[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for atum0:AAK86736.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3dwkC.bssp"
#ERROR : Can't open dsspfile "3dwkB.bssp"
#ERROR : Can't open dsspfile "3fwmA.bssp"
#ERROR : Can't open dsspfile "3dwkD.bssp"
#ERROR : Can't open dsspfile "3dwkA.bssp"
#ERROR : Can't open dsspfile "2olvB.bssp"
#ERROR : Can't open dsspfile "2olvA.bssp"
#ERROR : Can't open dsspfile "2oqoA.bssp"
#ERROR : Can't open dsspfile "3fwlA.bssp"
#ERROR : Can't open dsspfile "3d3hA.bssp"
#ERROR : Can't open dsspfile "2oluA.bssp"
#ERROR : Can't open dsspfile "3hzsA.bssp"
#ERROR : Can't open dsspfile "2bg4B.bssp"
#ERROR : Can't open dsspfile "2uwxA.bssp"
#ERROR : Can't open dsspfile "2jchA.bssp"
#ERROR : Can't open dsspfile "2je5B.bssp"
#ERROR : Can't open dsspfile "2je5A.bssp"
#ERROR : Can't open dsspfile "2jciA.bssp"
#ERROR : Can't open dsspfile "2bg4A.bssp"
#ERROR : Can't open dsspfile "2bg1A.bssp"
#ERROR : Can't open dsspfile "2uwyB.bssp"
#ERROR : Can't open dsspfile "2jciB.bssp"
#ERROR : Can't open dsspfile "2fffB.bssp"
#ERROR : Can't open dsspfile "2v2fF.bssp"
#ERROR : Can't open dsspfile "2c6wB.bssp"
#ERROR : Can't open dsspfile "2c5wB.bssp"
#ERROR : Can't open dsspfile "2zc6B.bssp"

## Summary of PDB Search
:757
    9e-39  31%  3dwkC  [x.x.x] PENICILLIN-BINDING PROTEIN 2
    9e-39  31%  3dwkB  [x.x.x] PENICILLIN-BINDING PROTEIN 2
    1e-36  32%  3fwmA  [x.x.x] PENICILLIN-BINDING PROTEIN 1B
    4e-34  31%  3dwkD  [x.x.x] PENICILLIN-BINDING PROTEIN 2
    1e-32  31%  3dwkA  [x.x.x] PENICILLIN-BINDING PROTEIN 2
    3e-32  32%  2olvB  [x.x.x] PENICILLIN-BINDING PROTEIN 2
    8e-32  31%  2olvA  [x.x.x] PENICILLIN-BINDING PROTEIN 2
    4e-31  42%  2oqoA  [x.x.x] PENICILLIN-BINDING PROTEIN 1A (PBP-1A) (PBP1A)
    4e-31  30%  3fwlA  [x.x.x] PENICILLIN-BINDING PROTEIN 1B
    2e-30  43%  3d3hA  [x.x.x] PENICILLIN-INSENSITIVE TRANSGLYCOSYLASE
    8e-29  32%  2oluA  [x.x.x] PENICILLIN-BINDING PROTEIN 2
    4e-21  35%  3hzsA  [x.x.x] MONOFUNCTIONAL GLYCOSYLTRANSFERASE
    2e-20  29%  2bg4B  [x.x.x] PENICILLIN-BINDING PROTEIN 1B
    1e-19  28%  2uwxA  [x.x.x] PENICILLIN-BINDING PROTEIN 1B
    2e-19  29%  2jchA  [x.x.x] PENICILLIN-BINDING PROTEIN 1B
    2e-19  29%  2je5B  [x.x.x] PENICILLIN-BINDING PROTEIN 1B
    2e-19  29%  2je5A  [x.x.x] PENICILLIN-BINDING PROTEIN 1B
    2e-19  29%  2jciA  [x.x.x] PENICILLIN-BINDING PROTEIN 1B
    2e-19  29%  2bg4A  [x.x.x] PENICILLIN-BINDING PROTEIN 1B
    2e-19  29%  2bg1A  [x.x.x] PENICILLIN-BINDING PROTEIN 1B
    3e-19  29%  2uwyB  [x.x.x] PENICILLIN-BINDING PROTEIN 1B
    3e-19  29%  2jciB  [x.x.x] PENICILLIN-BINDING PROTEIN 1B
    3e-19  29%  2fffB  [x.x.x] PENICILLIN-BINDING PROTEIN 1B
    3e-14  30%  2v2fF  [x.x.x] PENICILLIN BINDING PROTEIN 1A
    7e-12  29%  2c6wB  [x.x.x] PENICILLIN-BINDING PROTEIN 1A
    7e-12  29%  2c5wB  [x.x.x] PENICILLIN-BINDING PROTEIN 1A
    4e-11  28%  2zc6B  [x.x.x] PENICILLIN-BINDING PROTEIN 1A
:757

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3dwkC           ----------------------------------------------------------------------
3dwkB           ----------------------------------------------------------------------
