSDKDELTGRYIDTSEANFTNTMLISVYSLTAVSRRAEKLMAD
3grkG           DAASIDAVFETLEKKWGKLDFLVHAIGFSDKDELTGRYIDTSEANFTNTMLISVYSLTAVSRRAEKLMAD
3k2eA           DAESVDNMFKVLAEEWGSLDFVVHAVAFSDKNELKGRYVDTSLGNFLTSMHISCYSFTYIASKAEPLMTN
3k2eB           DAESVDNMFKVLAEEWGSLDFVVHAVAFSDKNELKGRYVDTSLGNFLTSMHISCYSFTYIASKAEPLMTN
2pd3A           KEEHFKSLYNSVKKDLGSLDFIVHSVAFAPKEALEGSLLETSKSAFNTAMEISVYSLIELTNTLKPLLNN
2qioA           NDEELTACFETIKQEVGTIHGVAHCIAFANRDDLKGEFVDTSRDGFLLAQNISAFSLTAVAREAKKVMTE
3ek2A           DDAQIDALFASLKTHWDSLDGLVHSIGFAPREAIAGDFLDLTRENFRIAHDISAYSFPALAKAALPMLSD
3ek2C           DDAQIDALFASLKTHWDSLDGLVHSIGFAPREAIAGDFLDLTRENFRIAHDISAYSFPALAKAALPMLSD
3ek2D           DDAQIDALFASLKTHWDSLDGLVHSIGFAPREAIAGDFLDLTRENFRIAHDISAYSFPALAKAALPMLSD
3ek2B           DDAQIDALFASLKTHWDSLDGLVHSIGFAPREAIAGDFLDLTRENFRIAHDISAYSFPALAKAALPMLSD
1qsgG           EDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNATREGFKIAHDISSYSFVAMAKACRSMLNP
1qsgA           EDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNATREGFKIAHDISSYSFVAMAKACRSMLNP
1qg6A           EDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNATREGFKIAHDISSYSFVAMAKACRSMLNP
2p91B           LDEDIKNLKKFLEENWGSLDIIVHSIAYAPKEEFKGGVIDTSREGFKIAMDISVYSLIALTRELLPLMEG
1c14A           EDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNATREGFKIAHDISSYSFVAMAKACRSMLNP
2p91A           LDEDIKNLKKFLEENWGSLDIIVHSIAYAPKEEFKGGVIDTSREGFKIAMDISVYSLIALTRELLPLMEG
2yw9B           QDEELDALFAGVKEAFGGLDYLVHAIAFAPREAMEGRYIDTRRQDWLLALEVSAYSLVAVARRAEPLLRE
2fhsB           EDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNATREGFKIAHDISSYSFVAMAKACRSMLNP
2yw9C           QDEELDALFAGVKEAFGGLDYLVHAIAFAPREAMEGRYIDTRRQDWLLALEVSAYSLVAVARRAEPLLRE
2yw9F           QDEELDALFAGVKEAFGGLDYLVHAIAFAPREAMEGRYIDTRRQDWLLALEVSAYSLVAVARRAEPLLRE
2yw9A           QDEELDALFAGVKEAFGGLDYLVHAIAFAPREAMEGRYIDTRRQDWLLALEVSAYSLVAVARRAEPLLRE
2yw9H           QDEELDALFAGVKEAFGGLDYLVHAIAFAPREAMEGRYIDTRRQDWLLALEVSAYSLVAVARRAEPLLRE
2yw9E           QDEELDALFAGVKEAFGGLDYLVHAIAFAPREAMEGRYIDTRRQDWLLALEVSAYSLVAVARRAEPLLRE
1lxcA           EDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNATREGFKIAHDISSYSFVAMAKACRSMLNP
2yw9D           QDEELDALFAGVKEAFGGLDYLVHAIAFAPREAMEGRYIDTRRQDWLLALEVSAYSLVAVARRAEPLLRE
1i30A           EDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNATREGFKIAHDISSYSFVAMAKACRSMLNP
2p91D           LDEDIKNLKKFLEENWGSLDIIVHSIAYAPKEEFKGGVIDTSREGFKIAMDISVYSLIALTRELLPLMEG
1dfiA           EDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNATREGFKIAHDISSYSFVAMAKACRSMLNP
2p91C           LDEDIKNLKKFLEENWGSLDIIVHSIAYAPKEEFKGGVIDTSREGFKIAMDISVYSLIALTRELLPLMEG
1lx6A           EDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNATREGFKIAHDISSYSFVAMAKACRSMLNP
1uluB           QDEELDALFAGVKEAFGGLDYLVHAIAFAPR-EAEGRYIDTRRQDWLLALEVSAYSLVAVARRAEPLLRE
2jjyA           SDQEIKDLFVELGKVWDGLDAIVHSIAFAPRDQLEGNFIDVTREGFSIAHDISAYSFAALAKEGRSMMNR
2jjyD           SDQEIKDLFVELGKVWDGLDAIVHSIAFAPRDQLEGNFIDVTREGFSIAHDISAYSFAALAKEGRSMMNR
2jjyB           SDQEIKDLFVELGKVWDGLDAIVHSIAFAPRDQLEGNFIDVTREGFSIAHDISAYSFAALAKEGRSMMNR
2jjyC           SDQEIKDLFVELGKVWDGLDAIVHSIAFAPRDQLEGNFIDVTREGFSIAHDISAYSFAALAKEGRSMMNR
1uluC           QDEELDALFAGVKEAFGGLDYLVHAIAFAPR-EAEGRYIDTRRQDWLLALEVSAYSLVAVARRAEPLLRE
1uluA           QDEELDALFAGVKEAFGGLDYLVHAIAFAPR-EAEGRYIDTRRQDWLLALEVSAYSLVAVARRAEPLLRE
1uluD           QDEELDALFAGVKEAFGGLDYLVHAIAFAPR-EAEGRYIDTRRQDWLLALEVSAYSLVAVARRAEPLLRE
2o2sB           DGYTIKEVAVKVKQDLGNIDILVHSLA--NGPEVTKPLLETSRKGYLAASSNSAYSFVSLLQHFGPIMNE
2o2sA           DGYTIKEVAVKVKQDLGNIDILVHSLA--NGPEVTKPLLETSRKGYLAASSNSAYSFVSLLQHFGPIMNE
1enoA           DVKTVQEAAECVRQDFGSIDILVHSLA--NGPEVSKPLLETSRKGYLXXXXXXXXXXXXXXXXXXPIMNP
1d7oA           DVKTVQEAAECVRQDFGSIDILVHSLA--NGPEVSKPLLETSRKGYLXXXXXXXXXXXXXXXXXXPIMNP
1cwuA           DVKTVQEAAECVRQDFGSIDILVHSLG--NGPEVSKPLLETSRKGYLXXXXXXXXXXXXXXXXXXPIMNP
2o50A           DGYTIKEVAVKVKQDLGNIDILVHSLA--NGPEVTKPLLETSRKGYLAASSNSAYSFVSLLQHFGPI-NE
2o50B           DGYTIKEVAVKVKQDLGNIDILVHSLA--NGPEVTKPLLETSRKGYLAASSNSAYSFVSLLQHFGPI-NE
3fnfB           NEEHLASLAGRVTEAIGKLDGVVHSIGFMPQTGMINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNP
2b35D           NEEHLASLAGRVTEAIGKLDGVVHSIGFMPQTGMINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNP
3fnfD           NEEHLASLAGRVTEAIGKLDGVVHSIGFMPQTGMINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNP
2b35C           NEEHLASLAGRVTEAIGKLDGVVHSIGFMPQTGMINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNP
3fnfC           NEEHLASLAGRVTEAIGKLDGVVHSIGFMPQTGMINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNP
3fneB           NEEHLASLAGRVTEAIGKLDGVVHSIGFMPQTGMINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNP
2nv6A           NEEHLASLAGRVTEAIGKLDGVVHAIGFMPQTGMINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNP
3fneC           NEEHLASLAGRVTEAIGKLDGVVHSIGFMPQTGMINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNP
2aqkA           NEEHLASLAGRVTEAIGKLDGVVHAIGFMPQTGMINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNP
2h7iA           NEEHLASLAGRVTEAIGKLDGVVHSIGFMPQTGMINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNP
1enyA           NEEHLASLAGRVTEAIGKLDGVVHSIGFMPQTGMINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNP
2op0B           ---TIEDVANLIHQKYGKINMLVHSLA--NAKEVQKDLLNTSRKGYLDALSKSSYSLISLCKYFVNIMKP
2oosA           ---TIEDVANLIHQKYGKINMLVHSLA--NAKEVQKDLLNTSRKGYLDALSKSSYSLISLCKYFVNIMKP
2aqiA           NEEHLASLAGRVTEAIGKLDGVVHSIGFMPQTGMINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNP
2aqhA           NEEHLASLAGRVTEAIGKLDGVVHSIGFMPQTGMINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNP
2aq8A           NEEHLASLAGRVTEAIGKLDGVVHSIGFMPQTGMINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNP
2b36B           NEEHLASLAGRVTEAIGKLDGVVHSIGFMPQTGMINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNP
1uh5A           ---TIEDVANLIHQKYGKINMLVHSLA--NAKEVQKDLLNTSRKGYLDALSKSSYSLISLCKYFVNIMKP
2oosB           ---TIEDVANLIHQKYGKINMLVHSLA--NAKEVQKDLLNTSRKGYLDALSKSSYSLISLCKYFVNIMKP
2ol4B           ---TIEDVANLIHQKYGKINMLVHSLA--NAKEVQKDLLNTSRKGYLDALSKSSYSLISLCKYFVNIMKP
3fneD           NEEHLASLAGRVTEAIGKLDGVVHSIGFMPQTGMINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNP
2b37B           NEEHLASLAGRVTEAIGKLDGVVHSIGFMPQTGMINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNP
2b35F           NEEHLASLAGRVTEAIGKLDGVVHSIGFMPQTGMINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNP
2b35B           NEEHLASLAGRVTEAIGKLDGVVHSIGFMPQTGMINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNP
2b35A           NEEHLASLAGRVTEAIGKLDGVVHSIGFMPQTGMINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNP
2b35E           NEEHLASLAGRVTEAIGKLDGVVHSIGFMPQTGMINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNP
1vrwA           ---TIEDVANLIHQKYGKINMLVHSLA--NAKEVQKDLLNTSRKGYLDALSKSSYSLISLCKYFVNIMKP
2o2yD           ---TIEDVANLIHQKYGKINMLVHSLA--NAKEVQKDLLNTSRKGYLDALSKSSYSLISLCKYFVNIMKP
2b37C           NEEHLASLAGRVTEAIGKLDGVVHSIGFMPQTGMINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNP
1zxlA           ---TIEDVANLIHQKYGKINMLVHSLA--NAKEVQKDLLNTSRKGYLDALSKSSYSLISLCKYFVNIMKP
1zsnA           ---TIEDVANLIHQKYGKINMLVHSLA--NAKEVQKDLLNTSRKGYLDALSKSSYSLISLCKYFVNIMKP
2o2yC           ---TIEDVANLIHQKYGKINMLVHSLA--NAKEVQKDLLNTSRKGYLDALSKSSYSLISLCKYFVNIMKP
2o2yA           ---TIEDVANLIHQKYGKINMLVHSLA--NAKEVQKDLLNTSRKGYLDALSKSSYSLISLCKYFVNIMKP
2ol4A           ---TIEDVANLIHQKYGKINMLVHSLA--NAKEVQKDLLNTSRKGYLDALSKSSYSLISLCKYFVNIMKP
2ntvA           NEEHLATLAERVTAEIGKLDGVVHSIGFMPQTGMTNQFFDAPYEDVSKGIHISTXXXXXXXXXXXXIMNS
1nhgA           ---TIEDVANLIHQKYGKINMLVHSLA--NAKEVQKDLLNTSRKGYLDALSKSSYSLISLCKYFVNIMKP
2ptgA           ISEVAEAVRADV----GQIDILVHSLA--NGPEVTKPLLQTSRKGXXXXXXXXXXXXXXXLQHFLPLMKE
1vl8B           NYXXXXXXXXXXXXXFGKLDTVVNAAGINRRHPAE----EFPLDEFRQVIEVNLFGTYYVCREAFSLLSD
1vl8A           NYXXXXXXXXXXXXXFGKLDTVVNAAGINRRHPAE----EFPLDEFRQVIEVNLFGTYYVCREAFSLLSD
1fmcA           SEQELSALADFAISKLGKVDILVNNAGGGGP-----KPFDMPMADFRRAYELNVFSFFHLSQLVAPEMNG
1ahhA           SEQELSALADFAISKLGKVDILVNNAGGGGP-----KPFDMPMADFRRAYELNVFSFFHLSQLVAPEMNG
2nm0A           DTEQVEQAYKEIEETHGPVEVLI-ANAGVTKDQL------MSEEDFTSVVETNLTGTFRVVKRANRAMAK
3gafF           DEQHREAVIKAALDQFGKITVLVNNAGGGGP-----KPFDMPMSDFEWAFKLNLFSLFRLSQLAAPHMQK
3gafH           DEQHREAVIKAALDQFGKITVLVNNAGGGGP-----KPFDMPMSDFEWAFKLNLFSLFRLSQLAAPHMQK
3gafA           DEQHREAVIKAALDQFGKITVLVNNAGGGGP-----KPFDMPMSDFEWAFKLNLFSLFRLSQLAAPHMQK
3gafE           DEQHREAVIKAALDQFGKITVLVNNAGGGGP-----KPFDMPMSDFEWAFKLNLFSLFRLSQLAAPHMQK
1i01E           DPASIESVLEKIRAEFGEVDILVNNAGIT-RDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAM-MKKR
3gafG           DEQHREAVIKAALDQFGKITVLVNNAGGGGP-----KPFDMPMSDFEWAFKLNLFSLFRLSQLAAPHMQK
3gafD           DEQHREAVIKAALDQFGKITVLVNNAGGGGP-----KPFDMPMSDFEWAFKLNLFSLFRLSQLAAPHMQK
3gafC           DEQHREAVIKAALDQFGKITVLVNNAGGGGP-----KPFDMPMSDFEWAFKLNLFSLFRLSQLAAPHMQK
3gafB           DEQHREAVIKAALDQFGKITVLVNNAGGGGP-----KPFDMPMSDFEWAFKLNLFSLFRLSQLAAPHMQK
1q7bA           DPASIESVLEKIRAEFGEVDILVNNAGIT-RDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRH
3cxrA           DEDGIQAMVAQIESEVGIIDILVNNAGIIRRVPM----IEMTAAQFRQVIDIDLNAPFIVSKAVIPIKKG
1q7cA           DPASIESVLEKIRAEFGEVDILVNNAGIT-RDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAM-MKKR
1q7bB           DPASIESVLEKIRAEFGEVDILVNNAGIT-RDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRH
1hdcA           IEEDWQRVVAYAREEFGSVDGLVNNAGIS-----TGMFLETSVERFRKVVEINLTGVFIGMKTVIPAMKD
1i01B           DPASIESVLEKIRAEFGEVDILVNNAGIT-RDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRH
1i01G           DPASIESVLEKIRAEFGEVDILVN-----NADNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAM-MKKR
1i01D           DPASIESVLEKIRAEFGEVDILVN------NDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAM-MKKR
3cxtA           DEDGIQAMVAQIESEVGIIDILVNNAGIIRRVPM----IEMTAAQFRQVIDIDLNAPFIVSKAVIPIKKG
3i3oF           DEQHCKDIVQETVRQLGSLNILVNNVA-QQYPQQGLEYI--TAEQLEKTFRINIFSYFHVTKAALSHLKQ
3i3oE           DEQHCKDIVQETVRQLGSLNILVNNVA-QQYPQQGLEYI--TAEQLEKTFRINIFSYFHVTKAALSHLKQ
3i3oC           DEQHCKDIVQETVRQLGSLNILVNNVA-QQYPQQGLEYI--TAEQLEKTFRINIFSYFHVTKAALSHLKQ
3i3oB           DEQHCKDIVQETVRQLGSLNILVNNVA-QQYPQQGLEYI--TAEQLEKTFRINIFSYFHVTKAALSHLKQ
3i3oA           DEQHCKDIVQETVRQLGSLNILVNNVA-QQYPQQGLEYI--TAEQLEKTFRINIFSYFHVTKAALSHLKQ
1cydA           DWDATEKALGGI----GPVDLLVNNAALV----IMQPFLEVTKEAFDRSFSVNLRSVFQVSQMARDMINR
1uzlA           DSDAVDRAFTAVEEHQGPVEVLVSNAGLS---------ADMTEEKFEKVINANLTGAFRVAQRASRSMNK
1i01H           DPASIESVLEKIRAEFGEVDILVN-----NADNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAM-MKKR
1i01F           DPASIESVLEKIRAEFGEVDILVN-----NAGNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAM-MKKR
1zemA           SEEAVIGTVDSVVRDFGKIDFLFNNAGYQGA---FAPVQDYPSDDFARVLTINVTGAFHVLKAVQMITQN
3ctmE           DPKSVEETISQQEKDFGTIDFVANAVTWTD-----------NYDSWNKIISVGVYYCSHXXXXXXXXXXX
3i3oH           DEQHCKDIVQETVRQLGSLNILVNNVA-QQYPQQGLEYI--TAEQLEKTFRINIFSYFHVTKAALSHLKQ
1xkqB           TEDGQDQIINSTLKQFGKIDVLVNNAGAAIPDAFGTTGTDQGIDIYHKTLKLNLQAVIEMTKKVKPVASK
1xkqA           TEDGQDQIINSTLKQFGKIDVLVNNAGAAIPDAFGTTGTDQGIDIYHKTLKLNLQAVIEMTKKVKPVASK
1i01A           DPASIESVLEKIRAEFGEVDILVN------NANLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAM-MKKR
1ulsB           DPASVERGFAEALAHLGRLDGVVH-------------YAGITRDNFHLVLRVNLTGSFLVAKAASEAREK
1ulsA           DPASVERGFAEALAHLGRLDGVVH-------------YAGITRDNFHLVLRVNLTGSFLVAKAASEAREK
3ctmG           DPKSVEETISQQEKDFGTIDFVANAGVTWTVD---------NYDSWNKIISVGVYYCSHXXXXXXXXXXX
3ctmC           DPKSVEETISQQEKDFGTIDFVANA----------GVTWVDNYDSWNKIISVGVYYCSHXXXXXXXXXXX
1uzlB           DSDAVDRAFTAVEEHQGPVEVLVSNAGLSADAFL----MRMTEEKFEKVINANLTGAFRVAQRASRSMNK
1pr9A           DWEATERALGSV----GPVDXXXXXXXXXXXQP----FLEVTKEAFDRSFEVNVIQVSQIVARGLIARGV
1i01C           NVTSIESVLEKIRAEFGEVDILVN------NDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAM-MKKR
2p68A           SEESINKAFEEIYNLVDGIDILVNNAGITDKLFLRMSLLDWEKVNLTGTFLVTQNSLRKMIKQRWGRIVN
3ctmA           DPKSVEETISQQEKDFGTIDFVANAGVTWTQEIDVDNY-----DSWNKIISVGVYYCSHXXXXXXXXXXX
1ulsC           DPASVERGFAEALAHLGRLDGVVH-------------YAGITRDNFHLVLRVNLTGSFLVAKAASEAREK
1g0nB           VVEDIVRMFEEAVKIFGKLDIVCSVVSF-------GHVKDVTPEEFDRVFTINTRGQFFVAREAYKHLEI
1w6uA           DPDMVQNTVSELIKVAGHPNIVINNAAISPTERLSPNAWKTITDI---VLNGTAFVTLEIGKQLIKAQKG
2p68B           SEESINKAFEEIYNLVDGIDILVNNAGITDKLFLRMSLLDWEKVNLTGTFLVTQNSLRKMIKQRWGRIVN
3i3oG           DEQHCKDIVQETVRQLGSLNILVNNVA-QQYPQQGLEYI--TAEQLEKTFRINIFSYFHVTKAALSHLKQ
3ftpA           DATAVDALVESTLKEFGALNVLVNNAGIT-QDQLAMRMKDDEWDAVIDTNLKAVFRLSRAVLR--PMMKA
2a4kA           ---------------------------------------------WEKVLRVNLTGSFLVARKAGEVLEE
1uznA           DSDAVDRAFTAVEEHQGPVEVLVSNAGLSADAFL----MRMTEEKFEKVINANLTGAFRVAQRASRSMNK
