[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for atum0:AAK86734.2

[Show Plain Result]

#ERROR : Can't open dsspfile "2zm0A.bssp"
#ERROR : Can't open dsspfile "1wycA.bssp"
#ERROR : Can't open dsspfile "2e8iA.bssp"
#ERROR : Can't open dsspfile "2zmaA.bssp"
#ERROR : Can't open dsspfile "2dcfA.bssp"
#ERROR : Can't open dsspfile "2zm8A.bssp"
#ERROR : Can't open dsspfile "2zm7A.bssp"
#ERROR : Can't open dsspfile "2zm2A.bssp"
#ERROR : Can't open dsspfile "2zm9A.bssp"
#ERROR : Can't open dsspfile "2zlyA.bssp"
#ERROR : Can't open dsspfile "1wybA.bssp"
#ERROR : Can't open dsspfile "1ikgA.bssp"
#ERROR : Can't open dsspfile "1hvbA.bssp"
#ERROR : Can't open dsspfile "1cegA.bssp"
#ERROR : Can't open dsspfile "2zc7A.bssp"
#ERROR : Can't open dsspfile "1ci9A.bssp"
#ERROR : Can't open dsspfile "1xx2A.bssp"
#ERROR : Can't open dsspfile "1q2qA.bssp"
#ERROR : Can't open dsspfile "1gceA.bssp"
#ERROR : Can't open dsspfile "1ga0A.bssp"
#ERROR : Can't open dsspfile "1y54A.bssp"
#ERROR : Can't open dsspfile "1s6rA.bssp"

## Summary of PDB Search
:435
    1e-52  35%  2zm0A  [x.x.x] 6-AMINOHEXANOATE-DIMER HYDROLASE
    1e-52  35%  1wycA  [x.x.x] 6-AMINOHEXANOATE-DIMER HYDROLASE
    2e-52  35%  2e8iA  [x.x.x] 6-AMINOHEXANOATE-DIMER HYDROLASE
    3e-52  35%  2zmaA  [x.x.x] 6-AMINOHEXANOATE-DIMER HYDROLASE
    3e-52  35%  2dcfA  [x.x.x] 6-AMINOHEXANOATE-DIMER HYDROLASE
    5e-52  35%  2zm8A  [x.x.x] 6-AMINOHEXANOATE-DIMER HYDROLASE
    5e-52  35%  2zm7A  [x.x.x] 6-AMINOHEXANOATE-DIMER HYDROLASE
    6e-50  35%  2zm2A  [x.x.x] 6-AMINOHEXANOATE-DIMER HYDROLASE
    1e-49  34%  2zm9A  [x.x.x] 6-AMINOHEXANOATE-DIMER HYDROLASE
    3e-49  35%  2zlyA  [x.x.x] 6-AMINOHEXANOATE-DIMER HYDROLASE
    1e-47  34%  1wybA  [x.x.x] 6-AMINOHEXANOATE-DIMER HYDROLASE
    5e-08  36%  1ikgA  [e.3.1] D-ALANYL-D-ALANINE CARBOXYPEPTIDASE
    5e-08  36%  1hvbA  [e.3.1] D-ALANYL-D-ALANINE CARBOXYPEPTIDASE
    5e-08  36%  1cegA  [x.x.x] D-ALANYL-D-ALANINE CARBOXYPEPTIDASE
    6e-05  27%  2zc7A  [x.x.x] BETA-LACTAMASE ACT-1
    2e-04  30%  1ci9A  [e.3.1] PROTEIN (CARBOXYLESTERASE)
    7e-04  25%  1xx2A  [e.3.1] BETA-LACTAMASE
    7e-04  25%  1q2qA  [e.3.1] CLASS C BETA-LACTAMASE
    7e-04  25%  1gceA  [e.3.1] BETA-LACTAMASE
    7e-04  25%  1ga0A  [e.3.1] BETA-LACTAMASE
    0.001  25%  1y54A  [x.x.x] BETA-LACTAMASE
    0.001  25%  1s6rA  [e.3.1] BETA-LACTAMASE
:435

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPKSRWTVCHFRQL
2zm0A           ---------------------------------------------------------PHNRWAFAHLGEM
1wycA           ---------------------------------------------------------PHNRWAFAHLGEM
2e8iA           ---------------------------------------------------------PHNRWAFAHLGEM
2zmaA           ---------------------------------------------------------PHNRWAFAHLGEM
2dcfA           ---------------------------------------------------------PHNRWAFAHLGEM
2zm8A           ---------------------------------------------------------PHNRWAFAHLGEM
2zm7A           ---------------------------------------------------------PHNRWAFAHLGEM
