[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for atum0:ohr

[Show Plain Result]

#ERROR : Can't open dsspfile "1n2fA.bssp"
#ERROR : Can't open dsspfile "3i07B.bssp"
#ERROR : Can't open dsspfile "3i07A.bssp"
#ERROR : Can't open dsspfile "1zb9B.bssp"
#ERROR : Can't open dsspfile "1zb9A.bssp"
#ERROR : Can't open dsspfile "3eerA.bssp"
#ERROR : Can't open dsspfile "1uspA.bssp"
#ERROR : Can't open dsspfile "1uspB.bssp"
#ERROR : Can't open dsspfile "2bjoA.bssp"
#ERROR : Can't open dsspfile "1nyeF.bssp"
#ERROR : Can't open dsspfile "1nyeE.bssp"
#ERROR : Can't open dsspfile "1nyeD.bssp"
#ERROR : Can't open dsspfile "1nyeC.bssp"
#ERROR : Can't open dsspfile "1nyeA.bssp"
#ERROR : Can't open dsspfile "1qwiA.bssp"
#ERROR : Can't open dsspfile "2ql8B.bssp"
#ERROR : Can't open dsspfile "2ql8A.bssp"

## Summary of PDB Search
:140
    2e-31  52%  1n2fA  [d.227.1] ORGANIC HYDROPEROXIDE RESISTANCE PROTEIN
    2e-31  53%  3i07B  [x.x.x] ORGANIC HYDROPEROXIDE RESISTANCE PROTEIN
    2e-31  53%  3i07A  [x.x.x] ORGANIC HYDROPEROXIDE RESISTANCE PROTEIN
    7e-30  52%  1zb9B  [x.x.x] ORGANIC HYDROPEROXIDE RESISTANCE PROTEIN
    7e-30  52%  1zb9A  [x.x.x] ORGANIC HYDROPEROXIDE RESISTANCE PROTEIN
    2e-29  53%  3eerA  [x.x.x] ORGANIC HYDROPEROXIDE RESISTANCE PROTEIN,
    2e-28  54%  1uspA  [d.227.1] ORGANIC HYDROPEROXIDE RESISTANCE PROTEIN
    3e-27  55%  1uspB  [d.227.1] ORGANIC HYDROPEROXIDE RESISTANCE PROTEIN
    6e-23  43%  2bjoA  [x.x.x] ORGANIC HYDROPEROXIDE RESISTANCE PROTEIN OHRB
    9e-09  31%  1nyeF  [d.227.1] OSMOTICALLY INDUCIBLE PROTEIN C
    2e-08  31%  1nyeE  [d.227.1] OSMOTICALLY INDUCIBLE PROTEIN C
    2e-08  31%  1nyeD  [d.227.1] OSMOTICALLY INDUCIBLE PROTEIN C
    2e-08  31%  1nyeC  [d.227.1] OSMOTICALLY INDUCIBLE PROTEIN C
    2e-08  31%  1nyeA  [d.227.1] OSMOTICALLY INDUCIBLE PROTEIN C
    6e-07  33%  1qwiA  [d.227.1] OSMOTICALLY INDUCIBLE PROTEIN
    4e-04  32%  2ql8B  [x.x.x] PUTATIVE REDOX PROTEIN
    4e-04  32%  2ql8A  [x.x.x] PUTATIVE REDOX PROTEIN
:140