3d3wA           DWEATERALGSV----GPVDXXXXXXXXXXXQP----FLEVTKEAFDRSFEVNVIQVSQIVARGLIARGV
1ybvA           VVEDIVRMFEEAVKIFGKLDIVCSVVSF-------GHVKDVTPEEFDRVFTINTRGQFFVAREAYKHLEI
1w6uD           DPDMVQNTVSELIKVAGHPNIVINNAAISPTERLSPNAWKTITDI---VLNGTAFVTLEIGKQLIKAQKG
3ijrH           DEQHCKDIVQETVRQLGSLNILVNNVA-QQYPQQGLEYI--TAEQLEKTFRINIFSYFHVTKAALSHLKQ
3ijrF           DEQHCKDIVQETVRQLGSLNILVNNVA-QQYPQQGLEYI--TAEQLEKTFRINIFSYFHVTKAALSHLKQ
3ijrE           DEQHCKDIVQETVRQLGSLNILVNNVA-QQYPQQGLEYI--TAEQLEKTFRINIFSYFHVTKAALSHLKQ
3ijrB           DEQHCKDIVQETVRQLGSLNILVNNVA-QQYPQQGLEYI--TAEQLEKTFRINIFSYFHVTKAALSHLKQ
3ijrA           DEQHCKDIVQETVRQLGSLNILVNNVA-QQYPQQGLEYI--TAEQLEKTFRINIFSYFHVTKAALSHLKQ
1g0oC           VVEDIVRMFEEAVKIFGKLDIVCSVVSF-------GHVKDVTPEEFDRVFTINTRGQFFVAREAYKHLEI
1g0oA           VVEDIVRMFEEAVKIFGKLDIVCSVVSF-------GHVKDVTPEEFDRVFTINTRGQFFVAREAYKHLEI
1dohB           VVEDIVRMFEEAVKIFGKLDIVCSVVSF-------GHVKDVTPEEFDRVFTINTRGQFFVAREAYKHLEI
1dohA           VVEDIVRMFEEAVKIFGKLDIVCSVVSF-------GHVKDVTPEEFDRVFTINTRGQFFVAREAYKHLEI
1yxmC           NEEEVNNLVKSTLDTFGKINFLVHAVL---ETNLTGTFY----------MCKAVYS--------SWMKEH
1k2wA           DQASIDRCVAELLDRWGSIDILVNNAALFDLAPI----VEITRESYDRLFAINVFMMQAVA-RAMIAGGR
1uznB           DSDAVDRAFTAVEEHQGPVEVLVSNAGLSADAFL----MRMTEEKFEKVINANLTGAFRVAQRASRSMNK
1uzmA           DSDAVDRAFTAVEEHQGPVEVLVSNAGLSAR---------MTEEKFEKVINANLTGAFRVAQRASRSMNK
3ctmH           DPKSVEETISQQEKDFGTIDFVANAVTWTQGPEIKIISVDLN----------GVYYCSHXXXXXXXXXXX
2bgkA           KDEDVRNLVDTTIAKHGKLDIMFGNVGVLSTTPYS--ILEAGNEDFKRVMDINVYGAFLVAKHAARVMKK
1w6uC           DPDMVQNTVSELIKVAGHPNIVINNAAISPTERLSPNAWKTITDI---VLNGTAFVTLEIGKQLIKAQKG
2ntnA           DSDAVDRAFTAVEEHQGPVEVLVSNAGL------------MTEEKFEKVINANLTGAFRVAQRASRSMNK
2hq1A           NPEDVENMVKTAMDAFGRIDILVN---------------NAWDDVLNTNLKSAYLCTKAVSKIM--LKQK
3ctmF           DPKSVEETISQQEKDFGTIDFVANA----------GVTWTQGPENKIISVDLNVYYCSHXXXXXXXXXXX
2ntnB           DSDAVDRAFTAVEEHQGPVEVLVSNAGL------------MTEEKFEKVINANLTGAFRVAQRASRSMNK
3ftpD           DATAVDALVESTLKEFGALNVLVNNAGIT-QDQLAMRMKDDEWDAVIDTNLKAVFRLSRAVLR--PMMKA
3ftpC           DATAVDALVESTLKEFGALNVLVNNAGIT-QDQLAMRMKDDEWDAVIDTNLKAVFRLSRAVLR--PMMKA
3ctmD           DPKSVEETISQQEKDFGTIDFVANAVTWTQGPEI---------DKIISVDLNGVYYCSHXXXXXXXXXXX
3ctmB           DPKSVEETISQQEKDFGTIDFVANAVTWTQGPEI---------DKIISVDLNGVYYCSHXXXXXXXXXXX
1xhlA           EASGQDDIINTTLAKFGKIDILVNADGTANTDQPVELYQKTFKLNFQAVIEMT-------QKTKEHLIKT
1uzmB           DSDAVDRAFTAVEEHQGPVEVLVSNAGLSAMTE----------EKFEKVINANLTGAFRVAQRASRSMNK
3iccA           SLHGVEALYSSLDNELQKFDILINNAGIGP-----GAFIEETTEQFFDRVSVNAKAPFFIIQQALSRLRD
1yxmD           NEEEVNNLVKSTLDTFGKINFLVN----NGGGQFLSPAEHISSKGWHAVLETNLTGTFYMCKAVYSMKEH
1w6uB           DPDMVQNTVSELIKVAGHPNIVINNAAISPTERLSPNAWKTITDI---VLNGTAFVTLEIGKQLIKAQKG
2d1yB           ----------------GRVDVLVNNAAIA----APGSALTVRLPEWRRVLEVNLTALSALAAREMRKVGG
1spxA           --QNVNSVVADVTTDAGQDEILSTTLGKFGKLDILVNNAGQSIESYDATLNLNLRSVIALTKKAVPLSST
1ja9A           KPSEVVALFDKAVSHFGGLDFVMSNSGM----EVWCDELEVTQELFDKVFNLNTRGQFFVAQQGLKHCRR
2cfcA           DEGDVNAAIAATMEQFGAIDVLVNNAGITGNSE-AGVLHTTPVEQFDKVMAVNVRGIFLGCRAVLPLLQG
1x7gB           SVPEIEALVAAVVERYGPVDVLVNGATAELADEL---WLDVVETNLT-----GVFRVTKQVLKAGGMLER
2d1yD           ----------------GRVDVLVNNAAIA----APGSALTVRLPEWRRVLEVNLTALSALAAREMRKVGG
1yxmB           NEEEVNNLVKSTLDTFGKINFLVN----NGGGQFLSPAEHISSKGWHAVLETNLTGTFYMCKAVYSMKEH
1o5iA           --KDLDLLFEKVKE--------VDILVLNAGGPKAGFFDELTNEDFKEAIDSLFLNMIKIVRNYLPAMKE
1h5qA           NTDIVTKTIQQIDADLGPISGLIANAGVSVVKPAT----ELTHEDFAFVYDVNVFGVRAVAKLWLQKQQK
2d1yA           ----------------GRVDVLVNNAAIA----APGSALTVRLPEWRRVLEVNLTALSALAAREMRKVGG
2d1yC           ----------------GRVDVLVNNAAIA----APGSALTVRLPEWRRVLEVNLTALSALAAREMRKVGG
3emkB           DREAVKALGQKAEEEMGGVDILVNNAGIT-RDGLFVRMSDEDWDAVLTVNLTSVFNLTR--ELTHPMMXX
3ezlA           DWDSTKQAFDKVKAEVGEIDVLVNNAGIT-RDVV---FRKMTREDWQAVIDTNLTSLFNVTKQVDGMVER
1xr3B           SVPEIEALVAAVVERYGPVDVLVNGATAELADEL---WLDVVETNLT-----GVFRVTKQVLKAGGMLER
1nffA           QPAQWKAAVDTAVTAFGGLHVLVNNAGILN----IGTIEDYALTEWQRILDVNLTGVLGIRAVVKPMKEA
1w4zB           SVPEIEALVAAVVERYGPVDVLVNGATAELADEL---WLDVVETNLT-----GVFRVTKQVLKAGGMLER
3i4fD           KKEDLHKIVEEAMSHFGKIDFLINPYVFERK-----KLVDYEEDEWNEMIQGNLTAVFHLLKLVVPVMQN
1yxmA           NEEEVNNLVKSTLDTFGKINFLVN----NGGGQFLSPAEHISSKGWHAVLETNLTGTFYMCKAVYSMKEH
1w0cH           ---------AACYTHWGRCDVLVNASSFYPTPLLRREAMETATDLFGSNAIAPYFLIKAFAHRVAPAKHR
2uvdA           NAEDVTNMVKQTVDVFGQVDILVNNAGVT-KDNLLMRMKEEEWDTVINTNLKGVFLCTKAVSRFMMRQRH
2q2qE           DVAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLE-SWDKIIALNLSAVFHGTRLALPGMRARNW
3gvcA           DEQQIIAMVDACVAAFGGVDKLVANAGVVHLASL----IDTTVEDFDRVIAINLRGAWLCTKHAAPRMIE
2q2vD           DVAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLE-SWDKIIALNLSAVFHGTRLALPGMRARNW
2p8kB           LFTRCAELVAACYTHWGRCDVLVNASSFYPTPLLRGEAMETATDLFGSNAIAPYFLIKAFAHRVAPAKHR
3i4fC           KKEDLHKIVEEAMSHFGKIDFLINPYVFERK-----KLVDYEEDEWNEMIQGNLTAVFHLLKLVVPVMQN
2bfpD           LFTRCAELVAACYTHWGRCDVLVNASSFYPTPLLRREAMETATDLFGSNAIAPYFLIKAFAHRVAPAKHR
1e92D           ---------AACYTHWGRCDVLVNASSFYPTPLLRREAMETATDLFGSNAIAPYFLIKAFAHRVAPAKHR
3bmoA           --EIINSCFRA----FGRCDVLVNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTSFAQRQKGTTSS
2bfmC           ---------AACYTHWGRCDVLVNASSFYPTPLLRREAMETATDLFGSNAIAPYFLIKAFAHRVAPAKHR
1w73A           DPDVQNTV-SELIKVAGHPNIVINNAAISPTERLSPNAWKTITDI---VLNGTAFVTLEIGKQLIKAQKG
1w0cC           LFTRCAELVAACYTHWGRCDVLVNASSFYPTPLLRNEAMETATDLFGSNAIAPYFLIKAFAHRVAPAKHR
1w0cB           LFTRCAELVAACYTHWGRCDVLVNASSFYPTPLLRGEAMETATDLFGSNAIAPYFLIKAFAHRVAPAKHR
2q2qA           DVAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLE-SWDKIIALNLSAVFHGTRLALPGMRARNW
3i4fA           KKEDLHKIVEEAMSHFGKIDFLINPYVFERK-----KLVDYEEDEWNEMIQGNLTAVFHLLKLVVPVMQN
2ag5C           KKKQIDQFANEVE----RLDVLFNVAGFVHH----GTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMQK
2ag5B           KKKQIDQFANEVE----RLDVLFNVAGFVHH----GTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMQK
2ag5A           KKKQIDQFANEVE----RLDVLFNVAGFVHH----GTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMQK
2qhxC           ---------AACYTHWGRCDVLVNNASSFYPTPLLRAMETATADLFGSNAIAPYFLIKAFAHRVAPAKHR
2q2qC           DVAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLE-SWDKIIALNLSAVFHGTRLALPGMRARNW
2p8kD           LFTRCAELVAACYTHWGRCDVLVNASSFYPTPLLRREAMETATDLFGSNAIAPYFLIKAFAHRVAPAKHR
1e92B           ---------AACYTHWGRCDVLVNASSFYPTPLLRREAMETATDLFGSNAIAPYFLIKAFAHRVAPAKHR
2bf7C           ---------AACYTHWGRCDVLVNNASSFYPTPLLEAMETATADLFGSNAIAPYFLIKAFAHRVAPAKHR
2ae2A           SRSERQELMNTVANHFGKLNILVNNAGIVIYKEAK----DYTVEDYSLIMSINFEAAYHLSVLAHPFLSE
2rhrB           SVPEIEALVAAVVERYGPVDVLVNGATAELADEL---WLDVVETNLT-----GVFRVTKQVLKAGGMLER
2qhxA           ---------AACYTHWGRCDVLVNNASSFYPTPLLREAMETATDLFGSNAIAPYFLIKAFAHRVAPAKHR
1p33D           LFSRCSALVDACYMHWGRCDVLVNASSFKDKESLEV----AAADLFGSNAIAPYFLIKAFAQRADTRAEQ
1p33A           LFSRCSALVDACYMHWGRCDVLVNNASLRDKESLEV----AAADLFGSNAIAPYFLIKAFAQRADTRAEQ
1e7wA           ---------AACYTHWGRCDVLVNNASSFYPTPLLREAMETATDLFGSNAIAPYFLIKAFAHRVAPAKHR
3csdB           SVPEIEALVAAVVERYGPVDVLVNGATAELADEL---WLDVVETNLT-----GVFRVTKQVLKAGGMLER
2bfaC           ---------AACYTHWGRCDVLVNASSFYPTPLLRREAMETATDLFGSNAIAPYFLIKAFAHRVAPAKHR
2bf7D           ---------AACYTHWGRCDVLVNASSFYPTPLLRREAMETATDLFGSNAIAPYFLIKAFAHRVAPAKHR
2bf7B           ---------AACYTHWGRCDVLVNNASSFYPTPLLREAMETATDLFGSNAIAPYFLIKAFAHRVAPAKHR
2ae1A           SRSERQELMNTVANHFGKLNILVNNAGIVIYKEAK----DYTVEDYSLIMSINFEAAYHLSVLAHPFLSE
2zatA           KAEDRERLVAMAVNLHGGVDILVSNAAVNP---FFGNIIDATEEVWDKILHVNVKATVLMTKAVVPEMEK
1x7hB           SVPEIEALVAAVVERYGPVDVLVNGATAELADEL---WLDVVETNLT-----GVFRVTKQVLKAGGMLER
1x7gA           SVPEIEALVAAVVERYGPVDVLVNGATAELADEL---WLDVVETNLT-----GVFRVTKQVLKAGGMLER
1w4zA           SVPEIEALVAAVVERYGPVDVLVNGATAELADEL---WLDVVETNLT-----GVFRVTKQVLKAGGMLER
2rhrA           SVPEIEALVAAVVERYGPVDVLVNGATAELADEL---WLDVVETNLT-----GVFRVTKQVLKAGGMLER
2rh4B           SVPEIEALVAAVVERYGPVDVLVNGATAELADEL---WLDVVETNLT-----GVFRVTKQVLKAGGMLER
2rh4A           SVPEIEALVAAVVERYGPVDVLVNGATAELADEL---WLDVVETNLT-----GVFRVTKQVLKAGGMLER
2q2vC           DVAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLE-SWDKIIALNLSAVFHGTRLALPGMRARNW
2q2qH           DVAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLE-SWDKIIALNLSAVFHGTRLALPGMRARNW
2q2qG           DVAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLE-SWDKIIALNLSAVFHGTRLALPGMRARNW
2p8kA           LFTRCAELVAACYTHWGRCDVLVNASSFYPTPLLRNEAMETATDLFGSNAIAPYFLIKAFAHRVAPAKHR
1iy8A           DEAQVEAYVTATTERFGRIDGFFNNAGIEGKQNPTESF---TAAEFDKVVSINLRGVFLGLEKVLKIMRE
3gvcD           DEQQIIAMVDACVAAFGGVDKLVANAGVVHLASL----IDTTVEDFDRVIAINLRGAWLCTKHAAPRMIE
1ae1A           SRTERDKLMQTVAHVFGKLNILVNNAGVVIHKEAK----DFTEKDYNIIMGTNFEAAYHLSQIAYPLLSQ
1ydeP           QEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQ---RPEETSAQGFRQXXXXXXXXXXXXXKLALPYLRK
1ydeM           QEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQ---RPEETSAQGFRQXXXXXXXXXXXXXKLALPYLRK
1ydeI           QEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQ---RPEETSAQGFRQXXXXXXXXXXXXXKLALPYLRK
1ydeH           QEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQ---RPEETSAQGFRQXXXXXXXXXXXXXKLALPYLRK
1ydeG           QEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQ---RPEETSAQGFRQXXXXXXXXXXXXXKLALPYLRK
1ydeF           QEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQ---RPEETSAQGFRQXXXXXXXXXXXXXKLALPYLRK
1ydeD           QEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQ---RPEETSAQGFRQXXXXXXXXXXXXXKLALPYLRK
1ydeA           QEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQ---RPEETSAQGFRQXXXXXXXXXXXXXKLALPYLRK
3edmD           NXXXXXXXXXXXXDKFGEIHGLVHVAG-----GLIARKTIAEMDEWHQVLDVNLTSLFLTAKTALPKMAK
3edmA           NXXXXXXXXXXXXDKFGEIHGLVHVAG-----GLIARKTIAEMDEWHQVLDVNLTSLFLTAKTALPKMAK
1e7wB           ---------AACYTHWGRCDVLVNASSFYPTPLLRGEAMETATDLFGSNAIAPYFLIKAFAHRVAPAKHR
2zk7B           NPDQVKASIDHIFKEYGSISVLVNNAGI----ESYGKIESMSMGEWRRIIDVNLFGYYYASKFAIPYMSR
2qhxD           ---------AACYTHWGRCDVLVNASSFYPTPLLRDREATATADLFGSNAIAPYFLIKAFAHRVAPAKHR
2q2wC           DVAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLE-SWDKIIALNLSAVFHGTRLALPGMRARNW
2q2qF           DVAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLE-SWDKIIALNLSAVFHGTRLALPGMRARNW
3grpA           DRKSIKQLAEVAEREMEGIDILVNNAG------ITVRMQDQDWD------DVLAVNLTAASTLTRELIHS
3edmB           NXXXXXXXXXXXXDKFGEIHGLVHVAG-----GLIARKTIAEMDEWHQVLDVNLTSLFLTAKTALPKMAK
2dteA           NPDQVKASIDHIFKEYGSISVLVNNAGI----ESYGKIESMSMGEWRRIIDVNLFGYYYASKFAIPYMSR
2bfoA           LFTRCAELVAACYTHWGRCDVLVNASSFYPTPLLRGEAMETATDLFGSNAIAPYFLIKAFAHRVAPAKHR
2bfmB           LFTRCAELVAACYTHWGRCDVLVNASSFYPTPLLRNREATATADLFGSNAIAPYFLIKAFAHRVAPAKHR
1w0cA           LFTRCAELVAACYTHWGRCDVLVNASSFYPTPLLRNDVGDATADLFGSNAIAPYFLIKAFAHRVAPAKHR
2q2vA           DVAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLE-SWDKIIALNLSAVFHGTRLALPGMRARNW
3gvcC           DEQQIIAMVDACVAAFGGVDKLVANAGVVHLASL----IDTTVEDFDRVIAINLRGAWLCTKHAAPRMIE
3gvcB           DEQQIIAMVDACVAAFGGVDKLVANAGVVHLASL----IDTTVEDFDRVIAINLRGAWLCTKHAAPRMIE
3ennD           DREAVKALGQKAEEEMGGVDILVNNAGIT-RDGLFVRMSDEDWDAVLTVNLTSVFNLTR--ELTHPMMXX
3ennC           DREAVKALGQKAEEEMGGVDILVNNAGIT-RDGLFVRMSDEDWDAVLTVNLTSVFNLTR--ELTHPMMXX
2c07A           KKEEISEVINKILTEHKNVDILVNNAGIT-RDNLFLRMKNDEWEDVLRTNLNSLFYITQISKRM--INNR
3bmfA           --EIINSCFRA----FGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTSFAQRQSNL---
2bfaB           ---------AACYTHWGRCDVLVNASSFYPTPLLRGEAMETATDLFGSNAIAPYFLIKAFAHRVAPAKHR
1ydeN           QEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQ---RPEETSAQGFRQXXXXXXXXXXXXXKLALPYLRK
1ydeB           QEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQ---RPEETSAQGFRQXXXXXXXXXXXXXKLALPYLRK
1xg5A           NEEDILSMFSAIRSQHSGVDICINNAGLARPDTLLSGSTSGWKDMFN----VNVLALSICTREAYQSMKD
2q2wD           DVAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLE-SWDKIIALNLSAVFHGTRLALPGMRARNW
1p33C           LFSRCSALVDACYMHWGRCDVLVNNASSFYPTPLLRKKESAAADLFGSNAIAPYFLIKAFAQRADTRAEQ
1p33B           LFSRCSALVDACYMHWGRCDVLVNNASSFYPTPLLRKKESAAADLFGSNAIAPYFLIKAFAQRADTRAEQ
3bmdB           --EIINSCFRA----FGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQNL---
2bfpB           ---------AACYTHWGRCDVLVNNASSFYPTPLLGEAMETATDLFGSNAIAPYFLIKAFAHRVAPAKHR
2bfoC           ---------AACYTHWGRCDVLVNASSFYPTPLLRDREATATADLFGSNAIAPYFLIKAFAHRVAPAKHR
2bfaA           ---------AACYTHWGRCDVLVNASSFYPTPLLRDREATATADLFGSNAIAPYFLIKAFAHRVAPAKHR
2bf7A           ---------AACYTHWGRCDVLVNNASSFYPTPLLGEAMETATDLFGSNAIAPYFLIKAFAHRVAPAKHR
1w73D           DPDVQNTV-SELIKVAGHPNIVINNAAISPTERLSPNAWKTITDI---VLNGTAFVTLEIGKQLIKAQKG