2zm2A           ---------------------------------------------------------PHNRWAFAHLGEM
2zm9A           ---------------------------------------------------------PHNRWAFAHLGEM
2zlyA           ---------------------------------------------------------PHNRWAFAHLGEM
1wybA           ---------------------------------------------------------PHNRWAFAHLGEM
1ikgA           ----------------------------------------------------------------------
1hvbA           ----------------------------------------------------------------------
1cegA           ----------------------------------------------------------------------
2zc7A           ----------------------------------------------------------------------
1ci9A           ----------------------------------------------------------------------
1xx2A           ----------------------------------------------------------------------
1q2qA           ----------------------------------------------------------------------
1gceA           ----------------------------------------------------------------------
1ga0A           ----------------------------------------------------------------------
1y54A           ----------------------------------------------------------------------
1s6rA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           MPTVNVSRGLGAPAALERKLDPAMDAVTFRPTGADQDMTWLQSLSANYTDGIVVLHKGVLVYERYSGCLN
2zm0A           VPSAAVSRRPGHALA-------RLGAIAAQLPDLEQ------RLEQTYTDAFLVLRGTEVVAEYYRAGFA
1wycA           VPSAAVSRRPGHALA-------RLGAIAAQLPDLEQ------RLEQTYTDAFLVLRGTEVVAEYYRAGFA
2e8iA           VPSAAVSRRPGHALA-------RLGAIAAQLPDLEQ------RLEQTYTDAFLVLRGTEVVAEYYRAGFA
2zmaA           VPSAAVSRRPGHALA-------RLGAIAAQLPDLEQ------RLEQTYTDAFLVLRGTEVVAEYYRAGFA
2dcfA           VPSAAVSRRPGHALA-------RLGAIAAQLPDLEQ------RLEQTYTDAFLVLRGTEVVAEYYRAGFA
2zm8A           VPSAAVSRRPGHALA-------RLGAIAAQLPDLEQ------RLEQTYTDAFLVLRGTEVVAEYYRAGFA
2zm7A           VPSAAVSRRPGHALA-------RLGAIAAQLPDLEQ------RLEQTYTDAFLVLRGTEVVAEYYRAGFA
2zm2A           VPSAAVSRRPGH--ALVR-----LGAIAAQLPDLEQ------RLEQTYTDAFLVLRGTEVVAEYYRAGFA
2zm9A           VPSAAVSRRPGH--ALVR-----LGAIAAQLPDLEQ------RLEQTYTDAFLVLRGTEVVAEYYRAGFA
2zlyA           VPSAAVSRRPGHALA-------RLGAIAAQLPDLEQ------RLEQTYTDAFLVLRGTEVVAEYYRAGFA
1wybA           VPSAAVSRRPGHALA-------RLGAIAAQLPDLEQ------RLEQTYTDAFLVLRGTEVVAEYYRAGFA
1ikgA           ----------------------------------------------------------------------
1hvbA           ----------------------------------------------------------------------
1cegA           ----------------------------------------------------------------------
2zc7A           ----------------------------------------------------------------------
1ci9A           ----------------------------------------------------IVARHGEILYRRAQGLAD
1xx2A           ----------------------------------------------------------------------
1q2qA           ----------------------------------------------------------------------
1gceA           ----------------------------------------------------------------------