3fwmA           ----------------------------------------------------------------------
3dwkD           ----------------------------------------------------------------------
3dwkA           ----------------------------------------------------------------------
2olvB           ----------------------------------------------------------------------
2olvA           ----------------------------------------------------------------------
2oqoA           ----------------------------------------------------------------------
3fwlA           ----------------------------------------------------------------------
3d3hA           ----------------------------------------------------------------------
2oluA           ----------------------------------------------------------------------
3hzsA           ----------------------------------------------------------------------
2bg4B           ----------------------------------------------------------------------
2uwxA           ----------------------------------------------------------------------
2jchA           ----------------------------------------------------------------------
2je5B           ----------------------------------------------------------------------
2je5A           ----------------------------------------------------------------------
2jciA           ----------------------------------------------------------------------
2bg4A           ----------------------------------------------------------------------
2bg1A           ----------------------------------------------------------------------
2uwyB           ----------------------------------------------------------------------
2jciB           ----------------------------------------------------------------------
2fffB           ----------------------------------------------------------------------
2v2fF           ----------------------------------------------------------------------
2c6wB           ----------------------------------------------------------------------
2c5wB           ----------------------------------------------------------------------
2zc6B           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGI
3dwkC           ----------------------------------------------------------------------
3dwkB           ----------------------------------------------------------------------
3fwmA           ----------------------------------------------------------------------
3dwkD           ----------------------------------------------------------------------
3dwkA           ----------------------------------------------------------------------
2olvB           ----------------------------------------------------------------------
2olvA           ----------------------------------------------------------------------
2oqoA           --------------------------------------------------------------------GI
3fwlA           ----------------------------------------------------------------------
3d3hA           ----------------------------------------------------------------------
2oluA           ----------------------------------------------------------------------
3hzsA           ----------------------------------------------------------------------