1w73C           DPDVQNTV-SELIKVAGHPNIVINNAAISPTERLSPNAWKTITDI---VLNGTAFVTLEIGKQLIKAQKG
3grpB           DRKSIKQLAEVAEREMEGIDILVNGVRMQDQD-----WDDVLAVNLTAASTLTRELIHSMMRRRY-----
3bmnD           --EIINSCFRA----FGRCDVLVNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTSFAQRQKGSSNL
3bmkC           --EIINSCFRA----FGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTSFAQRQKNL---
2wd7C           --EIINSCFRA----FGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTSFAQRQSNL---
2vz0A           --EIINSCFRA----FGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTSFAQRQSNL---
2q2qB           DVAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLE-SWDKIIALNLSAVFHGTRLALPGMRARNW
3imfB           DVRNTDDIIEQIDEKFGRIDILINNAA--------GNFIDLSVNGWNSVINITFYCSQAIGKYWIEKGIK
2ewmB           QPGDVEAFGKQVISTFGRCDILVNNAGIYPLDELTF-------EQWKKTFEINVDSGFLMAKAFVPGMNG
2ewmA           QPGDVEAFGKQVISTFGRCDILVNNAGIYPLDELTF-------EQWKKTFEINVDSGFLMAKAFVPGMNG
3ennA           DREAVKALGQKAEEEMGGVDILVNNAGIT-RDGLFVRMSDEDWDAVLTVNLTSVFNLTR--ELTHPMMXX
2dknA           ----------------------------------------------------------------------
3bmoC           --EIINSCFRA----FGRCDVLVNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQKSSNL
3bmnC           --EIINSCFRA----FGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQKSSNL
2wd7B           --EIINSCFRA----FGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQNL---
2vz0B           --EIINSCFRA----FGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQNL---
2p8kC           ---------AACYTHWGRCDVLVNASSFYPTPLLRNEAMETATDLFGSNAIAPYFLIKAFAHRVAPAKHR
2ew8A           QPGDVEAFGKQVISTFGRCDILVNNAGIYPLDELTF-------EQWKKTFEINVDSGFLMAKAFVPGMNG
1e92C           ---------AACYTHWGRCDVLVNASSFYPTPLLRNEAMETATDLFGSNAIAPYFLIKAFAHRVAPAKHR
3bmoD           --EIINSCFRA----FGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTSFAQRQK---GS
3bmiB           --EIINSCFRA----FGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTSFAQRQSSNL--
1ae1B           SRTERDKLMQTVAHVFGKLNILVNNAGVVIHKEAK----DFTEKDYNIIMGTNFEAAYHLSQIAYPLLSQ
2a4kB           ----------------------------------------------------------------------
3imfA           DVRNTDDIIEQIDEKFGRIDILINNAA--------GNFIDLSVNGWNSVINITFYCSQAIGKYWIEKGIK
3emkD           DREAVKALGQKAEEEMGGVDILVNNAGIT-RDGLFVRMSDEDWDAVLTVNLTSVFNLTR--ELTHPMMXX
2c7vA           --EIINSCFRA----FGRCDVLVNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTSFAQRQKGSSNL
3bmqA           --EIINSCFRA----FGRCDVLVNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTSFAQRQKGSSNL
2bfaD           ---------AACYTHWGRCDVLVNASSFYPTPLLRDREATATADLFGSNAIAPYFLIKAFAHRVAPAKHR
2q2wA           DVAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLE-SWDKIIALNLSAVFHGTRLALPGMRARNW
2q2vB           DVAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLE-SWDKIIALNLSAVFHGTRLALPGMRARNW
2gdzA           DQQQLRDTFRKVVDHFGRLDILVNNAGVNNE------------KNWEKTLQINLVSVISGTYLGLDYMSE
3bmfD           --EIINSCFRA----FGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTSFAQRQSNL---
3bmeA           --EIINSCFRA----FGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTSFAQRQSNL---
2ztuD           KGEAVRGLVDNAVRQMGRIDILVNNAGIQH----TALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKK
1x1tA           KGEAVRGLVDNAVRQMGRIDILVNNAGIQH----TALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKK
1x1eA           DLEKDDP--KGLVKRALEXXXXXXXXXXXXXXNVRKPALELSYEEWRRVLYLHLDVAFLLAQAAAPHMAE
1w0cE           ---------AACYTHWGRCDVLVNASSFYPTPLLRNEAMETATDLFGSNAIAPYFLIKAFAHRVAPAKHR
2p8kG           ---------AACYTHWGRCDVLVNASSFYPTPLLRNEAMETATDLFGSNAIAPYFLIKAFAHRVAPAKHR
2ekpA           DLEKDDP--KGLVKRALEXXXXXXXXXXXXXXNVRKPALELSYEEWRRVLYLHLDVAFLLAQAAAPHMAE
3bmoB           --EIINSCFRA----FGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQNL---
3bmnA           --EIINSCFRA----FGRCDVLVNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTSFAQRQSSNL--
3bmfB           --EIINSCFRA----FGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQNL---
2b4qB           PADLSSEAGARLAQALGELS--------ARLDILVNNAGTSPVSGWEKVMQLNVTSVFSCIQQLLPLLRR
2b4qA           SEAGARRLAQALGELSARLDILVNNAGTS-----WGAALESYPSGWEKVMQLNVTSVFSCIQQLLPLLRR
1w73B           DPDVQNTV-SELIKVAGHPNIVINNAAISPTERLSPNAWKTITDI---VLNGTAFVTLEIGKQLIKAQKG
1w0cF           ---------AACYTHWGRCDVLVNASSFYPTPLLRNEAMETATDLFGSNAIAPYFLIKAFAHRVAPAKHR
3imfC           DVRNTDDIIEQIDEKFGRIDILINNAA--------GNFIDLSVNGWNSVINITFYCSQAIGKYWIEKGIK
3grpC           ----------------------------------------------------------------------
1e92A           ---------AACYTHWGRCDVLVNASSFYPTPLLRNEAMETATDLFGSNAIAPYFLIKAFAHRVAPAKHR
2z1nB           EPGDIDRLFEKARDLGG-----ADILVYSTGGPRPGRFMELGVEDWDESYRLLARSAVWVGRRAAEQMVE
2p8kH           ---------AACYTHWGRCDVLVNASSFYPTPLLRNEAMETATDLFGSNAIAPYFLIKAFAHRVAPAKHR
2ew8B           QPGDVEAFGKQVISTFGRCDILVNNAGIYPLDELTF-------EQWKKTFEINVDSGFLMAKAFVPGMNG
2ztvC           KGEAVRGLVDNAVRQMGRIDILVNNAGIQH----TALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKK
2ztmD           KGEAVRGLVDNAVRQMGRIDILVNNAGIQH----TALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKK
2ztuC           KGEAVRGLVDNAVRQMGRIDILVNNAGIQH----TALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKK
2ztuB           KGEAVRGLVDNAVRQMGRIDILVNNAGIQH----TALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKK
2z1nA           EPGDIDRLFEKARDLGG-----ADILVYSTGGPRPGRFMELGVEDWDESYRLLARSAVWVGRRAAEQMVE
1xg5C           NEEDILSMFSAIRSQHSGVDICINNAGLARPDTLLSGSTSGWKDMFN----VNVLALSICTREAYQSMKD
1w0cG           ---------AACYTHWGRCDVLVNASSFYPTPLLRNEAMETATDLFGSNAIAPYFLIKAFAHRVAPAKHR
3grpD           ----------------------------------------------------------------------
3gk3C           DFESCERCAEKVLADFGKVDVLINNAGITRD----ATFMKMTKGDWDAVMRTDLDAMFNVTKQAGMVERR
3gk3A           DFESCERCAEKVLADFGKVDVLINNAGITRD----ATFMKMTKGDWDAVMRTDLDAMFNVTKQAGMVERR
3emkA           DREAVKALGQKAEEEMGGVDILVNNAGIT-RDGLFVRMSDEDWDAVLTVNLTSVFNLTR--ELTHPMMXX
2ekqD           DLEKDDP--KGLVKRALEXXXXXXXXXXXXXXNVRKPALELSYEEWRRVLYLHLDVAFLLAQAAAPHMAE
3edmC           NXXXXXXXXXXXXDKFGEIHGLVHVAG-----GLIARKTIAEMDEWHQVLDVNLTSLFLTAKTALPKMAK
3bmeC           --EIINSCFRA----FGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQNL---
2ztvB           KGEAVRGLVDNAVRQMGRIDILVNNAGIQH----TALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKK
3gk3D           DFESCERCAEKVLADFGKVDVLINNAGITRD----ATFMKMTKGDWDAVMRTDLDAMFNVTKQAGMVERR
3gk3B           DFESCERCAEKVLADFGKVDVLINNAGITRD----ATFMKMTKGDWDAVMRTDLDAMFNVTKQAGMVERR
3ennB           DREAVKALGQKAEEEMGGVDILVNNAGIT-RDGLFVRMSDEDWDAVLTVNLTSVFNLTR--ELTHPMMXX
3emkC           DREAVKALGQKAEEEMGGVDILVNNAGIT-RDGLFVRMSDEDWDAVLTVNLTSVFNLTR--ELTHPMMXX
1xg5B           NEEDILSMFSAIRSQHSGVDICINNAGLARPDTLLSGSTSGWKDMFN----VNVLALSICTREAYQSMKD
2japC           DRQGVDAAVASTVEALGGLDILVNNAGIM----LLGPVEDADTTDWTRMIDTNLLGLMYMTRAALPLLRS
2japA           DRQGVDAAVASTVEALGGLDILVNNAGIM----LLGPVEDADTTDWTRMIDTNLLGLMYMTRAALPLLRS
2ztuA           KGEAVRGLVDNAVRQMGRIDILVNNAGIQH----TALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKK
3bmqC           ----------------------------------------------------------------------
3bmnB           ----------------------------------------------------------------------
3bmfC           --EIINSCFRA----FGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQNL---
3bmeB           ----------------------------------------------------------------------
2ztmC           KGEAVRGLVDNAVRQMGRIDILVNNAGIQH----TALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKK
2yz7A           DAQATRDFIAKAAEALGGLDILVNNAGIQH----TAPIEEFPVDKWNAIIALNLSAVFHGTAAALPIMQK
2c7vB           --EIINSCFRA----FGRCDVLVNASAFYPTPLVNGKTVETQVAELIGTNAIAPFLLTSFAQRQKTSSNL
2ztvD           KGEAVRGLVDNAVRQMGRIDILVNNAGIQH----TALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKK
2ztlA           KGEAVRGLVDNAVRQMGRIDILVNNAGIQH----TALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKK
2c7vD           ----------------------------------------------------------------------
2c7vC           ----------------------------------------------------------------------
3bmjD           ----------------------------------------------------------------------
1nhgC           ----------------------------------------------------------------------
2ztmB           KGEAVRGLVDNAVRQMGRIDILVNNAGIQH----TALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKK
2ztmA           KGEAVRGLVDNAVRQMGRIDILVNNAGIQH----TALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKK
3f9iA           -----------------KDNYTIEVCNLANKEECSNLISKTSNGDFDKVIDINLKANFILNREAKMIQKR
2ph3A           ----------------GGLDTLVNNAGIT-RDTLLVRMKD---EDWEAVLEANLSAVFRTTREAVKLMMK
1nfrA           -----------------------------------GTIEDYALTEWQRILDVNLLGIRAVVKPKEA---G
3f9iB           ----------------------------------------------------------------------
3g1tA           --------------HYPRLDGVLHNAGLLGE---IGPMSEQDPQIWQDVMQVNVNATFMLTQALLPLLSD
1rwbA           VESDVINLVQSAIKEFGKLDVMINNAGLENPVSSH----EMSLSDWNKVIDTNLTGAFLGSREAIKVEND
2pd6B           EARAARCLLEQVQACFSRPPSVVVSCAGITQDEFL---LHMSEDDWDKVIAVNLKGTFLVTQAAQALVSN
2zk7A           NPDQVKASIDHIFKEYGSISVLVN---------------NASMGEWRRIIDVNLFGYYYASKFAIPYMSR
1g6kA           VESDVINLVQSAIKEFGKLDVMINNAGLANPVSSH----EMSLSDWNKVIDTNLTGAFLGSREAIKVEND
1geeA           VESDVINLVQSAIKEFGKLDVMINNAGLENPVSSH----EMSLSDWNKVIDTNLTGAFLGSREAIKVEND
1gcoA           VESDVINLVQSAIKEFGKLDVMINNAGLENPVSSH----EMSLSDWNKVIDTNLTGAFLGSREAIKVEND
2vr2A           DLELYEA---------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           GGSIITLTYYGAEKVMPNYNVMGVAKAALEASVRYLAVDLGNRGIRVNAVSAGPIKTLAASGIGDFRYIL
3grkB           GGSILTLTYYGAEKVMPNYNVMGVAKAALEASVKYLAVDLGPQNIRVNAISAGPIKTLAAS--GDFRYIL
3grkD           GGSILTLTYYGAEKVMPNYNVMGVAKAALEASVKYLAVDLGPQNIRVNAISAGPIKTLAA---GDFRYIL
3grkA           GGSILTLTYYGAEKVMPNYNVMGVAKAALEASVKYLAVDLGPQNIRVNAISAGPIKT------GDFRYIL
3grkG           GGSILTLTYYGAEKVMPNYNVMGVAKAALEASVKYLAVDLGPQNIRVNAISAGPIK-------GDFRYIL
3k2eA           GGSILTLSYYGAEKVVPHYNVMGVCKAALEASVKYLAVDLGKQQIRVNAISAGPVRTLASSGISDFHYIL
3k2eB           GGSILTLSYYGAEKVVPHYNVMGVCKAALEASVKYLAVDLGKQQIRVNAISAGPVRS-------DFHYIL
2pd3A           GASVLTLSYLGSTKYMAHYNVMGLAKAALESAVRYLAVDLGKHHIRVNALSAGPIRTLASSGIADFRMIL
2qioA           GGNILTLTYLGGERVVKNYNVMGVAKASLEASVKYLANDLGQHGIRVNAISAGPIRTLSAKGVGDFNSIL
3ek2A           DASLLTLSYLGAERAIPNYNTMGLAKAALEASVRYLAVSLGAKGVRVNAISAGPI-----SGIKSFGKIL
3ek2C           DASLLTLSYLGAERAIPNYNTMGLAKAALEASVRYLAVSLGAKGVRVNAISAGPIKT-------SFGKIL
3ek2D           DASLLTLSYLGAERAIPNYNTMGLAKAALEASVRYLAVSLGAKGVRVNAISAGPIKS--------FGKIL
3ek2B           DASLLTLSYLGAERAIPNYNTMGLAKAALEASVRYLAVSLGAKGVRVNAISAGPIK---------FGKIL
1qsgG           GSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKML
1qsgA           GSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKML
1qg6A           GSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKML
2p91B           NGAIVTLSYYGAEKVVPHYNVMGIAKAALESTVRYLAYDIAKHGHRINAISAGPVKTLAATG---FHLLM
1c14A           GSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKML
2p91A           NGAIVTLSYYGAEKVVPHYNVMGIAKAALESTVRYLAYDIAKHGHRINAISAGPVKTLAA--ITGFHLLM
2yw9B           GGGIVTLTYYASEKVVPKYNVMAIAKAALEASVRYLAYELGPKGVRVNAISAGPVR-VAARSIPGFTKMY
2fhsB           GSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRT-----IKDFRKML
2yw9C           GGGIVTLTYYASEKVVPKYNVMAIAKAALEASVRYLAYELGPKGVRVNAISAGPVYDRVAQ---------
2yw9F           GGGIVTLTYYASEKVVPKYNVMAIAKAALEASVRYLAYELGPKGVRVNAISAGPYDRVAQT---------
2yw9A           GGGIVTLTYYASEKVVPKYNVMAIAKAALEASVRYLAYELGPKGVRVNAISAGPVRDRVAQ---------
2yw9H           GGGIVTLTYYASEKVVPKYNVMAIAKAALEASVRYLAYELGPKGVRVNAISAGPVFTKMYDRVAQ-----
2yw9E           GGGIVTLTYYASEKVVPKYNVMAIAKAALEASVRYLAYELGPKGVRVNAISAGPV-----------RKMY
1lxcA           GSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTL-------FRKML
2yw9D           GGGIVTLTYYASEKVVPKYNVMAIAKAALEASVRYLAYELGPKGVRVNAISAGPV---------GFTKMY
1i30A           GSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRT--------FRKML
2p91D           NGAIVTLSYYGAEKVVPHYNVMGIAKAALESTVRYLAYDIAKHGHRINAISAGPVK--------------
1dfiA           GSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTL----------ML
2p91C           NGAIVTLSYYGAEKVVPHYNVMGIAKAALESTVRYLAYDIAKHGHRINAISAGPV---------------
1lx6A           GSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPI-------------ML
1uluB           GGGIVTLTYYASEKVVPKYNV-AIAKAALEASVRYLAYELGPKGVRVNAISAGPVRTVAARSIPGF---T
2jjyA           NASMVALTYIGAEKAMPSYNTMGVAKASLEATVRYTALALGEDGIKVNAVSAGPIKKM-----------L
2jjyD           NASMVALTYIGAEKAMPSYNTMGVAKASLEATVRYTALALGEDGIKVNAVSAGPIK------------ML
2jjyB           NASMVALTYIGAEKAMPSYNTMGVAKASLEATVRYTALALGEDGIKVNAVSAGPIKTLMVS---------
2jjyC           NASMVALTYIGAEKAMPSYNTMGVAKASLEATVRYTALALGEDGIKVNAVSAGPI---------------