1ga0A           ----------------------------------------------------------------------
1y54A           ----------------------------------------------------------------------
1s6rA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           EAGQHGAMSVTKSLTGLLGEMLVAEGTLDENAKVATVVPELEKSAFGDATIRQVLDMTTGLRYSEDYADP
2zm0A           PDDRHLLMSVSKSLCGTVVGALVDEGRIDPAQPVTEYVPELAGSVYDGPSVLQVLDMQISIDYNEDYVDP
1wycA           PDDRHLLMSVSKSLCGTVVGALVDEGRIDPAQPVTEYVPELAGSVYDGPSVLQVLDMQISIDYNEDYVDP
2e8iA           PDDRHLLMSVSKSLCGTVVGALVDEGRIDPAQPVTEYVPELAGSVYDGPSVLQVLDMQISIDYNEDYVDP
2zmaA           PDDRHLLMAVSKSLCGTVVGALVDEGRIDPAQPVTEYVPELAGSVYDGPSVLQVLDMQISIDYNEDYVDP
2dcfA           PDDRHLLMAVSKSLCGTVVGALVDEGRIDPAQPVTEYVPELAGSVYDGPSVLQVLDMQISIDYNEDYVDP
2zm8A           PDDRHLLMAVSKSLCGTVVGALVDEGRIDPAQPVTEYVPELAGSVYDGPSVLQVLDMQISIDYNEDYVDP
2zm7A           PDDRHLLMAVSKSLCGTVVGALVDEGRIDPAQPVTEYVPELAGSVYDGPSVLQVLDMQISIDYNEDYVDP
2zm2A           PDDRHLLMSVSKSLCGTVVGVLVDEGRIDPAQPVTEYVPELAGSVYDGPSVLQVLDMQISIDYNEDYVDP
2zm9A           PDDRHLLMAVSKSLCGTVVGVLVDEGRIDPAQPVTEYVPELAGSVYDGPSVLQVLDMQISIDYNEDYVDP
2zlyA           PDDRHLLMSVSKSLCGTVVGALVDEGRIDPAQPVTEYVPELAGSVYDGPSVLQVLDMQISIDYNED---P
1wybA           PDDRHLLMSVSKSLCGTVVGALVDEGRIDPAQPVTEYVPELAGSVYDGPSVLQVLDMQISIDYNE-----
1ikgA           --------SVTKSFSAVVLLQLVDEGKLDLDASVNTYLPGLLPD--DRITVRQVMSHRSGLY---DYTN-
1hvbA           --------SVTKSFSAVVLLQLVDEGKLDLDASVNTYLPGLLPD--DRITVRQVMSHRSGLY---DYTN-
1cegA           --------SVTKSFSAVVLLQLVDEGKLDLDASVNTYLPGLLPD--DRITVRQVMSHRSGLY---DYTN-
2zc7A           --------SISKTFTGVLGGDAIARGEISLGDPVTKYWPELTGKQWQGI---RMLDLAT-----------
1ci9A           EAGRFRLASVTKPIVALAVLRLVARGELALDAPVTRWLPEFRRLADGSVTIHHLLTHTSGLGY-------
1xx2A           --------SISKTFTGVLGGDAIARGEISLDDAVTRYWPQLTGKQWQGI---RMLDLAT-----------
1q2qA           --------SISKTFTGVLGGDAIARGEISLDDPVTRYWPQLTGKQWQGI---RMLDLAT-----------
1gceA           --------SISKTFTGVLGGDAIARGEISLDDPVTRYWPQLTGKQWQGI---RMLDLAT-----------
1ga0A           --------SISKTFTGVLGGDAIARGEISLDDPVTRYWPQLTGKQWQGI---RMLDLAT-----------
1y54A           --------SISKTFTGVLGGDAIARGEISLDDPVTRYWPQLTGKQWQGI---RMLDLAT-----------
1s6rA           --------SISKTFTGVLGGDAIARGEISLDDPVTRYWPQLTGKQWQGI---RMLDLAT-----------


                         .         .         .         +         .         .         .:280
query           NADVWIYSAAGNPLPKPDGYEGPRSYFDYLKTVVKQGENGSAFGYKTINSDALGWVIARASGKSVAELLS
2zm0A           ASEVQTHDRSAGWRTRRHG--DPADTYEFLTTLRGDGSTGE-FQYCSANTDVLAWIVERVTGLRYVEALS
1wycA           ASEVQTHDRSAGWRTRRHG--DPADTYEFLTTLRGDGSTGE-FQYCSANTDVLAWIVERVTGLRYVEALS
2e8iA           ASEVQTHDRSAGWRTRRHG--DPADTYEFLTTLRGDGSTGE-FQYCSANTDVLAWIVERVTGLRYVEALS
2zmaA           ASEVQTHDRSAGWRTRRHG--DPADTYEFLTTLRGDGSTGE-FQYCSANTDVLAWIVERVTGLRYVEALS
2dcfA           ASEVQTHDRSAGWRTRRHG--DPADTYEFLTTLRGDGSTGE-FQYCSANTDVLAWIVERVTGLRYVEALS
2zm8A           ASEVQTHGRSAGWRTRRHG--DPADTYEFLTTLRGDGSTGE-FQYCSANTDVLAWIVERVTGLRYVEALS
2zm7A           ASEVQTHDRSAGWRTRRHG--DPADTYEFLTTLRGDGSTGE-FQYCSANTDVLAWIVERVTGLRYVEALS