2bg4B           ----------------------------------------------------------------------
2uwxA           ----------------------------------------------------------------------
2jchA           ----------------------------------------------------------------------
2je5B           ----------------------------------------------------------------------
2je5A           ----------------------------------------------------------------------
2jciA           ----------------------------------------------------------------------
2bg4A           ----------------------------------------------------------------------
2bg1A           ----------------------------------------------------------------------
2uwyB           ----------------------------------------------------------------------
2jciB           ----------------------------------------------------------------------
2fffB           ----------------------------------------------------------------------
2v2fF           ----------------------------------------------------------------------
2c6wB           ----------------------------------------------------------------------
2c5wB           ----------------------------------------------------------------------
2zc6B           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           IHEDSVPIDQMPDHFIKAVLATEDRRFFDHFGIDFIGLARAMSENARAGGVVQGGSTLTQQLAKNLFLTN
3dwkC           ---EHVNLKDVPKSMKDAVLATEDNRFYEHGALDYKRLFGAIGKNLTGGFGSEGASTLTQQVVKDAFLSQ
3dwkB           ---EHVNLKDVPKSMKDAVLATEDNRFYEHGALDYKRLFGAIGKNLTGGFGSEGASTLTQQVVKDAFLSQ
3fwmA           ---------------------------------------------------------------KNLFLSS
3dwkD           ---EHVNLKDVPKSMKDAVLATEDNRFYEHGALDYKRLF---------------ASTLTQQVVKDAFLSQ
3dwkA           ---EHVNLKDVPKSMKDAVLATEDNRFYEHGALDYKRLF---------------GSTLTQQVVKDAFL--
2olvB           -----------------AVLATEDNRFYEHGALDYKRLFGAIGKN--------GASTLTQQVVKDAFLSQ
2olvA           -----------------AVLATEDNRFYEHGALDYKRLF---------GAIGKGASTLTQQVVKDAFLSQ
2oqoA           QKRFYVSIDKIPEHVINAFVATEDRNFWHHFGIDPVAIVRAAIVN------VQGGSTITQQLAKNLFLTR
3fwlA           -----VPRSGFPDLLVDTLLATEDRHFYEHDGISLY-------------------SILTQQLVKNLFLSS
3d3hA           -----VSIDKIPEHVINAFVATEDRNFWHHFGIDPVAIVRA---------AIQGGSTITQQLAKNLFLTR
2oluA           -----------------AVLATEDNRFYEHGALDY-------------GFGSEGASTLTQQVVKDAFL--
3hzsA           -----VSADNMPEYVKGAFISMQDERFYNHHGFDLKGTTRALFSTI-SDRDVQGGSTITQQVVKNYFYDN
2bg4B           ----------------------------------------------------------------------
2uwxA           ----------------------------------------------------------------------
2jchA           ----------------------------------------------------------------------
2je5B           ----------------------------------------------------------------------
2je5A           ----------------------------------------------------------------------
2jciA           ----------------------------------------------------------------------
2bg4A           ----------------------------------------------------------------------
2bg1A           ----------------------------------------------------------------------
2uwyB           ----------------------------------------------------------------------