1uluC           GGGIVTLTYYASEKVVPKYNV-AIAKAALEASVRYLAYELGPKGVRVNAISAGPVYDRVAQ---------
1uluA           GGGIVTLTYYASEKVVPKYNV-AIAKAALEASVRYLAYELGPKGVRVNAISAGPVFT-------------
1uluD           GGGIVTLTYYASEKVVPKYNV-AIAKAALEASVRYLAYELGPKGVRVNAISAGPVRKYDRVA--------
2o2sB           GGSAVTLSYLAAERVVPGYGGMSSAKAALESDTRTLAWEAGQKGVRVNAISAGPLKSRAASAIGKEKYAI
2o2sA           GGSAVTLSYLAAERVVPGYGGMSSAKAALESDTRTLAWEAGQKGVRVNAISAGPLKSRAASAIGKIDYAI
1enoA           GGASISLTYIASERIIPGYGGMSSAKAALESDTRVLAFEAGRKNIRVNTISAGPLGSRAAKAIGFIDTMI
1d7oA           GGASISLTYIASERIIPGYGGMSSAKAALESDTRVLAFEAGRKNIRVNTISAGPLGSRAAKAIGFIDTMI
1cwuA           GGASISLTYIASERIIPGYGGMSSAKAALESDTRVLAFEAGRKNIRVNTISAGPLGSRAAKAIGFIDTMI
2o50A           GGSAVTLSYLAAERVVPGYGGGSSAKAALESDTRTLAWEAGQKGVRVNAISAGPLKSF-------IDYAI
2o50B           GGSAVTLSYLAAERVVPGYGGGSSAKAALESDTRTLAWEAGQKGVRVNAISAGPLSFI--------DYAI
3fnfB           GGSIVGMDF-DPSRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAMSEGWDQRAPI
2b35D           GGSIVGMDF-DPSRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAMEG-WDQRAPI
3fnfD           GGSIVGMDF-DPSRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAMSGAWDQRAPI
2b35C           GGSIVGMDF-DPSRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLLEEG-WDQRAPI
3fnfC           GGSIVGMDF-DPSRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAMSAIWDQRAPI
3fneB           GGSIVGMDF-DPSRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAAEEGWDQRAPI
2nv6A           GGSIVGMDF-DPSRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAMSAIWDQRAPI
3fneC           GGSIVGMDF-DPSRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAMSAIWDQRAPI
2aqkA           GGSIVGMDF-DPSRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAMSAIWDQRAPI
2h7iA           GGSIVGMDF-DPSRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAMSAIWDQRAPI
1enyA           GGSIVGMDF-DPSRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAMSAIWDQRAPI
2op0B           QSSIISLTYHASQKVVPGYGGMSSAKAALESDTRVLAYHLGNYNIRINTISAGPLKSRAATAITFIDYAI
2oosA           QSSIISLTYHASQKVVPGYGGMSSAKAALESDTRVLAYHLGNYNIRINTISAGPLKSRAATAITFIDYAI
2aqiA           GGSIVGMDF-DPSRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAMSAIWDQRAPI
2aqhA           GGSIVGMDF-DPSRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAMSAIWDQRAPI
2aq8A           GGSIVGMDF-DPSRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAMSAIWDQRAPI
2b36B           GGSIVGMDF-DPSRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTALGEEAGAQIQLL
1uh5A           QSSIISLTYHASQKVVPGYGGMSSAKAALESDTRVLAYHLGNYNIRINTISAGPLKSRAATAINTFDYAI
2oosB           QSSIISLTYHASQKVVPGYGGMSSAKAALESDTRVLAYHLGNYNIRINTISAGPLKSRAATAINTFDYAI
2ol4B           QSSIISLTYHASQKVVPGYGGMSSAKAALESDTRVLAYHLGNYNIRINTISAGPLKSRAATAINTFDYAI
3fneD           GGSIVGMDF-DPSRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAMGEEADQRAPI
2b37B           GGSIVGMDF-DPSRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTEG----WDQRAPI
2b35F           GGSIVGMDF-DPSRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLLEEG-WDQRAPI
2b35B           GGSIVGMDF-DPSRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTEEG---WDQRAPI
2b35A           GGSIVGMDF-DPSRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTGAQIQLWDQRAPI
2b35E           GGSIVGMDF-DPSRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTAGAEEGWDQRAPI
1vrwA           QSSIISLTYHASQKVVPGYGGMSSAKAALESDTRVLAYHLGNYNIRINTISAGPLKSRAATAINKYTFII
2o2yD           QSSIISLTYHASQKVVPGYGGMSSAKAALESDTRVLAYHLGNYNIRINTISAGPLKSRAATAIYTFDYAI
2b37C           GGSIVGMDF-DPSRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLGEEAGAQIQLLE
1zxlA           QSSIISLTYHASQKVVPGYGGMSSAKAALESDTRVLAYHLGNYNIRINTISAGPLKSRAATAINFIDYAI
1zsnA           QSSIISLTYHASQKVVPGYGGMSSAKAALESDTRVLAYHLGNYNIRINTISAGPLKSRAATAINFIDYAI
2o2yC           QSSIISLTYHASQKVVPGYGGMSSAKAALESDTRVLAYHLGNYNIRINTISAGPLKSRAATAINFIDYAI
2o2yA           QSSIISLTYHASQKVVPGYGGMSSAKAALESDTRVLAYHLGNYNIRINTISAGPLKSRAATAINFIDYAI
2ol4A           QSSIISLTYHASQKVVPGYGGMSSAKAALESDTRVLAYHLGNYNIRINTISAGPLKSTFID------YAI
2ntvA           GGSIVGMDF-DPTRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAMSAIGAQMQLL
1nhgA           QSSIISLTYHASQKVVPGYGGMSSAKAALESDTRVLAYHLGNYNIRINTISAGPLKSRAATAI-------
2ptgA           GGSALALSYI-----------------ALESDCRTLAFEAGRRAVRVNCISAGPLKELES----------
1vl8B           NPSIINIGSLTVEEVMPNISAYAASKGGVASLTKALAKEWGRYGIRVNVIAPGWYRTKMTEAVFSDPEKL
1vl8A           NPSIINIGSLTVEEVMPNISAYAASKGGVASLTKALAKEWGRYGIRVNVIAPGWYRTKMTEAVFSDPEKL
1fmcA           GGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSVITPEIEQ
1ahhA           GGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSVITPEIEQ
2nm0A           KGRXXXXXXXXXXXXXXXQANYAASKAGLVGFARSLARELGSRNITFNVVAPGFVDTQRANIVS------
3gafF           GGAILNISSMAGENTNVRMASYGSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTDAVLTPEIERAML
3gafH           GGAILNISSMAGENTNVRMASYGSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTPEIE-----RAML
3gafA           GGAILNISSMAGENTNVRMASYGSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTDALATVEIERAML
3gafE           GGAILNISSMAGENTNVRMASYGSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTTPEIE----RAML
1i01E           HGRIITI---GSVVGQANY---AAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTRALSDDQRIL
3gafG           GGAILNISSMAGENTNVRMASYGSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKT-------DTPEIE
3gafD           GGAILNISSMAGENTNVRMASYGSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTDVLTPEIE-RAML
3gafC           GGAILNISSMAGENTNVRMASYGSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKT-------DTPEIE
3gafB           GGAILNISSMAGENTNVRMASYGSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTDPEIE----RAML
1q7bA           GGSVVGTMGNGGQA---NY---AAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTRALSDDQRIL
3cxrA           HGKIINICSMMSELGRETVSAYAAAKGGLKMLTKNIASEYGEANIQCNGIGPGYIATPQTAPLRELHPFD
1q7cA           HGRIITIGSVVGTMGNGGQANFAAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTRALSDDQRIL
1q7bB           GGSVVGTMGNGGQA---NY---AAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTRSDDQRAGIL
1hdcA           GGSIVNISSAAGLMGLALTSSYGASKWGVRGLSKLAAVELGTDRIRVNSVHPGMTYTTAETGIRQG----
1i01B           GRIITIGSVVGTGQA--NY---AAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETSDDQRAGILAQV-
1i01G           HGRIITIGY-------------AAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTRALSDDQRIL
1i01D           HGRIITIG-----SVVANY---AAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETALSD---DQRAGI
3cxtA           HGKIINICSMMSELGRETVSAYAAAKGGLKMLTKNIASEYGEANIQCNGIGPGYIATPQTHPFDQF-IIA
3i3oF           GDVIISIVAYEGNETLIDYSA---TKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWTPLIPSSFDEKKVS
3i3oE           GDVIISIVAYEGNETLIDYSA---TKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWTPLIPSSFDEKKVS
3i3oC           GDVIISIVAYEGNETLIDYSA---TKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWTPLIPSSFDEKKVS
3i3oB           GDVIISIVAYEGNETLIDYSA---TKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWTPLIPSSFDEKKVS
3i3oA           GDVIISIVAYEGNETLIDYSA---TKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWTPLIPSSFDEKKVS
1cydA           GGSIVNVSSMVAHVTFPNLITYSSTKGAMTMLTKAMAMELGPHKIRVNSVNPTVVLTDMGKKVSDPEFAR
1uzlA           FGRMIFIGSVSGSWGQANY---AASKAGVIGMARSIARELSKANVTANVVAPGYIDTDMTRALDE--RIQ
1i01H           HGRIITI---GA-----NY---AAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTRALQRAGILA
1i01F           HGRIITIG-----------SVVAAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTRALSDDQRIL
1zemA           YGRIVNTASMAGVKGPPNMAAYGTSKGAIIALTETAALDLAPYNIRVNAISPGQVELQAKVGSQYFKVVA
3ctmE           XSLIITSSISGKIQLQAPYN---TAKAACTHLAKSLAIEWAPFA-RVNTISPGYIDT----DITDFAMKA
3i3oH           GDVIISIVAYEGNETLIDYSA---TKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWTLIPSSFSQF----
1xkqB           GEIVNVSSIVAGPQAQPDFLYYAIAKAALDQYTRSTAIDLAKFGIRVNSVSPGMVETGFTNAMGPDQASQ
1xkqA           GEIVNVSSIVAGPQAQPDFLYYAIAKAALDQYTRSTAIDLAKFGIRVNSVSPGMVETGFTNAMGPDQASQ
1i01A           HGRIITIGSV--------VGTMAAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTRALSDDQRIL
1ulsB           NPGSIVLTVYLGNLGQANY----AASAGVVGLTRTLALELGRWGIRVNTLAPGFIETRTAKVPEKVR---
1ulsA           NPGSIVLTVYLGNLGQANY----AASAGVVGLTRTLALELGRWGIRVNTLAPGFIETRTAKVPEKVR---
3ctmG           XSLIITSSISGKIQLQAPYN---TAKAACTHLAKSLAIEWAPFA-RVNTISPGYIDT----DITDFAMKA
3ctmC           XSLIITSSISGKIQLQAPYN---TAKAACTHLAKSLAIEWAPFA-RVNTISPGYIDT----DITDFAMKA
1uzlB           FGRMIFIGSVSGSWGIGNQANYAASKAGVIGMARSIARELSKANVTANVVAPGYIDTA-------LQFI-
1pr9A           PGAIVNVSSQCSQRAVTNHSVYCSTKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWSDPHKA
1i01C           HGRIITIG-----SVVANY---AAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETRARAGI-------
2p68A           ISSVVGFT---GNVGQVNYST---TKAGLIGFTKSLAKELAPRNVLVNAVAPGFIETDMTAVLSE--EIK
3ctmA           XSLIITSSISG--KIVQLQAPYNTAKAACTHLAKSLAIEWAPFA-RVNTISPGYIDT----DITDFAMKA
1ulsC           NPGSIVLTVYLGNLGQANY----AASAGVVGLTRTLALELGRWGIRVNTLAPGFIETPEK--------VR
1g0nB           GGRLILMSITGQAKAVPKHAVYSGSKGAIETFARCMAIDMADKKITVNVVAPGGIKTDMYH--ADEYAAV
1w6uA           AAFLSITTIYGSGFVVPSAS----AKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKTLDPTGTFEKEMIG
2p68B           ISSVVGFT---GNVGQVNYST---TKAGLIGFTKSLAKELAPRNVLVNAVAPGFIET-------DMTAVL
3i3oG           GDVIISIVAYEGNETLIDYSA---TKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIGS-------------
3ftpA           GGRIVNITSVVGSAGNPGQVNYAAAKAGVAGMTRALAREIGSRGITVNCVAPGFIDTDMTKGLPQEQQTA
2a4kA           GGSLVLLAHYAAGKL----GVVGLA--------RTLALELARKGVRVNVLLPGLIQTPMTAGLPPWAWEQ
1uznA           FGRMIFIGSVSGLWGIGNQANYAASKAGVIGMARSIARELSKANVTANVVAPGYIDTDMTRALDE--RIQ
3d3wA           PGAIVNVSSQ-SQRAVTNHSVYCSTKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWSDPHKA
1ybvA           GGRLILMSITGQAKAVPKHAVYSGSKGAIETFARCMAIDMADKKITVNVVAPGGIKTDMYHAVGENLSNE
1w6uD           AAFLSITTIYGSGFVVPSAS----AKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKTFEKEMIG------
3ijrH           GDVIISIVAYEGNETLIDYSA---TKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWTPLIPSSFDEKKVS
3ijrF           GDVIISIVAYEGNETLIDYSA---TKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWTPLIPSSFDEKKVS
3ijrE           GDVIISIVAYEGNETLIDYSA---TKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWTPLIPSSFDEKKVS
3ijrB           GDVIISIVAYEGNETLIDYSA---TKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWTPLIPSSFDEKKVS
3ijrA           GDVIISIVAYEGNETLIDYSA---TKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWTPLIPSSFDEKKVS
1g0oC           GGRLILMSITGQAKAVPKHAVYSGSKGAIETFARCMAIDMADKKITVNVVAPGGIKTDMYHAVGENLSNE
1g0oA           GGRLILMSITGQAKAVPKHAVYSGSKGAIETFARCMAIDMADKKITVNVVAPGGIKTDMYHAVGENLSNE
1dohB           GGRLILMSITGQAKAVPKHAVYSGSKGAIETFARCMAIDMADKKITVNVVAPGGIKTDMYHAVGENLSNE
1dohA           GGRLILMSITGQAKAVPKHAVYSGSKGAIETFARCMAIDMADKKITVNVVAPGGIKTDMYHAVGENLSNE
1yxmC           GGSIVNIIVPGFPLAVHS----GAARAGVYNLTKSLALEWACSGIRINCVAPGVIYSQTAVFEGSFQKI-
1k2wA           GGKIINMASQAGRRGEALVGVYCATKAAVISLTQSAGLNLIRHGINVNAIAPGVVDGEHWDGVADYENLP
1uznB           FGRMIFIGSVSGLWGIGNQANYAASKAGVIGMARSIARELSKANVTANVVAPGYIDTA-------LQFI-
1uzmA           FGRMIFI-----GSVSGNQANYAASKAGVIGMARSIARELSKANVTANVVAPGYIDTDMTRALDE--RIQ
3ctmH           XSLIITSSISGKIVNIPQLQAYNTAKAACTHLAKSLAIEWAPFA-RVNTISPGYIDT----DITDFAMKA
2bgkA           GSIVFTASISSFTAGEGVSHVYTATKHAVLGLTTSLCTELGEYGIRVNCVSASPLLT-DVFGVDSSR-VE
1w6uC           AAFLSITTIYGSGFVVPSAS----AKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKT------GAFGTFE
2ntnA           FGRMIFIA-----SVQANY---AASKAGVIGMARSIARELSKANVTANVVAPGYIMTRALDQQGALQFI-
2hq1A           SGKIINITSQA------NY---AASKAGLIGFTKSIAKEFAAKGIYCNAVAPGIIKTDMTDVLPDKVKEM
3ctmF           XSLIITSSISGKIVNIPQLQAYNTAKAACTHLAKSLAIEWAPFA-RVNTISPGYIDT----DITDFAMKA
2ntnB           FGRMIFIA-----SVQANY---AASKAGVIGMARSIARELSKANVTANVVAPGYIDTL--------QFI-
3ftpD           GGRIVNITSVVGSAGNPGQVNYAAAKAGVAGMTRALAREIGSRGITVNCVAPGFIDT------DEQQTAL
3ftpC           GGRIVNITSVVGSAGNPGQVNYAAAKAGVAGMTRALAREIGSRGITVNCVAPGFIDTDMTK---EQQTAL
3ctmD           XSLIITSSISGKIVNIPQLQAYNTAKAACTHLAKSLAIEWAPFA-RVNTISPGYIDT----DITDFAMKA
3ctmB           XSLIITSSISGKIVNIPQLQAYNTAKAACTHLAKSLAIEWAPFA-RVNTISPGYIDT----DITDFAMKA
1xhlA           KGEIVNVSSIVAPQAHSGYPYYACAKAALDQYTRCTAIDLIQHGVRVNSVSPGAVATMGAMGLPEYSFIG
1uzmB           FGRMIFI----GSVSQANY---AASKAGVIGMARSIARELSKANVTANVVAPGYIDTA-------LQFI-
3iccA           NSRIINISSAATRISLPDF-IAYSTKGAINTTFT-LAKQLGARGITVNAILPGFVKTDNAELLSDKQYAT
1yxmD           GGSIVNIIV-PTKAGFPLAVHSGAARAGVYNLTKSLALEWACSGIRINCVAPGVIYSTAVENYGSWQSFF
1w6uB           AAFLSITTIYGSGFVVPSAS----AKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKT------GTFE---