2zm2A           ASEVQTHGRSAGWSTRRHG--DPADTYEFLTTLRGDGSTGE-FQYCSANTDVLAWIVERVTGLRYVEALS
2zm9A           ASEVQTHGRSAGWSTRRHG--DPADTYEFLTTLRGDGSTGE-FQYCSANTDVLAWIVERVTGLRYVEALS
2zlyA           ASEVQTHGRSAGWRTRRHG--DPADTYEFLTTLRGDGSTGE-FQYCSANTDVLAWIVERVTGLRYVEALS
1wybA           -SEVQTHGRSAGWRTRRHG--DPADTYEFLTTLRGDGSTGE-FQYCSANTDVLAWIVERVTGLRYVEALS
1ikgA           --DMFAQTVPG--------FESVRSYQDLITLSLKHGVTGAAYSYSNTNFVVAGMLIEKLTGHSVATEYQ
1hvbA           --DMFAQTVPG--------FESVRSYQDLITLSLKHGVTGAAYSYSNTNFVVAGMLIEKLTGHSVATEYQ
1cegA           --DMFAQTVPG--------FESVRSYQDLITLSLKHGVTGAAYSYSNTNFVVAGMLIEKLTGHSVATEYQ
2zc7A           ------YTAGGLPLQVPDEVKDNASLLRFYQNWQPQWKPGTTRLYANASIGLFGALAVKPSGMSYEQAIT
1ci9A           ----WLLEGAGSVYDRSDGIDLRDFDLDRLASAPLSFAPGSGWQY-SLALDVLGAVVERATGQPLAAAVD
1xx2A           ------YTAGGLPLQVPDEVTDNASLLRFYQNWQPQWKPGTTRLYANASIGLFGALAVKPSGMPYEQAMT
1q2qA           ------YTAGGLPLQVPDEVTDNASLLRFYQNWQPQWKPGTTRLYANASIGLFGALAVKPSGMPYEQAMT
1gceA           ------YTAGGLPLQVPDEVTDNASLLRFYQNWQPQWKPGTTRLYANASIGLFGALAVKPSGMPYEQAMT
1ga0A           ------YTAGGLPLQVPDEVTDNASLLRFYQNWQPQWKPGTTRLYANASIGLFGALAVKPSGMPYEQAMT
1y54A           ------YTAGGLPLQVPDEVTDNASLVRFYQNWQPQWKPGTTRLYANASIGLFGALAVKPSGMPYEQAMT
1s6rA           ------YTAGGLPLQVPDEVTDNASLVRFYQNWQPQWKPGTTRLYANASIGLFGALAVKPSGMPYEQAMT


                         .         *         .         .         .         .         +:350
query           QRIWSRIGAEQDAYYTVDSTGTPFAGGGLNAGLRDMARIGQLLLDDGMAGGHRLIPQKAIDNIRHGGDKA
2zm0A           TYLWAKLDADRDATITVDTTGFGFANGGVSCTARDLARVGRMMLDGGVAPGGRVVSEDWVRRVLAGGSHE
1wycA           TYLWAKLDADRDATITVDTTGFGFANGGVSCTARDLARVGRMMLDGGVAPGGRVVSEDWVRRVLAGGSHE
2e8iA           TYLWAKLDADRDATITVDTTGFGFAHGGVSCTARDLARVGRMMLDGGVAPGGRVVSEDWVRRVLAGGSHE
2zmaA           TYLWAKLDADRDATITVDTTGFGFANGGVSCTARDLARVGRMMLDGGVAPGGRVVSEDWVRRVLAGGSHE
2dcfA           TYLWAKLDADRDATITVDTTGFGFANGGVSCTARDLARVGRMMLDGGVAPGGRVVSEDWVRRVLAGGSHE
2zm8A           TYLWAKLDADRDATITVDTTGFGFAHGGVSCTARDLARVGRMMLDGGVAPGGRVVSEDWVRRVLAGGSHE
2zm7A           TYLWAKLDADRDATITVDTTGFGFAHGGVSCTARDLARVGRMMLDGGVAPGGRVVSEDWVRRVLAGGSHE
2zm2A           TYLWAKLDADRDATITVDTTGFGCAHGGVSCTARDLARVGRMMLDGGVAPRGRVVSEDWVRRVLAGGSHE
2zm9A           TYLWAKLDADRDATITVDTTGFGCAHGGVSCTARDLARVGRMMLDGGVAPRGRVVSEDWVRRVLAGGSHE
2zlyA           TYLWAKLDADRDATITVDTTGFGFAHGGVSCTARDLARVGRMMLDGGVAPGGRVVSEDWVRRVLAGGSHE
1wybA           TYLWAKLDADRDATITVDTTGFGFAHGGVSCTARDLARVGRMMLDGGVAPGGRVVSEDWVRRVLAGGSHE
1ikgA           NRIFTPLNL-TDTFYVHPDTVIP-----------------------------------------------
1hvbA           NRIFTPLNL-TDTFYVHPDTVIP-----------------------------------------------
1cegA           NRIFTPLNL-TDTFYVHPDTVIP-----------------------------------------------
2zc7A           TRVWINVPKAEEAHY-------------------------------------------------------
1ci9A           ALVAQPLGMRDCGFVSAE----------------------------------------------------
1xx2A           TRVWINVPKAEEAHY-------------------------------------------------------
1q2qA           TRVWINVPKAEEAHY-------------------------------------------------------