2jciB           ----------------------------------------------------------------------
2fffB           ----------------------------------------------------------------------
2v2fF           ----------------------------------------------------------------------
2c6wB           ----------------------------------------------------------------------
2c5wB           ----------------------------------------------------------------------
2zc6B           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ERSLERKIKEAFLALWLESNMSKKEILSLYLDRAYMXXXXXXXXXXXXXXXXKNLTDVTLSESAILAGLF
3dwkC           HKSIGRKAQEAYLSYRLEQEYSKDDIFQVYLNKIYYSDGVTGIKAAAKYYFNKDLKDLNLAEEAYLAGLP
3dwkB           HKSIGRKAQEAYLSYRLEQEYSKDDIFQVYLNKIYYSDGVTGIKAAAKYYFNKDLKDLNLAEEAYLAGLP
3fwmA           ERSYWRKANEAYMALIMDARYSKDRILELYMNEVYLGQSGDNEIRGFPLASLRPVEELSLDQQALLVGMV
3dwkD           HKSIGRKAQEAYLSYRLEQEYSKDDIFQVYLNKIYYSDGVTGIKAAAKYYFNKDLKDLNLAEEAYLAGLP
3dwkA           --SIGRKAQEAYLSYRLEQEYSKDDIFQVYLNKIYYSDGVTGIKAAAKYYFNKDLKDLNLAEEAYLAGLP
2olvB           HKSIGRKAQEAYLSYRLEQEYSKDDIFQVYLNKIYYSDGVTGIKAAAKYYFNKDLKDLNLAEEAYLAGLP
2olvA           HKSIGRKAQEAYLSYRLEQEYSKDDIFQVYLNKIYYSDGVTGIKAAAKYYFNKDLKDLNLAEEAYLAGLP
2oqoA           ERTLERKIKEALLAIKIERTFDKKKIMELYLNQIYLGSGAYGVEAAAQVYFGKHVWELSLDEXXXXXXXX
3fwlA           ERSYWRKANEAYALI--DARYSKDRILELY-NEVYLGQSGDNEIRGFPLASLRPVEELSLDQQALLVGV-
3d3hA           ERTLERKIKEALLAIKIERTFDKKKIMELYLNQIYLGSGAYGVEAAAQVYFGKHVWELSLDEXXXXXXXX
2oluA           --SIGRKAQEAYLSYRLEQEYSKDDIFQVYLNKIYYSDGVTGIKAAAKYYFNKDLKDLNLAEEAYLAGLP
3hzsA           DRSFTRKVKELFVAHRVEKQYNKNEILSFYLNNIYLEGAANHYFGTTVNKNSTTMSHITVLQSAILASKV
2bg4B           ----------------------------------------------------------------------
2uwxA           ----------------------------------------------------------------------
2jchA           ----------------------------------------------------------------------
2je5B           ----------------------------------------------------------------------
2je5A           ----------------------------------------------------------------------
2jciA           ----------------------------------------------------------------------
2bg4A           ----------------------------------------------------------------------
2bg1A           ----------------------------------------------------------------------
2uwyB           ----------------------------------------------------------------------
2jciB           ----------------------------------------------------------------------
2fffB           ----------------------------------------------------------------------
2v2fF           ----------------------------------------------------------------------
2c6wB           ----------------------------------------------------------------------
2c5wB           ----------------------------------------------------------------------
2zc6B           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           KAPAKYAPHVNLPAARARANTVLSNLVQSGLMTEGQVIGARRNPATVIDRADVKAPDYFLDWAFDEVQRL
3dwkC           QVPNNYNIYDHPKAAEDRKNTVLYLMHYHKRITDKQWEDAKKLKANLVNRTDTNQDSEYNSYVNFVKSEL
3dwkB           QVPNNYNIYDHPKAAEDRKNTVLYLMHYHKRITDKQWEDAKKLKANLVNRTDTNQDSEYNSYVNFVKSEL