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MPILYTTKASATGGRAGNAKSEDGVLDVTLTVPKELGGDGARGTNPEQLFAAGYSACFLGALKAVAGKHK
1n2fA           --------------------SSDGVLDVKLSTPREMGGQGGAATNPEQLFAAGYSACFIGAMKFVAGQRK
3i07B           MSTIYQTSATASAGRNGVVSTEDKLLELNLSYPKEMGGSGT-ATNPEQLFAVGYAACFSNAILHVAREAK
3i07A           MSTIYQTSATASAGRNGVVSTEDKLLELNLSYPKEMGGSGT-ATNPEQLFAVGYAACFSNAILHVAREAK
1zb9B           --VLYTAIVTATGGRDGSVVSSDNVLNVKLSVPQXXXXXXXXXTNPEQLFAAGYSA-FIGALKFVANKEK
1zb9A           --VLYTAIVTATGGRDGSVVSSDNVLNVKLSVPQXXXXXXXXXTNPEQLFAAGYSA-FIGALKFVANKEK
3eerA           ---IYQTSATASAGRNGVVSTEDKLLELNLSYPKE-GGSGT-ATNPEQLFAVGYAACFSNAILHVAREAK
1uspA           --------------------SSDDRLNLDLSVPAE-GGDGGPGTNPEQLFAAGYAACFQGALGVVSRRQK
1uspB           --------------------SSDDRLNLDLSVPAE-GGDGGPGTNPEQLFAAGYAACFQGALGVVSRRNK
2bjoA           ---LFTAKVTARGGRAGHITSDDGVLDFDIVMPNAAAA-GQTGTNPEQLXXXXXXXXXXXXLEHVAKEQN
1nyeF           ----------------GTVSTESGVLN-----QQPYGFNTRKGTNPEELIGAAHAACFSMALSLMLGEAG
1nyeE           --------------------------------------EGEKGTNPEELIGAAHAACFSMALSLMLGEAG
1nyeD           --------------------------------------EGEKGTNPEELIGAAHAACFSMALSLMLGEAG
1nyeC           --------------------------------------EGEKGTNPEELIGAAHAACFSMALSLMLGEAG
1nyeA           --------------------------------------EGEKGTNPEELIGAAHAACFSMALSLMLGEAG
1qwiA           --------------------------------------EGEKGTNPEELIGAAHAACFSASLLGEAGF--
2ql8B           ---LYTTTAINDEELEGHAYIPGG-LKVQTSSPND-----HPGTNPEQLLGLSLSTCLEATLEAVEKEH-
2ql8A           ---LYTTTAINDEELEGHAYIPGG-LKVQTSSPND-----HPGTNPEQLLGLSLSTCLEATLEAVEKEH-


                         .         .         *         .         .         .         .:140
query           VKIPEDTTVTATVGIGPREDGTGFGIEVTLKVNIPGLEREKAEELVAAAHIVCPYSHAMRTSTEVPVSVA
1n2fA           QTLPADASITGKVGIG--QIPGGFGLEVELHINLPGMXXXXXXXXXXXXHQVCPYSNATRGNIDVRLNVS
3i07B           VALKE-APVTATVGIGPNGQG-GFALSVALAAHI-ALEDEQARQLVTVAHQVCPYSNAVRGNIDVQVSV-
3i07A           VALKE-APVTATVGIGPNGQG-GFALSVALAAHI-ALEDEQARQLVTVAHQVCPYSNAVRGNIDVQVSV-
1zb9B           VDLPAEPRVEGRVGIG--EIPGGFGLVVELRIAVSGMERSMLQTLVDKAHRVCPYSNATRGNIDV-----
1zb9A           VDLPAEPRVEGRVGIG--EIPGGFGLVVELRIAVSGMERSMLQTLVDKAHRVCPYSNATRGNIDV-----
3eerA           VALKE-APVTATVGIGPNGQG-GFALSVALAAHI-ALEDEQARQLVTVAHQVCPYSNAVRGNIDVQVSV-
1uspA           IDVPADSTITARVGL--QKAGLAFALDVELEGHFPGLSREQAEGL-HAAHEVCPYSAATRNNVDVRLKV-
1uspB           IDVPADSTITARVGL------QKFALDVELEGHFPGLSREQAEGL-HAAHEVCPYSAATRNNVDVRLKV-
2bjoA           IEI--DSEIEGQVSLMKDESDGGFKIGVTLVVNTKDLDREKAQELVNAAHEFCPYSKATRGNVDVKLEL-
1nyeF           F---TPTSIDTTADVSLDKVDAGFAIKIALKVAVPGIDASTFDGIIQKAKAGCPVSQVLK----------
1nyeE           F---TPTSIDTTADVSLDKVDAGFAIKIALKVAVPGIDASTFDGIIQKAKAGCPVSQVLK----------
1nyeD           F---TPTSIDTTADVSLDKVDAGFAIKIALKVAVPGIDASTFDGIIQKAKAGCPVSQVLK----------
1nyeC           F---TPTSIDTTADVSLDKVDAGFAIKIALKVAVPGIDASTFDGIIQKAKAGCPVSQVLK----------
1nyeA           F---TPTSIDTTADVSLDKVDAGFAIKIALKVAVPGIDASTFDGIIQKAKAGCPVSQVLK----------
1qwiA           ----TPTSIDTTADVSLDKVDAGFAIKIALKVAVPGIDASTFDGIIQKAKAGCPVSQVLK----------
2ql8B           -GLPHTGAVRVKVAIGARAE---YQFLVHAQV-VKGVDFDTAKAFTNEIENRCPVSKLLKNS--------
2ql8A           -GLPHTGAVRVKVAIGARAE---YQFLVHAQV-VKGVDFDTAKAFTNEIENRCPVSKLLKNS--------