2d1yB           GAIVNVASVQGAEQENAAYNA---SKGGLVNLTRSLALDLAPLRIRVNAVAPGAIATEAV--LEAIRTRR
1spxA           KGEIVNISSIASGHATPDFPYYSIAKAAIDQYTRNTAIDLIQHGIRVNSISPGLVAT-------------
1ja9A           GGRIILTSSIAAVMTIPNHALYAGSKAAVEGFCRAFAVDCGAKGVTVNCIAPGGVKT-------------
2cfcA           AGVIVNIASVASLVAFPGRSAYTTSKGAVLQLTKSVAVDYAGSGIRCNAVCPGMIETPMTQWRLDQPELR
1x7gB           GGRIVNIASTGGKQGVVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVREFDRIT
2d1yD           GAIVNVASVQGAEQENAAYNA---SKGGLVNLTRSLALDLAPLRIRVNAVAPGAIATEAVEAIATRR---
1yxmB           GGSIVNIIV-PTKAGFPLAVHSGAARAGVYNLTKSLALEWACSGIRINCVAPGVIYSQTAQSFGSFQKI-
1o5iA           KGRIVAITSFSVISPIENLYTSNSARMALTGFLKTLSFEVAPYGITVNCVAPGWTETERVKELLSEEK-K
1h5qA           GSIVVTXXXXXXXXXXXXXXXXNSSKAACSNLVKGLAAEWASAGIRVNALSPGYVNTDQTAHMD--KKIR
2d1yA           GAIVNVASVQGAEQENAAYNA---SKGGLVNLTRSLALDLAPLRIRVNAVAPGAIATEAVLEAIARR---
2d1yC           GAIVNVASVQGAEQENAAYNA---SKGGLVNLTRSLALDLAPLRIRVNAVAPGAIATEAALSPDPERTRR
3emkB           XXSIVGVT---GNPGQANYCA---SKAGLIGFSKSLAQEIASRNVTVNCIAPGFIKDAIMG---------
3ezlA           GGRIINISSVNGQKGQFGQTNYSTAKAGIHGFTMSLAQEVATKGVTVNTVSPGYIGTDMVKAIRP--DVL
1xr3B           GGRIVNIASTGGKQGVVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVREVSTEE
1nffA           GGSIINISSIEGLAGTVACHGYTATKFAVRGLTKSTALELGPSGIRVNSIHPGLVKTPMTDWVPE-----
1w4zB           GGRIVNIASTGGKQGVVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVREHYTEE
3i4fD           FGRIINYGFQGADSA-PGWSAFAAAKVGLVSLTKTVAYEEAEYGITANMVCPGDI-------IGEMKE-A
1yxmA           GGSIVNIIV-PTKAGFPLAVHSGAARAGVYNLTKSLALEWACSGIRINCVAPGVIYSTAVENYGSWQSFF
1w0cH           GTSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPG-LSVLVA--------VW
2uvdA           GRIVNIASVVGVTGNPGQANYVA-AKAGVIGLTKTSAKELASRNITVNAIAPGFIAT-------DMTDVL
2q2qE           GRIINIASVHGAAYVAAKHGVVGLTKV--------VGLETATSNVTCNAICPGWVLTPLVQKQIDDRALQ
3gvcA           GGAIVNLSSLAGQVAVGGTGAYGMSKAGIIQLSRITAAELRSSGIRSNTLLPAPMQQTAMAMFGGARSMI
2q2vD           GRIINIASVHGAAYVAAKHGVVGLTKV--------VGLETATSNVTCNAICPGWVLTLVQKQIDDRQAQH
2p8kB           GTSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPG------LSVLVDDMPPA
3i4fC           FGRIINYGFQGADSA-PGWSAFAAAKVGLVSLTKTVAYEEAEYGITANMVCPGDI-------IGEMK---
2bfpD           GTSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVN-------------GVGPGLSVL
1e92D           GTSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVN-------------GVGPGLSVL
3bmoA           NLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKD---
2bfmC           GTSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVN-------------GVGPGLSVL
1w73A           AAFLSITTIYGSGFVVPSAS----AKAGVEAS-KSLAAEWGKYG-RFNVIQPGPIKTLDPTGTFEKEI--
1w0cC           GTSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVN-------------GVGPGLSVL
1w0cB           GTSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPG------LSVLVDDMPPA
2q2qA           GRIINIASVHGAAYVAAKHGVVGLTKV--------VGLETATSNVTCNAICPGWVLTLVQKQIDDRDPLQ
3i4fA           FGRIINYGFQGADSA-PGWSAFAAAKVGLVSLTKTVAYEEAEYGITANMVCPGDI-------IGEMK---
2ag5C           SGNIINMSSVASSKGVVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQE----RIQA
2ag5B           SGNIINMSSVASSKGVVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQE----RIQA
2ag5A           SGNIINMSSVASSKGVVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQE----RIQA
2qhxC           GTSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPG------------LSVLV
2q2qC           GRIINIASVHGAAYVAAKHGVVGLTKV--------VGLETATSNVTCNAICPGWVLTLVQKQIAQHDLLA
2p8kD           GTSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPG-LSVLVDD------MVW
1e92B           GTSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPG------LSVLVDDMPPA
2bf7C           GTSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVN-------------GVGPGLSVL
2ae2A           RGNVVFISSVSGALAVPYEAVYGATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATLVEMTIQDPEQKE
2rhrB           GGRIVNIASTGGKQGVVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVREHEEAF
2qhxA           GTSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPG------LSVLVDDMPPA
1p33D           RGSIVNMVDAMTSQPLLGYTMYTMAKEALEGLTRSAALELASLQIRVNGVSPG------LSVLPDDMPFS
1p33A           RGSIVNMVDAMTSQPLLGYTMYTMAKEALEGLTRSAALELASLQIRVNGVSPG------LSVLPDDMPFS
1e7wA           GTSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPG------LSVLVDDMPPA
3csdB           GGRIVNIASTGGKQGVVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVREHEEAF
2bfaC           GTSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPG-LSVLVRSKV-------
2bf7D           GTSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPG-LSVLVRSKV-------
2bf7B           GTSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPG------LSVLVDDMPPA
2ae1A           RGNVVFISSVSGALAVPYEAVYGATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATQDPEQKENLNKLI
2zatA           XXXXXXXXXXXAYHPFPNLGPYNVSKTALLGLTKNLAVELAPRNIRVNCLAPGLIKT-------------
1x7hB           GGRIVNIASTGGKQGVVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVRE-HYSD
1x7gA           GGRIVNIASTGGKQGVVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVRE-HYSD
1w4zA           GGRIVNIASTGGKQGVVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVRE-HYSD
2rhrA           GGRIVNIASTGGKQGVVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVRE-HYSD
2rh4B           GGRIVNIASTGGKQGVVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVRE-HYSD
2rh4A           GGRIVNIASTGGKQGVVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVRE-HYSD
2q2vC           GRIINIASVHGAAYVAAKHGVVGLTKV--------VGLETATSNVTCNAICPGWVLTPLVQKQIDDRLQA
2q2qH           GRIINIASVHGAAYVAAKHGVVGLTKV--------VGLETATSNVTCNAICPGWVLTPPLQAQHDLL---
2q2qG           GRIINIASVHGAAYVAAKHGVVGLTKV--------VGLETATSNVTCNAICPGWVLTLVQKQIDDRAAPL
2p8kA           GTSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPG------LSVLVDDMPPA
1iy8A           QGSVVNTASVGGIRGIGNQSGYAAAKHGVVGLTRNSAVEYGRYGIRINAIAPGAIWTPMVE--NSMKQLD
3gvcD           GGAIVNLSSLAGQVAVGGTGAYGMSKAGIIQLSRITAAELRSSGIRSNTLLPAPMQQTAMAGGARSMIAR
1ae1A           NGNVIFLSSIAGFSALPSVSLYSASKGAINQMTKSLACEWAKDNIRVNSVAPGVI--LQKEEIDNF--IV
1ydeP           SGNVINISSLGQAQAVPYV----ATKGAVTAMTKALALDESPYGVRVNCISPGPLWEELAALMPDPRASI
1ydeM           SGNVINISSLGQAQAVPYV----ATKGAVTAMTKALALDESPYGVRVNCISPGPLWEELAALMPDPRASI
1ydeI           SGNVINISSLGQAQAVPYV----ATKGAVTAMTKALALDESPYGVRVNCISPGPLWEELAALMPDPRASI
1ydeH           SGNVINISSLGQAQAVPYV----ATKGAVTAMTKALALDESPYGVRVNCISPGPLWEELAALMPDPRASI
1ydeG           SGNVINISSLGQAQAVPYV----ATKGAVTAMTKALALDESPYGVRVNCISPGPLWEELAALMPDPRASI
1ydeF           SGNVINISSLGQAQAVPYV----ATKGAVTAMTKALALDESPYGVRVNCISPGPLWEELAALMPDPRASI
1ydeD           SGNVINISSLGQAQAVPYV----ATKGAVTAMTKALALDESPYGVRVNCISPGPLWEELAALMPDPRASI
1ydeA           SGNVINISSLGQAQAVPYV----ATKGAVTAMTKALALDESPYGVRVNCISPGPLWEELAALMPDPRASI
3edmD           GGAIVTFSQAGRDGGGPGALAYATSKGAVMTFTRGLAKEVGPK-IRVNAVCPGSSEDVA-----------
3edmA           GGAIVTFSQAGRDGGGPGALAYATSKGAVMTFTRGLAKEVGPK-IRVNAVCPGMISTREGSS--------
1e7wB           GTSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPG------------LSVLV
2zk7B           DPSIVNISSVQASIITKNASAYVTSKHAVIGLTKSIALDYAPL-LRCNAVCPATIDTPLVRKAAELKKIS
2qhxD           GTSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPG------------LSVLV
2q2wC           GRIINIASVHGAAYVAAKHGVVGLTKV--------VGLETATSNVTCNAICPGWVLTLVQKQIDDGGDPL
2q2qF           GRIINIASVHGAAYVAAKHGVVGLTKV--------VGLETATSNVTCNAICPGWVLTPLAQ-----HDLL
3grpA           MGRIINITSIG----QTNYCA---AKAGLIGFSKALAQEIASRNITVNCIAPGFIKSAMTDKLNE-----
3edmB           GGAIVTFSQAGRDGGGPGALAYATSKGAVMTFTRGLAKEVGPK-IRVNAVCPGMIST-------------
2dteA           DPSIVNISSVQASIITKNASAYVTSKHAVIGLTKSIALDYAPL-LRCNAVCPATIDTPLVRKAAELKKIS
2bfoA           GTSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPG------LSVLVDDMPPA
2bfmB           GTSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPG------LSVLVDDMPPA
1w0cA           GTSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPG------LSVLVDDMPPA
2q2vA           GRIINIASVHGAAYVAAKHGVVGLTKVGLETATSNVTCNAICPGWVLTPLVQKQIDDRAANGGDPLQAQH
3gvcC           GGAIVNLSSLAGQVAVGGTGAYGMSKAGIIQLSRITAAELRSSGIRSNTLLPAFVDTMFDGALGGARSMI
3gvcB           GGAIVNLSSLAGQVAVGGTGAYGMSKAGIIQLSRITAAELRSSGIRSNTLLPAFVDTMFDGALGGARSMI
3ennD           XXSIVGVT---GNPGQANYCA---SKAGLIGFSKSLAQEIASRNVTVNCIAPGFIEKDAIMG--------
3ennC           XXSIVGVT---GNPGQANYCA---SKAGLIGFSKSLAQEIASRNVTVNCIAPGFIEKDAIMG--------
2c07A           YGRIINISSIVGLTGNVGQANYSSSKAGVIGFTKSLAKELASRNITVNAIAPGFISSISEQ-------IK
3bmfA           --SIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPG-VSLLPAMGEEEKD---
2bfaB           GTSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPG------LSVLVDDMPPA
1ydeN           SGNVINISSLGQAQAVPYV----ATKGAVTAMTKALALDESPYGVRVNCISPGNIWT----PLWEPRASI
1ydeB           SGNVINISSLGQAQAVPYV----ATKGAVTAMTKALALDESPYGVRVNCISPGNIWT----PLWEPRASI
1xg5A           DGHIININSMSGHRVLPFYSATKYAVTALTEGLRQ-ELREAQTHIRATCISPGVVETQFAFKLHD-----
2q2wD           GRIINIASVHGAAYVAAKHGVVGLTKV--------VGLETATSNVTCNAICPGWVLTLVQKQIDDLQAQH
1p33C           RGSIVNMVDAMTSQPLLGYTMYTMAKEALEGLTRSAALELASLQIRVNGVSPG------LSVLPDDMPFS
1p33B           RGSIVNMVDAMTSQPLLGYTMYTMAKEALEGLTRSAALELASLQIRVNGVSPG------LSVLPDDMPFS
3bmdB           --SIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPG-VSLLPAMGEEEKD---
2bfpB           GTSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPG------LSVLVDDMPPA
2bfoC           GTSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPG------------LSVLV
2bfaA           GTSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPG------LSVLVDDMPPA
2bf7A           GTSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPG------LSVLVDDMPPA
1w73D           AAFLSITTIYGSGFVVPSAS----AKAGVEAS-KSLAAEWGKYG-RFNVIQPGPIKTKEIGRI-------
1w73C           AAFLSITTIYGSGFVVPSAS----AKAGVEAS-KSLAAEWGKYG-RFNVIQPGPIKTT-----GTFEKEI
3grpB           -GRIINITSIG----QTNYCA---AKAGLIGFSKALAQEIASRNITVNCIAPGFIKSAIMAMI-------
3bmnD           --SIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKD---
3bmkC           --SIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKD---
2wd7C           --SIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKD---
2vz0A           --SIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKD---
2q2qB           GRIINIASVHGAAYVAAKHGVVGLTKV--------VGLETATSNVTCNAICPGWVLTLVQKQIDDRAGDP
3imfB           GNIINVATY--AWDAGPGVIHSAAAKAGVLAT-KTLAVEWGRKGIRVNAIAPGPIERTGGADEEAKRTI-
2ewmB           WGRIINLTSTTYWLKIEAYTHYISTKAANIGFTRALASDLGKDGITVNAIAPSLVRT-------------
2ewmA           WGRIINLTSTTYWLKIEAYTHYISTKAANIGFTRALASDLGKDGITVNAIAPSLVRT-------------
3ennA           XXSIVGVT---GNPGQANYCA---SKAGLIGFSKSLAQEIASRNVTVNCIAPGFIESKQKDAIMG-----
2dknA           ------------------------SKYAVTCLARRNVVDWAGRGVRLNVVAPGAVETLLQASKADPRYGE
3bmoC           --SIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKD---
3bmnC           --SIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKD---
2wd7B           --SIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKD---
2vz0B           --SIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKD---
2p8kC           GTSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPG------------LSVLV
2ew8A           WGRIINLTSTTYWLKIEAYTHYISTKAANIGFTRALASDLGKDGITVNAIAPSLVNMLQA----------
1e92C           GTSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVN-------------GVGPGLSVL
3bmoD           NLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKD---
3bmiB           --SIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKD---
1ae1B           NGNVIFLSSIAGFSALPSVSLYSASKGAINQMTKSLACEWAKDNIRVNSVAPGVILTLVETAIKKDNFIV
2a4kB           ---------------------------------RTLALELARKGVRVNVLLPGLIQA-------------
3imfA           GNIINVATY--AWDAGPGVIHSAAAKAGVLAT-KTLAVEWGRKGIRVNAIAPGPIERTGGAE-------A
3emkD           XXSIVGVT---GNPGQANYCA---SKAGLIGFSKSLAQEIASRNVTVNCIAPGFIEEKQKDAIMG-----
2c7vA           --SIVNLCDAMVDQPMA-FSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKD---
3bmqA           --SIVNLCDAMVDQPMA-FSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKD---
2bfaD           GTSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVHRSKV-------
2q2wA           GRIINIASVHGAAYVAAKHGVVGLTKV--------VGLETATSNVTCNAICPGWVLTLVQKQIDDLQAQH
2q2vB           GRIINIASVHGAAYVAAKHGVVGLTKV--------VGLETATSNVTCNAICPGWVLTLVQKQIDDLQAQH
2gdzA           GGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRALAANLMNSGVRLNAICPGFVNTAILESIEKEENMG
3bmfD           --SIVNLCDAMVDQPMA-FSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKD---
3bmeA           --SIVNLCDAMVDQPMA-FSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKD---
2ztuD           QGRIINIASAHGLVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVRETAA------RELL
1x1tA           QGRIINIASAHGLVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVRTLLSE---------