3fwmA           KGASIYNPWRNPKLALERRNLVLRLVISP-------------QPA-------------FMQLVRQELQAK
3dwkD           QVPNNYNIYDHPKAAEDRKNTVLYLMHYHKRITDKQWEDAKKLKANLVNRTDTNQDSEYNSYVNFVKSEL
3dwkA           QVPNNYNIYDHPKAAEDRKNTVLYLMHYHKRITDKQWEDAKKIDRTPEERQNDSEYNSYVNFVKSELMNN
2olvB           QVPNNYNIYDHPKAAEDRKNTVL-YLHYHKRITDKQWEDAKKLKANLVNRTPEERQNIYVNFVKSELNNK
2olvA           QVPNNYNIYDHPKAAEDRKNTVL-YLHYHKRITDKQWEDAKKLKANLVNRTPEERQNIYVNFVKSELNNK
2oqoA           XXXXXYNPFYHPERALQRRNLVLKRMLEEGYITPEQ----------------------------------
3fwlA           KGASIYNPWRNPKXXXXXXXXXXXXXXXXXXXXXXXXXXSAR---------PVISPQPAFQLVRQELQAK
3d3hA           XXXXXYNPFYHPERALQRRNLVLKRMLEEGYITPEQ----------------------------------
2oluA           QVPNNYNIYDHPKAAEDRKNTVL-YLHYHKRITDKQWEDAKKLKANLVNRTPEERQNIYVNFVKSELNNK
3hzsA           NAPSVYNINNMSENFTQRVSTNLEKMKQQNYINETQ----------------------------------
2bg4B           ---------------------------------------------------------------YDYLANE
2uwxA           ---------------------------------------AQRDNVSAKELKNEATQKFYRDLAAKEIEN-
2jchA           ------------------------------------------------DNVSAATQKFYRDLAAKEIEN-
2je5B           ---------------------------------------AQRDNVSAKELKNEATQKFYRDLAAKEIEN-
2je5A           ---------------------------------------AQRDNVSAKELKNEATQKFYRDLAAKEIEN-
2jciA           ---------------------------------------AQRDNVSAKELKNEATQKFYRDLAAKEIEN-
2bg4A           ---------------------------------------AQRDNVSAKELKNEATQKFYRDLAAKEIEN-
2bg1A           ---------------------------------------AQRDNVSAKELKNEATQKFYRDLAAKEIEN-
2uwyB           ----------------------------------------------------------------------
2jciB           ----------------------------------------------------------------------
2fffB           ---------------------------------------AQRDNVSAKELKNEATQKFYRDLAAKEIEN-
2v2fF           ----------------------------------------------------------------------
2c6wB           ----------------------------------------------------------------------
2c5wB           ----------------------------------------------------------------------
2zc6B           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           AAEGKFKDHTVVVRTTIDTGLQQAAEQAMEMELREYGEGYRVKQGAMVMIENGGGVRAMVGGRDYGESQF
3dwkC           MNNKAFKDENLVLQSGIKTNMDKDVQKTLQNDV-DNGSFYKNKDGATILDSKTGGLVAISGGRDF-KDVV
3dwkB           MNNKAFKDENLVLQSGIKTNMDKDVQKTLQNDV-DNGSFYKNKDGATILDSKTGGLVAISGGRDF-KDVV
3fwmA           LGD-KVKDLSVKIFTTFDSVAQDAAEKAAVEGIPALKKQRKLSETAIVVVDRSGEVRAMVGGSEPQFAGY
3dwkD           MNNKAFKDENLVLQSGIKTNMDKDVQKTLQNDV-DNGSFYKNKDGATILDSKTGGLVAISGGRDF-KDVV
3dwkA           KA---FKDENLVLQSGIKTNMDKDVQKTLQNDV-DNGSFYKNKDGATILDSKTGGLVAISGGRDF-KDVV
2olvB           A----FKDENLVLQSGIKIYTNDKDVQKTLQNDVDNGSFYKNKDGATILDSKTGGLVAISGGRDF-KDVV
2olvA           A----FKDENLVLQSGIKIYTNDKDVQKTLQNDVDNGSFYKNKDGATILDSKTGGLVAISGGRDF-KDVV
2oqoA           ----------------------------------------------------------------------
3fwlA           LGD-KVKDLSVKIFTTFDSVAQDAAEKAAVEGIPALKKQRKLSETAIVVVDRFSGEVRAVGGSEPQFAGY
3d3hA           ----------------------------------------------------------------------
2oluA           A----FKDENLVLQSGIKIYTNDKDVQKTLQNDVDNGSFYKNKDGATILDSKTGGLVAISGGRDF-KDVV