1gceA           TRVWINVPKAEEAHY-------------------------------------------------------
1ga0A           TRVWINVPKAEEAHY-------------------------------------------------------
1y54A           TRVWINVPKAEEAHY-------------------------------------------------------
1s6rA           TRVWINVPKAEEAHY-------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           AFAKGGYPALRGWSYRAMWWVTHNANGAFMARGVHGQAIYVDPAADMVIARFSSHPxxxxxxxxxxxxxx
2zm0A           AMTDKGFTTFPDGSYTRQWWCTGNERGNVSGIGIHGQNLWLDPLTDSVIVKLSSWP--------------
1wycA           AMTDKGFTTFPDGSYTRQWWCTGNERGNVSGIGIHGQNLWLDPLTDSVIVKLSSWP--------------
2e8iA           AMTDKGFTTFPDGSYTRQWWCTGNERGNVSGIGIHGQNLWLDPLTDSVIVKLSSWP--------------
2zmaA           AMTDKGFTTFPDGSYTRQWWCTGNERGNVSGIGIHGQNLWLDPLTDSVIVKLSSWP--------------
2dcfA           AMTDKGFTTFPDGSYTRQWWCTGNERGNVSGIGIHGQNLWLDPLTDSVIVKLSSWP--------------
2zm8A           AMTDKGFTTFPDGSYTRQWWCTGNERGNVSGIGIHGQNLWLDPLTDSVIVKLSSWP--------------
2zm7A           AMTDKGFTTFPDGSYTRQWWCTGNERGNVSGIGIHGQNLWLDPLTDSVIVKLSSWP--------------
2zm2A           AMTDKGFTTFPDGSYTRQWWCTGNERANVSGIGIHGQNLWLDPLTDSVIVKLSSWP--------------
2zm9A           AMTDKGFTTFPDGSYTRQWWCTGNERANVSGIGIHGQNLWLDPLTDSVIVKLSSWP--------------
2zlyA           AMTDKGFTTFPDGSYTRQWWCTGNERGNVSGIGIHGQNLWLDPLTDSVIVKLSSWP--------------
1wybA           AMTDKGFTTFPDGSYTRQWWCTGNERGNVSGIGIHGQNLWLDPLTDSVIVKLSSWP--------------
1ikgA           ----------------------------------------------------------------------
1hvbA           ----------------------------------------------------------------------
1cegA           ----------------------------------------------------------------------
2zc7A           ----------------------------------------------------------------------
1ci9A           ----------------------------------------------------------------------
1xx2A           ----------------------------------------------------------------------
1q2qA           ----------------------------------------------------------------------
1gceA           ----------------------------------------------------------------------
1ga0A           ----------------------------------------------------------------------
1y54A           ----------------------------------------------------------------------
1s6rA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxx
2zm0A           ---------------
1wycA           ---------------
2e8iA           ---------------
2zmaA           ---------------
2dcfA           ---------------
2zm8A           ---------------
2zm7A           ---------------
2zm2A           ---------------
2zm9A           ---------------
2zlyA           ---------------
1wybA           ---------------
1ikgA           ---------------
1hvbA           ---------------
1cegA           ---------------
2zc7A           ---------------
1ci9A           ---------------
1xx2A           ---------------
1q2qA           ---------------
1gceA           ---------------
1ga0A           ---------------
1y54A           ---------------
1s6rA           ---------------