1x1eA           AGSVTTFTAGGPVPI-PAYTT---AKTALLGLTRALAKEWARLGIRVNLLCPGYVETEFTLPLRQNPELY
1w0cE           GTSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPG------LSVLVDDMPPA
2p8kG           GTSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGV--GP-------GLSVLVDDM
2ekpA           AGSVTTFTAGGPVPI-PAYTT---AKTALLGLTRALAKEWARLGIRVNLLCPGYVETEFTLPLRQNPELY
3bmoB           --SIVNLCDAMVDQPMA-FSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKD---
3bmnA           --SIVNLCDAMVDQPMA-FSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKD---
3bmfB           --SIVNLCDAMVDQPMA-FSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKD---
2b4qB           SASVINISVAGISAMGEQAYAYGPSKAALHQLSRMLAKELVGEHINVNVIAPGRFPSRMTRHIANDPQAL
2b4qA           SASVINISVAGISAMGEQAYAYGPSKAALHQLSRMLAKELVGEHINVNVIAPGRFPSRMTRHIANDPQAL
1w73B           AAFLSITTIYGSGFVVPSAS----AKAGVEAS-KSLAAEWGKYG-RFNVIQPGPIKEKEIGRI-------
1w0cF           GTSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPG------LSVLVDDMPPA
3imfC           GNIINVATY--AWDAGPGVIHSAAAKAGVLAT-KTLAVEWGRKGIRVNAIAPGPIER------------A
3grpC           -GRIINIT-----SIQTNYCA---AKAGLIGFSKALAQEIASRNITVNCIAPGFIKKEAIMAM-------
1e92A           GTSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPG------LSVLVDDMPPA
2z1nB           KGWG-RMVYIGSVTLLRPWQLSNIMRLPVIGVVRTLALELAPHGVTVNAVLPSLILTDRVRSLSMASRI-
2p8kH           GTSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDEG--------
2ew8B           WGRIINLTSTTYWLKIEAYTHYISTKAANIGFTRALASDLGKDGITVNAIA-------------------
2ztvC           QGRIINIASAHGLVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVRTQISAGVDQETAAR
2ztmD           QGRIINIASAHGLVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVRSPLVEKQISARELL
2ztuC           QGRIINIASAHGLVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVRQETAA-----RELL
2ztuB           QGRIINIASAHGLVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVELLSEK---------
2z1nA           KGWG-RMVYIGSVTLLRPWQLSNIMRLPVIGVVRTLALELAPHGVTVNAVLPSLILTDRVRRI-------
1xg5C           DGHIININSMSGHRVLPFYSATKYAVTALTEGLRQ-ELREAQTHIRATCISPGVVETQFAFKLHDKDPEK
1w0cG           GTSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGV--GPGLSVLVDDMPPEGHRS
3grpD           -GRIINIT-----SIQTNYCA---AKAGLIGFSKALAQEIASRNITVNCIAPGFIKMI------------
3gk3C           FGRIVNIGSVNGSRGAFGQANYASAKAGIHGFTKTLALETAKRGITVNTVSPGYLATAMVAKILP-----
3gk3A           FGRIVNIGSVNGSRGAFGQANYASAKAGIHGFTKTLALETAKRGITVNTVSPGYLATAMVEAAKILPQI-
3emkA           XXSIVGVT---GNPGQANYCA---SKAGLIGFSKSLAQEIASRNVTVNCIAPGFIESAMEKQKDAIMG--
2ekqD           AGSVTTFTAGGPVPI-PAYTT---AKTALLGLTRALAKEWARLGIRVNLLCPGYVETELYEPI-------
3edmC           GGAIVTFSQAGRDGGGPGALAYATSKGAVMTFTRGLAKEVGPK-IRVNAVCPGSSEDVA-----------
3bmeC           --SIVNLCDAMVDQPMA-FSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPG------VSLLPD-----
2ztvB           QGRIINIASAHGLVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVRTPLVEKTAA-RELL
3gk3D           FGRIVNIGSVNGSRGAFGQANYASAKAGIHGFTKTLALETAKRGITVNTVSPGYLATAMVEAVPQDVLEA
3gk3B           FGRIVNIGSVNGSRGAFGQANYASAKAGIHGFTKTLALETAKRGITVNTVSPGYLATAMVEAVPQDVLEA
3ennB           XXSIVGVT---GNPGQANYCA---SKAGLIGFSKSLAQEIASRNVTVNCIAPGFIESNEKQKDAIMG---
3emkC           XXSIVGVT---GNPGQANYCA---SKAGLIGFSKSLAQEIASRNVTVNCIAPGFEKQKDAI-MG------
1xg5B           DGHIININSMSGHRVLPFYSATKYAVTALTEGLRQ-ELREAQTHIRATCISPGVVETQFA-----FKLHM
2japC           KGTVVQMSSIAGRVNVRNAAVYQATKFGVNAFSETLRQEVTERGVRVVVIEPGTTDT-------------
2japA           KGTVVQMSSIAGRVNVRNAAVYQATKFGVNAFSETLRQEVTERGVRVVVIEPGTTDT-------------
2ztuA           QGRIINIASAHGLVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVRLLSEK---------
3bmqC           --SIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKD---
3bmnB           --SIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKD---
3bmfC           --SIVNLCDAMVDQPMA-FSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGV-------SLGEEEKD-
3bmeB           --SIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKD---
2ztmC           QGRIINIASAHGLVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGPLVEKQISALAEKELLS
2yz7A           QGRIINIASAHGLVASVNKSAYVAAKHGVVGLTKVTALENAGKGITCNAICPGWVRTPLVEGIDIEAAAR
2c7vB           --SIVNLCDAMVDQPMA-FSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKD---
2ztvD           QGRIINIASAHGLVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVRTISVDQETAARELL
2ztlA           QGRIINIASAHGLVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVRTAEKNGVDQETAAR
2c7vD           ------------------FSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKD---
2c7vC           ------------------FSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKD---
3bmjD           ------------------FSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKD---
1nhgC           -------------------------------------------------------------------YAI
2ztmB           QGRIINIASAHGLVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVRSA--------RELL
2ztmA           QGRIINIASAHGLVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVRSAEKNGVDQETAAR
3f9iA           YGRIINISIVGGNPGQANYCA---SKAGLIGMTKSLSYEVATRGITVNAVAPGFIKLNEKQREAIVQKI-
2ph3A           AGRIVNITSVVGILGNPGQANYVASKAGLIGFTRAVAKEYAQRGITVNAVAPGFIETEMTERLP--QEVK
1nfrA           RGSIINISSIEGLAGTVACHGYTATKFAVRGLTKSTALELGPSGIRVNSIHPGLVKTPTDWVPEDI----
3f9iB           ------------------------SKAGLIGMTKSLSYEVATRGITVNAVAPGFIKSDMTDKLNE-----
3g1tA           AGSLVFTSSSVGRQGRANWGAYATSKFATEGMMQVLADEYQNRSLRVNCINPGGTRT-------------
1rwbA           KGTVINMSSVHEKIPWPLFVHYAASKGGMKLMTKTLALEYAPKGIRVNNIGPGAINT-------------
2pd6B           GGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQ-KVVD
2zk7A           DPSIVNISS------VKNASAYVTSKHAVIGLTKSIALDYAPL-LRCNAVCPATIDTPLVRKAAELKKIS
1g6kA           KGTVINMSSVHEKIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAINT-------------
1geeA           KGTVINMSSVHEKIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAINT-------------
1gcoA           KGTVINMSSVHEKIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAINT-------------
2vr2A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           KWNEYNAPLKRTVTIEEVGKSALYLLSDLSTAVTGEIHHVDSGYHTIGMKAVDAPDISVVKx
3grkB           KWNEYNAPLRRTVTIDEVGDVGLYFLSDLSRSVTGEVHHADSGYHVIGM-------------
3grkD           KWNEYNAPLRRTVTIDEVGDVGLYFLSDLSRSVTGEVHHADSGYHVIGM-------------
3grkA           KWNEYNAPLRRTVTIDEVGDVGLYFLSDLSRSVTGEVHHADSGYHVIGM-------------
3grkG           KWNEYNAPLRRTVTIDEVGDVGLYFLSDLSRSVTGEVHHADSGYHVIGM-------------
3k2eA           TWNKYNSPLRRNTTLDDVGGAALYLLSDLGRGTTGETVHVDCGYHVVGMKSV----------
3k2eB           TWNKYNSPLRRNTTLDDVGGAALYLLSDLGRGTTGETVHVDCGYHVVGMKSVDAPDI-----
2pd3A           KWNEINAPLRKNVSLEEVGNAGMYXXXXXXXGVSGEVHFVDAGYHVMGMGAVEEKD------
2qioA           REIEERAPLRRTTTQEEVGDTAVFLFSDLARGVTGENIHVDSGYHILG--------------
3ek2A           DFVESNSPLKRNVTIEQVGNAGAFLLSDLASGVTAEVMHVDSGFNAV---------------
3ek2C           DFVESNSPLKRNVTIEQVGNAGAFLLSDLASGVTAEVMHVDSGFNAV---------------
3ek2D           DFVESNSPLKRNVTIEQVGNAGAFLLSDLASGVTAEVMHVDSGFNAV---------------
3ek2B           DFVESNSPLKRNVTIEQVGNAGAFLLSDLASGVTAEVMHVDSGFNAV---------------
1qsgG           AHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNELE---------
1qsgA           AHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAM-------------
1qg6A           AHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAM-------------
2p91B           EHTTKVNPFGKPITIEDVGDTAVFLCSDWARAITGEVVHVDNGYHIMGV-------------
1c14A           AHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAM-------------
2p91A           EHTTKVNPFGKPITIEDVGDTAVFLCSDWARAITGEVVHVDNGYHIMGV-------------
2yw9B           DRVAQTAPLRRNITQEEVGNLGLFLLSPLASGITGEVVYVDAGYHIMG--------------
2fhsB           AHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAM-------------
2yw9C           -----TAPLRRNITQEEVGNLGLFLLSPLASGITGEVVYVDAGYHIMGME------------
2yw9F           ------APLRRNITQEEVGNLGLFLLSPLASGITGEVVYVDAGYHIMGM-------------
2yw9A           -----TAPLRRNITQEEVGNLGLFLLSPLASGITGEVVYVDAGYHIMG--------------
2yw9H           -----TAPLRRNITQEEVGNLGLFLLSPLASGITGEVVYVDAGYHIMG--------------
2yw9E           DRVAQTAPLRRNITQEEVGNLGLFLLSPLASGITGEVVYVDAGYHIMGM-------------
1lxcA           AHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAM-------------
2yw9D           DRVAQTAPLRRNITQEEVGNLGLFLLSPLASGITGEVVYVDAGYHIMG--------------
1i30A           AHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAM-------------
2p91D           --------FGKPITIEDVGDTAVFLCSDWARAITGEVVHVDNGYHIMGV-------------
1dfiA           AHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAM-------------
2p91C           -----------PITIEDVGDTAVFLCSDWARAITGEVVHVDNGYHIMGV-------------
1lx6A           AHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAM-------------
1uluB           KYDRQTAPLRRNITQEEVGNLGLFLLSPLASGITGEVVYVDAGYH-----------------
2jjyA           DYNAMVSPLKKNVDIMEVGNTVAFLCSDMATGITGEVVHVDAGYHCVSM-------------
2jjyD           DYNAMVSPLKKNVDIMEVGNTVAFLCSDMATGITGEVVHVDAGYHCVSM-------------
2jjyB           -------PLKKNVDIMEVGNTVAFLCSDMATGITGEVVHVDAGYHCVSM-------------
2jjyC           DYNAMVSPLKKNVDIMEVGNTVAFLCSDMATGITGEVVHVDAGYHCVSM-------------
1uluC           -----TAPLRRNITQEEVGNLGLFLLSPLASGITGEVVYVDAGYH-----------------
1uluA           KYDRQTAPLRRNITQEEVGNLGLFLLSPLASGITGEVVYVDAGYH-----------------
1uluD           ----QTAPLRRNITQEEVGNLGLFLLSPLASGITGEVVYVDAGYH-----------------
2o2sB           DYSYNNAPLRRDLHSDDVGGAALFLLSPLARAVSGVTLYVDNGLHAMG-QAVDS--------
2o2sA           DYSYNNAPLRRDLHSDDVGGAALFLLSPLARAVSGVTLYVDNGLHAMG-QAVDS--------
1enoA           EYSYNNAPIQKTLTADEVGNAAAFLVSPLASAITGATIYVDNGLNSMGV-ALDSP-------
1d7oA           EYSYNNAPIQKTLTADEVGNAAAFLVSPLASAITGATIYVDNGLNSMGV-ALDSP-------
1cwuA           EYSYNNAPIQKTLTADEVGNAAAFLVSPLASAITGATIYVDNGLNSMGV-ALDSP-------
2o50A           DYSYNNAPLRRDLHSDDVGGAALFLLSPLARAVSGVTLYVDNGLH-----------------
2o50B           DYSYNNAPLRRDLHSDDVGGAALFLLSPLARAVSGVTLYVDNGLH-----------------
3fnfB           GWNMKDA--------TPVAKTVCALLSDWLPATTGDIIYADGGAHT----------------
2b35D           GWNMKDA--------TPVAKTVCALLSDWLPATTGDIIYADGGAHT----------------
3fnfD           GWNMKDA--------TPVAKTVCALLSDWLPATTGDIIYADGGAHT----------------
2b35C           GWNMKDA--------TPVAKTVCALLSDWLPATTGDIIYADGGAHT----------------
3fnfC           GWNMKDA--------TPVAKTVCALLSDWLPATTGDIIYADGGAHT----------------
3fneB           GWNMKDA--------TPVAKTVCALLSDWLPATTGDIIYADGGAHT----------------
2nv6A           GWNMKDA--------TPVAKTVCALLSDWLPATTGDIIYADGGAHT----------------
3fneC           GWNMKDA--------TPVAKTVCALLSDWLPATTGDIIYADGGAHT----------------
2aqkA           GWNMKDA--------TPVAKTVCALLSDWLPATTGDIIYADGGAHT----------------
2h7iA           GWNMKDA--------TPVAKTVCALLSDWLPATTGDIIYADGGAHT----------------
1enyA           GWNMKDA--------TPVAKTVCALLSDWLPATTGDIIYADGGAHT----------------
2op0B           EYSEKYAPLRQKLLSTDIGSVASFLLSRESRAITGQTIYVDNG-------------------
2oosA           EYSEKYAPLRQKLLSTDIGSVASFLLSRESRAITGQTIYVDNG-------------------
2aqiA           GWNMKDA--------TPVAKTVCALLSDWLPATTGDIIYADGGAHT----------------
2aqhA           GWNMKDA--------TPVAKTVCALLSDWLPATTGDIIYADGGAHT----------------
2aq8A           GWNMKDA--------TPVAKTVCALLSDWLPATTGDIIYADGGAHT----------------
2b36B           EWDQ-RAPIGWNMDATPVAKTVCALLSDWLPATTGDIIYADGGAHT----------------
1uh5A           EYSEKYAPLRQKLLSTDIGSVASFLLSRESRAITGQTIYVDNG-------------------
2oosB           EYSEKYAPLRQKLLSTDIGSVASFLLSRESRAITGQTIYVDNG-------------------
2ol4B           EYSEKYAPLRQKLLSTDIGSVASFLLSRESRAITGQTIYVDNG-------------------
3fneD           GWNMKDA--------TPVAKTVCALLSDWLPATTGDIIYADGGAHT----------------
2b37B           GWNMKDA--------TPVAKTVCALLSDWLPATTGDIIYADGGAHT----------------
2b35F           GWNMKDA--------TPVAKTVCALLSDWLPATTGDIIYADGGAHT----------------
2b35B           GWNMKDA--------TPVAKTVCALLSDWLPATTGDIIYADGGAHT----------------
2b35A           GWNMKDA--------TPVAKTVCALLSDWLPATTGDIIYADGGAHT----------------
2b35E           GWNMKDA--------TPVAKTVCALLSDWLPATTGDIIYADGGAHT----------------
1vrwA           EYSEKYAPLRQKLLSTDIGSVASFLLSRESRAITGQTIYVDNG-------------------
2o2yD           EYSEKYAPLRQKLLSTDIGSVASFLLSRESRAITGQTIYVDNG-------------------
2b37C           EGWDQRAPIGWNMDATPVAKTVCALLSDWLPATTGDIIYADGGAHT----------------
1zxlA           EYSEKYAPLRQKLLSTDIGSVASFLLSRESRAITGQTIYVDNG-------------------
1zsnA           EYSEKYAPLRQKLLSTDIGSVASFLLSRESRAITGQTIYVDNG-------------------
2o2yC           EYSEKYAPLRQKLLSTDIGSVASFLLSRESRAITGQTIYVDNG-------------------
2o2yA           EYSEKYAPLRQKLLSTDIGSVASFLLSRESRAITGQTIYVDNG-------------------
2ol4A           EYSEKYAPLRQKLLSTDIGSVASFLLSRESRAITGQTIYVDNG-------------------