3hzsA           ----------------------------------------------------------------------
2bg4B           ATQKFYRDLAAKITTTID----QKIHSAMQSAVADYGDGTRVEVGNVLMDNQTGAILGFVGGRNYQENQN
2uwxA           ---GGYK-----ITTTID----QKIHSAMQSAVADYGDGTRVEVGNVLMDNQTGAILGFVGGRNYQENQN
2jchA           ---GGYK-----ITTTID----QKIHSAMQSAVADYGDGTRVEVGNVLMDNQTGAILGFVGGRNYQENQN
2je5B           ---GGYK-----ITTTID----QKIHSAMQSAVADYGDGTRVEVGNVLMDNQTGAILGFVGGRNYQENQN
2je5A           ---GGYK-----ITTTID----QKIHSAMQSAVADYGDGTRVEVGNVLMDNQTGAILGFVGGRNYQENQN
2jciA           ---GGYK-----ITTTID----QKIHSAMQSAVADYGDGTRVEVGNVLMDNQTGAILGFVGGRNYQENQN
2bg4A           ---GGYK-----ITTTID----QKIHSAMQSAVADYGDGTRVEVGNVLMDNQTGAILGFVGGRNYQENQN
2bg1A           ---GGYK-----ITTTID----QKIHSAMQSAVADYGDGTRVEVGNVLMDNQTGAILGFVGGRNYQENQN
2uwyB           ----------------ITTTIDQKIHSAMQSAVADYGDGTRVEVGNVLMDNQTGAILGFVGGRNYQENQN
2jciB           ----------------ITTTIDQKIHSAMQSAVADYGDGTRVEVGNVLMDNQTGAILGFVGGRNYQENQN
2fffB           ---GGYK-----ITTTID----QKIHSAMQSAVADYGDGTRVEVGNVLMDNQTGAILGFVGGRNYQENQN
2v2fF           ---------------------------------------------------SNGKVIAQLGARSFGT---
2c6wB           ---------------------------------------------------SNGKVIAQLGARHQSSNVI
2c5wB           ---------------------------------------------------SNGKVIAQLGARHQSSNVI
2zc6B           ---------------------------------------------------SNGKVIAQLGARHQSSNVI


                         .         .         +         .         .         .         .:490
query           NRATAALRQPGSSFKVYTYSAAMEKGMKPDTLISDAPVTWRGWSPQNYGRSYAGKVTLQVALAKSYNTVP
3dwkC           NRNQATDPHPGSSLKPFAYGPAIEKWATNHAIQDESSYQVDGSTFRNYDTKSHGTVSIYDALRQSFN-IP
3dwkB           NRNQATDPHPGSSLKPFAYGPAIEKWATNHAIQDESSYQVDGSTFRNYDTKSHGTVSIYDALRQSFN-IP
3fwmA           NRAMQARRSIGSLAKPATYLTALSKIYRLNTWIADAPIALRQWSPQNDDRRYSGRVMLVDALTRSMNVPT
3dwkD           NRNQATDPHPGSSLKPFAYGPAIEKWATNHAIQDESSYQVDGSTFRNYDTKSHGTVSIYDALRQSFN-IP
3dwkA           NRNQATDPHPGSSLKPFAYGPAIEKWATNHAIQDESSYQVDGSTFRNYDTKSHGTVSIYDALRQSFN-IP
2olvB           NRNQATDPHPGSSLKPFAYGPAIENKWATNHAIQDSSYQVDGSTFRNYDTKSHGTVSIYDALRQSFN-IP
2olvA           NRNQATDPHPGSSLKPFAYGPAIENKWATNHAIQDSSYQVDGSTFRNYDTKSHGTVSIYDALRQSFN-IP
2oqoA           ----------------------------------------------------------------------
3fwlA           NRAQAR-RSIGSLAKPATYLTALSKIYRLNTWIADAPIALRQWSPQNDDRRYSESGRVLVDALTRSNVPT
3d3hA           ----------------------------------------------------------------------
2oluA           NRNQATDPHPGSSLKPFAYGPAIENKWATNHAIQDSSYQVDGSTFRNYDTKSHGTVSIYDALRQSFN-IP
3hzsA           ----------------------------------------------------------------------
2bg4B           NHAFDTKRSPASTTKLLAYGIAIDQGMGSETILSNYPTNFANGNPIMYANSKTGMMTLGEALNYSWN-IP
2uwxA           NHAFDTKRSPATTKPLLAYGIAIDQGMGSETILSNYPTNFANGNPIMYANSKTGMMTLGEALNYSWN-IP
2jchA           NHAFDTKRSPASTTKLLAYGIAIDQGMGSETILSNYPTNFANGNPIMYANSKTGMMTLGEALNYSWN-IP
2je5B           NHAFDTKRSPASTTKLLAYGIAIDQGMGSETILSNYPTNFANGNPIMYANSKTGMMTLGEALNYSWN-IP
2je5A           NHAFDTKRSPASTTKLLAYGIAIDQGMGSETILSNYPTNFANGNPIMYANSKTGMMTLGEALNYSWN-IP
2jciA           NHAFDTKRSPASTTKLLAYGIAIDQGMGSETILSNYPTNFANGNPIMYANSKTGMMTLGEALNYSWN-IP