2ntvA           EWDQ-RAPIGWNMDPTPVAKTVCALLSEWLPATTGSIIYADGGAST----------------
1nhgA           --------------------------------------------------------------
2ptgA           ---------------DDVGRAALFLLSPLARAVTGATLYVDNGLHAM---------------
1vl8B           DYMLKRIPLGRTGVPEDLKGVAVFLASEEAKYVTGQIIFVDGGW------------------
1vl8A           DYMLKRIPLGRTGVPEDLKGVAVFLASEEAKYVTGQIIFVDGGW------------------
1fmcA           KMLQH-TPIRRLGQPQDIANAALFLCSPAASWVSGQILTVSGG-------------------
1ahhA           KMLQH-TPIRRLGQPQDIANAALFLCSPAASWVSGQILTVSGG-------------------
2nm0A           -----QVPLGRYARPEEIAATVRFLASDDASYITGAVIPVDGG-------------------
3gafF           K----HTPLGRLGEAQDIANAALFLCSPAAAWISGQVLTVSGG-------------------
3gafH           K----HTPLGRLGEAQDIANAALFLCSPAAAWISGQVLTVSGG-------------------
3gafA           K----HTPLGRLGEAQDIANAALFLCSPAAAWISGQVLTVSGG-------------------
3gafE           K----HTPLGRLGEAQDIANAALFLCSPAAAWISGQVLTVSGG-------------------
1i01E           A----QVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGG-------------------
3gafG           RAMLKHTPLGRLGEAQDIANAALFLCSPAAAWISGQVLTVSGG-------------------
3gafD           K----HTPLGRLGEAQDIANAALFLCSPAAAWISGQVLTVSGG-------------------
3gafC           RAMLKHTPLGRLGEAQDIANAALFLCSPAAAWISGQVLTVSGG-------------------
3gafB           K----HTPLGRLGEAQDIANAALFLCSPAAAWISGQVLTVSGG-------------------
1q7bA           A----QVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGGMYMV---------------
3cxrA           QFIIAKTPAARWGEAEDLMGPAVFLASDASNFVNGHILYVDGG-------------------
1q7cA           A----QVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGGMYMV---------------
1q7bB           A----QVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGGMYMV---------------
1hdcA           EGNYPNTPMGRVGEPGEIAGAVVKLLSDTSSYVTGAELAVDGGWTT----------------
1i01B           -------PAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGG-------------------
1i01G           A----QVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGG-------------------
1i01D           L---AQVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGG-------------------
3cxtA           K-----TPAARWGEAEDLMGPAVFLASDASNFVNGHILYVDGG-------------------
3i3oF           QFGS-NVPMQRPGQPYELAPAYVYLASSDSSYVTGQMIHVNGG-------------------
3i3oE           QFGS-NVPMQRPGQPYELAPAYVYLASSDSSYVTGQMIHVNGG-------------------
3i3oC           QFGS-NVPMQRPGQPYELAPAYVYLASSDSSYVTGQMIHVNGG-------------------
3i3oB           QFGS-NVPMQRPGQPYELAPAYVYLASSDSSYVTGQMIHVNGG-------------------
3i3oA           QFGS-NVPMQRPGQPYELAPAYVYLASSDSSYVTGQMIHVNGG-------------------
1cydA           KLKERH-PLRKFAEVEDVVNSILFLLSDRSASTSGGGILVDAGY------------------
1uzlA           QGALQFIPAKRVGTPAEVAGVVSFLASEDASYISGAVIPVDGG-------------------
1i01H           Q-----VPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGG-------------------
1i01F           A----QVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGG-------------------
1zemA           QQMIGSVPMRRYGDINEIPGVVAFLLGDDSSFMTG---------------------------
3ctmE           KWWQL-TPLGREGLTQELVGGYLYLASNASTFTTGSDVVIDGGY------------------
3i3oH           ---GSNVPMQRPGQPYELAPAYVYLASSDSSYVTGQMIHVNGG-------------------
1xkqB           KFYNFMASHKECIPIGAAGKNIILFLADLSFYILGQSIVADGG-------------------
1xkqA           KFYNFMASHKECIPIGAAGKNIILFLADLSFYILGQSIVADGG-------------------
1i01A           A----QVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGG-------------------
1ulsB           EKAIAATPLGRAGKPLEVAYAALFLLSDESSFITGQVLFVDGG-RTIG--------------
1ulsA           EKAIAATPLGRAGKPLEVAYAALFLLSDESSFITGQVLFVDGG-RTIG--------------
3ctmG           KWWQL-TPLGREGLTQELVGGYLYLASNASTFTTGSDVVIDGGY------------------
3ctmC           KWWQL-TPLGREGLTQELVGGYLYLASNASTFTTGSDVVIDGGY------------------
1uzlB           -------PAKRVGTPAEVAGVVSFLASEDASYISGAVIPVDGG-------------------
1pr9A           KTMLNRIPLGKFAEVEHVVNAILFLLSDRSGMTTGSTLPVEGGF------------------
1i01C           ---LAQVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGG-------------------
2p68A           QKYKEQIPLGRFGSPEEVANVVLFLCSELASYITGEVIHVNGG-------------------
3ctmA           KWWQL-TPLGREGLTQELVGGYLYLASNASTFTTGSDVVIDGGY------------------
1ulsC           EKAIAATPLGRAGKPLEVAYAALFLLSDESSFITGQVLFVDGG-RTIG--------------
1g0nB           QW----SPLRRVGLPIDIARVVCFLASNDGGWVTGKVIGIDGG-------------------
1w6uA           R-----IPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGG-------------------
2p68B           QKYKEQIPLGRFGSPEEVANVVLFLCSELASYITGEVIH-----------------------
3i3oG           -----NVPMQRPGQPYELAPAYVYLASSDSSYVTGQMIHVNGG-------------------
3ftpA           L--KTQIPLGRLGSPEDIAHAVAFLASPQAGYITGTTLHVNGG-------------------
2a4kA           EVGA--SPLGRAGRPEEVAQAALFLLSEESAYITGQALYVDGG-------------------
1uznA           QGALQFIPAKRVGTPAEVAGVVSFLASEDASYISGAVIPVDGG-------------------
3d3wA           KTMLNRIPLGKFAEVEHVVNAILFLLSDRSGMTTGSTLPVEGGF------------------
1ybvA           EVDEYAAPLRRVGLPIDIARVVCFLASNDGGWVTGKVIGIDGG-------------------
1w6uD           -----RIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGG-------------------
3ijrH           QFGS-NVP-QRPGQPYELAPAYVYLASSDSSYVTGQIH------------------------
3ijrF           QFGS-NVP-QRPGQPYELAPAYVYLASSDSSYVTGQIH------------------------
3ijrE           QFGS-NVP-QRPGQPYELAPAYVYLASSDSSYVTGQIH------------------------
3ijrB           QFGS-NVP-QRPGQPYELAPAYVYLASSDSSYVTGQIH------------------------
3ijrA           QFGS-NVP-QRPGQPYELAPAYVYLASSDSSYVTGQIH------------------------
1g0oC           EVDEYAAPLRRVGLPIDIARVVCFLASNDGGWVTGKVIGIDGG-------------------
1g0oA           EVDEYAAPLRRVGLPIDIARVVCFLASNDGGWVTGKVIGIDGG-------------------
1dohB           EVDEYAAPLRRVGLPIDIARVVCFLASNDGGWVTGKVIGIDGG-------------------
1dohA           EVDEYAAPLRRVGLPIDIARVVCFLASNDGGWVTGKVIGIDGG-------------------
1yxmC           -------PAKRIGVPEEVSSVVCFLLSPAASFITGQSVDVDGGLYTHSYEVPDAGDLSVVK-
1k2wA           RGEKKRVPFGRMGRAEDLTGMAIFLATPEADYIVAQTYNVDGG-------------------
1uznB           -------PAKRVGTPAEVAGVVSFLASEDASYISGAVIPVDGG-------------------
1uzmA           QGALQFIPAKRVGTPAEVAGVVSFLASEDASYISGAVIPVDGG-------------------
3ctmH           KWWQL-TPLGREGLTQELVGGYLYLASNASTFTTGSDVVIDGGY------------------
2bgkA           ELAHQAANLKGTLRAEDVADAVAYLAGDESKYVSGLNLVIDGGY------------------
1w6uC           KEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGG-------------------
2ntnA           -------PAKRVGTPAEVAGVVSFLASEDASYISGAVIPVDGG-------------------
2hq1A           YLN--NIPLKRFGTPEEVANVVGFLASDDSNYITGQVINIDGG-------------------
3ctmF           KWWQL-TPLGREGLTQELVGGYLYLASNASTFTTGSDVVIDGGY------------------
2ntnB           -------PAKRVGTPAEVAGVVSFLASEDASYISGAVIPVDGG-------------------
3ftpD           K---TQIPLGRLGSPEDIAHAVAFLASPQAGYITGTTLHVNGG-------------------
3ftpC           K---TQIPLGRLGSPEDIAHAVAFLASPQAGYITGTTLHVNGG-------------------
3ctmD           KWWQL-TPLGREGLTQELVGGYLYLASNASTFTTGSDVVIDGGY------------------
3ctmB           KWWQL-TPLGREGLTQELVGGYLYLASNASTFTTGSDVVIDGGY------------------
1xhlA           SRKEC-IPVGHCGKPEEIANIIVFLADNLSSYIIGQSIVADGGSTLVGMQTHD---------
1uzmB           -------PAKRVGTPAEVAGVVSFLASEDASYISGAVIPVDGG-------------------
3iccA           TISAFN----RLGEVEDIADTAAFLASPDSRWVTGQLIDVSGG-------------------
1yxmD           EGSFQKIPAKRIGVPEEVSSVVCFLLSPAASFITGQSVDVDGG-RSLYTHSYEVPD------
1w6uB           KEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGG-------------------
2d1yB           DWEDLHA-LRRLGKPEEVAEAVLFLASEKASFITGAILPVDGG-------------------
1spxA           --------------------------------------------------------------
1ja9A           --------------------------------------------------------------
2cfcA           DQVLARIPQKEIGTAAQVADAVMFLAGEDATYVNGAALVMDGAYTAI---------------
1x7gB           A----RVPIGRYVQPSEVAEMVAYLIGPGAAAVTAQALNVCGG-------------------
2d1yD           DWEDLHA-LRRLGKPEEVAEAVLFLASEKASFITGAILPVDGG-------------------
1yxmB           -------PAKRIGVPEEVSSVVCFLLSPAASFITGQSVDVDGGLYTHSYEVPDAGDLSVVK-
1o5iA           KQVESQIPMRRMAKPEEIASVVAFLCSEKASYLTGQTIVVDGG-------------------
1h5qA           DHQASNIPLNRFAQPEEMTGQAILLLSDHATYMTGGEYFIDGG-------------------
2d1yA           DWEDLHA-LRRLGKPEEVAEAVLFLASEKASFITGAILPVDGG-------------------
2d1yC           DWEDLHA-LRRLGKPEEVAEAVLFLASEKASFITGAILPVDGG-------------------
3emkB           -----NIPMKRMGVGADIAAAVVYLASDEAAYVTGQTLHVNGG-------------------
3ezlA           EKIVATIPVRRLGSPDEIGSIVAWLASEESGFSTGADFSLNGGLH-----------------
1xr3B           AFDRITAPIGRYVQPSEVAEMVAYLIGPGAAAVTAQALNVCGG-------------------
1nffA           --DIFQTALGRAAEPVEVSNLVVYLASDESSYSTGAEFVVDGG-------------------
1w4zB           AFDRITAPIGRYVQPSEVAEMVAYLIGPGAAAVTAQALNVCGG-------------------
3i4fD           TIQEARQLIGRSGTGEDIARTISFLCEDDSDMITGTIIEVTGAVDVI---------------
1yxmA           EGSFQKIPAKRIGVPEEVSSVVCFLLSPAASFITGQSVDVDGG-RSLYTHSYEVPD------
1w0cH           EGHRSKVPLQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGY------------------
2uvdA           DENIKAEMLKQFGEAQDIANAVTFFASDQSKYITGQTLNVDGG-------------------
2q2qE           AQHDLLAPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGGW------------------
3gvcA           ------ARLQRMAAPEEMAGIVVFLLSDDASMITGTTQIADGG-------------------
2q2vD           DLLAEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGGW------------------
2p8kB           VWEGHRSKVQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGY------------------
3i4fC           EATIQEARQLRSGTGEDIARTISFLCEDDSDMITGTIIEVTGAVDVI---------------
2bfpD           VGHRSKVPLQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGY------------------
1e92D           VGHRSKVPLQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGY------------------
3bmoA           KWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-------------------
2bfmC           VGHRSKVPLQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGY------------------
1w73A           ----GRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGG-------------------
1w0cC           VGHRSKVPLQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGY------------------
1w0cB           VWEGHRSKVQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGY------------------
2q2qA           AQHDLLAPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGGW------------------
3i4fA           EATIQEARQLRSGTGEDIARTISFLCEDDSDMITGTIIEVTGAVDVI---------------
2ag5C           RGNPEEARLKRQATAEEIAMLCVYLASDESAYVTGNPVIIDGGW------------------
2ag5B           RGNPEEARLKRQATAEEIAMLCVYLASDESAYVTGNPVIIDGGW------------------
2ag5A           RGNPEEARLKRQATAEEIAMLCVYLASDESAYVTGNPVIIDGGW------------------
2qhxC           EGHRSKVPLQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGY------------------
2q2qC           E----KQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGGW------------------
2p8kD           EGHRSKVPLQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGY------------------
1e92B           VWEGHRSKVQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGY------------------
2bf7C           VGHRSKVPLQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGY------------------
2ae2A           NLNKLRCALRRMGEPKELAAMVAFLCFPAASYVTGQIIYVDGG-------------------
2rhrB           DRITARVPIGRYVQPSEVAEMVAYLIGPGAAAVTAQALNVCGG-------------------
2qhxA           VWEGHRSKVQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGY------------------
1p33D           VQEDYKVPLQRNSSAEEVSDVVIFLCSPKAKYITGTCIKVDGGY------------------
1p33A           VQEDYKVPLQRNSSAEEVSDVVIFLCSPKAKYITGTCIKVDGGY------------------
1e7wA           VWEGHRSKVQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGY------------------
3csdB           DRITARVPIGRYVQPSEVAEMVAYLIGPGAAAVTAQALNVCGG-------------------
2bfaC           -------PLQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGY------------------
2bf7D           -------PLQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGY------------------
2bf7B           VWEGHRSKVQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGY------------------
2ae1A           D----RCALRRMGEPKELAAMVAFLCFPAASYVTGQIIYVDGG-------------------
2zatA           --------------------------------------------------------------
1x7hB           IWETARVPIGRYVQPSEVAEMVAYLIGPGAAAVTAQALNVCGG-------------------
1x7gA           IWETARVPIGRYVQPSEVAEMVAYLIGPGAAAVTAQALNVCGG-------------------
1w4zA           IWETARVPIGRYVQPSEVAEMVAYLIGPGAAAVTAQALNVCGG-------------------
2rhrA           IWETARVPIGRYVQPSEVAEMVAYLIGPGAAAVTAQALNVCGG-------------------
2rh4B           IWETARVPIGRYVQPSEVAEMVAYLIGPGAAAVTAQALNVCGG-------------------
2rh4A           IWETARVPIGRYVQPSEVAEMVAYLIGPGAAAVTAQALNVCGG-------------------
2q2vC           QHDAEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGGW------------------
2q2qH           ---AEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGGW------------------
2q2qG           QAQHEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGGW------------------
2p8kA           VWEGHRSKVQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGY------------------
1iy8A           PENPRKAPSKRYGEAPEIAAVVAFLLSDDASYVNATVVPIDGG-------------------
3gvcD           LQGRMAAP-------EEMAGIVVFLLSDDASMITGTTQIADGG-------------------
1ae1A           K-----TPMGRAGKPQEVSALIAFLCFPAASYITGQIIWADGGFTANG--------------
1ydeP           REGMLAQPLGRMGQPAEVGAAAVFLASE----------------------------------
1ydeM           REGMLAQPLGRMGQPAEVGAAAVFLASE----------------------------------
1ydeI           REGMLAQPLGRMGQPAEVGAAAVFLASE----------------------------------
1ydeH           REGMLAQPLGRMGQPAEVGAAAVFLASE----------------------------------
1ydeG           REGMLAQPLGRMGQPAEVGAAAVFLASE----------------------------------
1ydeF           REGMLAQPLGRMGQPAEVGAAAVFLASE----------------------------------
1ydeD           REGMLAQPLGRMGQPAEVGAAAVFLASE----------------------------------
1ydeA           REGMLAQPLGRMGQPAEVGAAAVFLASE----------------------------------
3edmD           --------------------------------------------------------------
3edmA           ---------------EDVAGLVAFLASDDAAYVTGACYDINGG-------------------
1e7wB           DWEGHRSKVQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGY------------------
2zk7B           EWG-HEHPMQRIGKPQEVASAVAFLASREASFITGTCLYVDGG-------------------
2qhxD           EGHRSKVPLQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGY------------------
2q2wC           QAQHEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGGW------------------
2q2qF           AEKQ---PSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGGW------------------
3grpA           KQKEAMIPMKRMGIGEEIAFATVYLASDEAAYLTGQTLHINGG-------------------
3edmB           ---------TREGSSEDVAGLVAFLASDDAAYVTGACYDINGG-------------------
2dteA           EWG-HEHPMQRIGKPQEVASAVAFLASREASFITGTCLYVDGG-------------------
2bfoA           VWEGHRSKVQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGY------------------
2bfmB           VWEGHRSKVQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGY------------------
1w0cA           VWEGHRSKVQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGY------------------
2q2vA           DLLAEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGGW------------------
3gvcC           ------ARLQRMAAPEEMAGIVVFLLSDDASMITGTTQIADGG-------------------
3gvcB           ------ARLQRMAAPEEMAGIVVFLLSDDASMITGTTQIADGG-------------------
3ennD           -----NIPMKRMGVGADIAAAVVYLASDEAAYVTGQTLHVNGG-------------------
3ennC           -----NIPMKRMGVGADIAAAVVYLASDEAAYVTGQTLHVNGG-------------------
2c07A           KNIISNIPAGRMGTPEEVANLACFLSSDKSGYINGRVFVIDGG-------------------
3bmfA           KWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-------------------
2bfaB           VWEGHRSKVQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGY------------------
1ydeN           REGMLAQPLGRMGQPAEVGAAAVFLASE----------------------------------
1ydeB           REGMLAQPLGRMGQPAEVGAAAVFLASE----------------------------------
1xg5A           KDPEKAAATYECLKPEDVAEAVIYVLSTPAHIQIGDIQMRPTG-------------------
2q2wD           DLLAEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGGW------------------
1p33C           VQEDYKVPLQRNSSAEEVSDVVIFLCSPKAKYITGTCIKVDGGY------------------
1p33B           VQEDYKVPLQRNSSAEEVSDVVIFLCSPKAKYITGTCIKVDGGY------------------
3bmdB           KWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-------------------
2bfpB           VWEGHRSKVQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGY------------------
2bfoC           DGHRSKVPLQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGY------------------
2bfaA           VWEGHRSKVQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGY------------------
2bf7A           VWEGHRSKVQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGY------------------
1w73D           -------PCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGG-------------------
1w73C           G----RIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGG-------------------
3grpB           -------PMKRMGIGEEIAFATVYLASDEAAYLTGQTLHINGG-------------------
3bmnD           KWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-------------------
3bmkC           KWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-------------------
2wd7C           KWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-------------------
2vz0A           KWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-------------------
2q2qB           LQAQHDQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGGW------------------
3imfB           ----QSVPLGRLGTPEEIAGLAYYLCSDEAAYINGTC--TDGGQH-----------------
2ewmB           --------------------------------------------------------------
2ewmA           --------------------------------------------------------------
3ennA           -----NIPMKRMGVGADIAAAVVYLASDEAAYVTGQTLHVNGG-------------------
2dknA           STRRFVAPLGRGSEPREVAEAIAFLLGPQASFIHGSVLFVDGG-------------------
3bmoC           KWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-------------------
3bmnC           KWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-------------------
2wd7B           KWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-------------------
2vz0B           KWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-------------------
2p8kC           EGHRSKVPLQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGY------------------
2ew8A           --------------------------------------------------------------
1e92C           VGHRSKVPLQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGY------------------
3bmoD           KWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-------------------
3bmiB           KWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-------------------
1ae1B           K-----TPMGRAGKPQEVSALIAFLCFPAASYITGQIIWADGGFTANG--------------
2a4kB           -WEQEASPLGRAGRPEEVAQAALFLLSEESAYITGQALYVDGG-------------------
3imfA           KRTIQSVPLGRLGTPEEIAGLAYYLCSDEAAYINGTC--TDGGQH-----------------
3emkD           -----NIPMKRMGVGADIAAAVVYLASDEAAYVTGQTLHVNGG-------------------
2c7vA           KWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-------------------
3bmqA           KWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-------------------
2bfaD           -------PLQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGY------------------
2q2wA           DLLAEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGGW------------------
2q2vB           DLLAEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGGW------------------
2gdzA           QYIEYKDHIK----------------------------------------------------
3bmfD           KWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-------------------
3bmeA           KWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-------------------
2ztuD           SEKQ---PSLQFVTPEQLGGTAVFLASDAAAQITGTTVSVDGGW------------------
1x1tA           -----KQPSLQFVTPEQLGGTAVFLASDAAAQITGTTVSVDGGW------------------
1x1eA           EPITARIPMGRWARPEEIARVAAVLCGDEAEYLTGQAVAVDGGF------------------
1w0cE           VWEGHRSKVQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGY------------------
2p8kG           EGHRSKVPLQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGY------------------
2ekpA           EPITARIPMGRWARPEEIARVAAVLCGDEAEYLTGQAVAVDGGF------------------
3bmoB           KWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-------------------
3bmnA           KWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-------------------
3bmfB           KWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-------------------
2b4qB           EADSASIPMGRWGRPEEMAALAISLAGTAGAYMTGNVIPIDGGFH-----------------
2b4qA           EADSASIPMGRWGRPEEMAALAISLAGTAGAYMTGNVIPIDGGFH-----------------
1w73B           -------PCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGG-------------------
1w0cF           VWEGHRSKVQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGY------------------
3imfC           KRTIQSVPLGRLGTPEEIAGLAYYLCSDEAAYINGTC--TDGGQH-----------------
3grpC           ------IPMKRMGIGEEIAFATVYLASDEAAYLTGQTLHINGG-------------------
1e92A           VWEGHRSKVQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGY------------------
2z1nB           -------PMGRVGKPEELASVVAFLASEKASFITGAVIPVDGGAH-----------------
2p8kH           --HRSKVPLQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGY------------------
2ew8B           --------------------------------------------------------------
2ztvC           ELLSEKQPSLQFVTPEQLGGTAVFLASDAAAQITGTTVSVDGGW------------------
2ztmD           SEKQ---PSLQFVTPEQLGGTAVFLASDAAAQITGTTVSVDGGW------------------
2ztuC           SEKQ---PSLQFVTPEQLGGTAVFLASDAAAQITGTTVSVDGGW------------------
2ztuB           ------QPSLQFVTPEQLGGTAVFLASDAAAQITGTTVSVDGGW------------------
2z1nA           -------PMGRVGKPEELASVVAFLASEKASFITGAVIPVDGGAH-----------------
1xg5C           AAATYEQ--MKCLKPEDVAEAVIYVLSTPAHIQIGDIQMRPTG-------------------
1w0cG           KVPLY----QRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGY------------------
3grpD           -------PMKRMGIGEEIAFATVYLASDEAAYLTGQTLHINGG-------------------
3gk3C           -----QIPVGRLGRPDEVAALIAFLCSDDAGFVTGADLAINGGMH-----------------
3gk3A           -------PVGRLGRPDEVAALIAFLCSDDAGFVTGADLAINGGMH-----------------
3emkA           -----NIPMKRMGVGADIAAAVVYLASDEAAYVTGQTLHVNGG-------------------
2ekqD           ---TARIPMGRWARPEEIARVAAVLCGDEAEYLTGQAVAVDGGF------------------
3edmC           --------------------------------------------------------------
3bmeC           KWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-------------------
2ztvB           SEKQ---PSLQFVTPEQLGGTAVFLASDAAAQITGTTVSVDGGW------------------
3gk3D           KILP-QIPVGRLGRPDEVAALIAFLCSDDAGFVTGADLAINGGMH-----------------
3gk3B           KILP-QIPVGRLGRPDEVAALIAFLCSDDAGFVTGADLAINGGMH-----------------
3ennB           -----NIPMKRMGVGADIAAAVVYLASDEAAYVTGQTLHVNGG-------------------
3emkC           -----NIPMKRMGVGADIAAAVVYLASDEAAYVTGQTLHVNGG-------------------
1xg5B           K----------CLKPEDVAEAVIYVLSTPAHIQIGDIQMRPTG-------------------
2japC           --------------------------------------------------------------
2japA           --------------------------------------------------------------
2ztuA           ------QPSLQFVTPEQLGGTAVFLASDAAAQITGTTVSVDGGW------------------
3bmqC           KWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-------------------
3bmnB           KWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-------------------
3bmfC           KWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-------------------
3bmeB           KWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-------------------
2ztmC           E----KQPSLQFVTPEQLGGTAVFLASDAAAQITGTTVSVDGGW------------------
2yz7A           ELLAEKQPSLQFVTPEQLGGAAVFLSSAAADQMTGTTLSLDGGW------------------
2c7vB           KWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-------------------
2ztvD           SEKQ---PSLQFVTPEQLGGTAVFLASDAAAQITGTTVSVDGGW------------------
2ztlA           ELLSEKQPSLQFVTPEQLGGTAVFLASDAAAQITGTTVSVDGGW------------------
2c7vD           KWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-------------------
2c7vC           KWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-------------------
3bmjD           KWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-------------------
1nhgC           EYSEKYAPLRQKLLSTDIGSVASFLLSRESRAITGQTIYVDNG-------------------
2ztmB           SEKQ---PSLQFVTPEQLGGTAVFLASDAAAQITGTTVSVDGGW------------------
2ztmA           ELLSEKQPSLQFVTPEQLGGTAVFLASDAAAQITGTTVSVDGGW------------------
3f9iA           -------PLGTYGIPEDVAYAVAFLASNNASYITGQTLHVNGG-------------------
2ph3A           EAYLKQIPAGRFGRPEEVAEAVAFLVSEKAGYITGQTLCVDGG-------------------
1nfrA           ----FQTALGRAAEPVEVSNLVVYLASDESSYSTGAEFVVDGG-------------------
3f9iB           KQREQKIPLGTYGIPEDVAYAVAFLASNNASYITGQTLHVNGG-------------------
3g1tA           --------------------------------------------------------------
1rwbA           --------------------------------------------------------------
2pd6B           KITEM-IPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGG-------------------
2zk7A           EWG-HEHPMQRIGKPQEVASAVAFLASREASFITGTCLYVDGG-------------------
1g6kA           --------------------------------------------------------------
1geeA           --------------------------------------------------------------
1gcoA           --------------------------------------------------------------
2vr2A           --------------------------------------------------------------