2bg4A           NHAFDTKRSPASTTKLLAYGIAIDQGMGSETILSNYPTNFANGNPIMYANSKTGMMTLGEALNYSWN-IP
2bg1A           NHAFDTKRSPASTTKLLAYGIAIDQGMGSETILSNYPTNFANGNPIMYANSKTGMMTLGEALNYSWN-IP
2uwyB           NHAFDTKRSPASTTKLLAYGIAIDQGMGSETILSNYPTNFANGNPIMYANSKTGMMTLGEALNYSWN-IP
2jciB           NHAFDTKRSPASTTKLLAYGIAIDQGMGSETILSNYPTNFANGNPIMYANSKTGMMTLGEALNYSWN-IP
2fffB           NHAFDTKRSPASTTKLLAYGIAIDQGMGSETILSNYPTNFANGNPIMYANSKTGMMTLGEALNYSWN-IP
2v2fF           NQAVETNRDWGSAMKPITYAPAIEYGVYDSTMVNDIPYNYPGTSTPNWDRAYFGNITLQYALQQSRNVTA
2c6wB           NQAVETNRDWGSTMKPITYAPALEYGVYDSTIVHDEPYNYPGTNTPNWDRGYFGNITLQYALQQSRN-VP
2c5wB           NQAVETNRDWGSTMKPITYAPALEYGVYESTIVHDEPYNYPGTNTPNWDRGYFGNITLQYALQQSRN-VP
2zc6B           NQAVETNRDWGSTMKPITYAPALEYGVYDSTIVHDEPYNYPGTNTPNWDRGYFGNITLQYALQQSRN-VP


                         *         .         .         .         .         +         .:560
query           VRLAKDVLGTQVIVDTAKAMGVATPLRSDKTIPLGTSEVTVLDQATAYAVFPADGMQSRRHGIEQVMDYE
3dwkC           ALKAWQSVKQNAGNDAPKKFAAKLGLNYEGDIVLGASEFSPTQLASAFAAIANGGTYNNAHSIQKVVTRD
3dwkB           ALKAWQSVKQNAGNDAPKKFAAKLGLNYEGDIVLGASEFSPTQLASAFAAIANGGTYNNAHSIQKVVTRD
3fwmA           VNLGM-ALGLPAVTETWIKLGVPKDLHPVPAMLLGALNLTPIEVAQAFQTIASGGNRAPLSALRSVIAED
3dwkD           ALKAWQSVKQNAGNDAPKKFAAKLGLNYEGDIVLGASEFSPTQLASAFAAIANGGTYNNAHSIQKVVTRD
3dwkA           ALKAWQSVKQNAGNDAPKKFAAKLGLNYEGDIVLGASEFSPTQLASAFAAIANGGTYNNAHSIQKVVTRD
2olvB           ALKAWQSVKQNAGNDAPKKFAAKLGLNYEGDIVLGASEFSPTQLASAFAAIANGGTYNNAHSIQKVVTRD
2olvA           ALKAWQSVKQNAGNDAPKKFAAKLGLNYEGDIVLGASEFSPTQLASAFAAIANGGTYNNAHSIQKVVTRD
2oqoA           ----------------------------------------------------------------------
3fwlA           VNLG--ALGLPAVTETWIKLGVPKDQLHPVPALLGALNLTPIEVAQAFQTIASGGNRAPLSALRSVIAED
3d3hA           ----------------------------------------------------------------------
2oluA           ALKAWQSVKQNAGNDAPKKFAAKLGLNYEGDIVLGASEFSPTQLASAFAAIANGGTYNNAHSIQKVVTRD
3hzsA           ----------------------------------------------------------------------
2bg4B           AYWTYRMLRENDVKGYMEKMGYEIPEYGIESLPMGGGEVTVAQHTNGYQTLANNGVYHQKHVISKIEAAD
2uwxA           AYWTYRMLRENDVKGYMEKMGYEIPEYGIESLPMGGGEVTVAQHTNGYQTLANNGVYHQKHVISKIEAAD
2jchA           AYWTYRMLRENDVKGYMEKMGYEIPEYGIESLPMGGGEVTVAQHTNGYQTLANNGVYHQKHVISKIEAAD
2je5B           AYWTYRMLRENDVKGYMEKMGYEIPEYGIESLPMGGGEVTVAQHTNGYQTLANNGVYHQKHVISKIEAAD
2je5A           AYWTYRMLRENDVKGYMEKMGYEIPEYGIESLPMGGGEVTVAQHTNGYQTLANNGVYHQKHVISKIEAAD
2jciA           AYWTYRMLRENDVKGYMEKMGYEIPEYGIESLPMGGGEVTVAQHTNGYQTLANNGVYHQKHVISKIEAAD
2bg4A           AYWTYRMLRENDVKGYMEKMGYEIPEYGIESLPMGGGEVTVAQHTNGYQTLANNGVYHQKHVISKIEAAD
2bg1A           AYWTYRMLRENDVKGYMEKMGYEIPEYGIESLPMGGGEVTVAQHTNGYQTLANNGVYHQKHVISKIEAAD
2uwyB           AYWTYRMLRENDVKGYMEKMGYEIPEYGIESLPMGGGEVTVAQHTNGYQTLANNGVYHQKHVISKIEAAD
2jciB           AYWTYRMLRENDVKGYMEKMGYEIPEYGIESLPMGGGEVTVAQHTNGYQTLANNGVYHQKHVISKIEAAD
2fffB           AYWTYRMLRENDVKGYMEKMGYEIPEYGIESLPMGGGEVTVAQHTNGYQTLANNGVYHQKHVISKIEAAD
2v2fF           VETLNKV-GLDRAKTFLNGLGIDYPMHYANAISSNTTESNKQYGASSEKMXXXXXXXXNGGIYHKPMYIN
2c6wB           AVETLNKVGLNRAKTFLNGLGIDYPIHYSNAISSNTTESDKKYGASSEKMXXXXXXXXNGGTYYKPMYIH
2c5wB           AVETLNKVGLNRAKTFLNGLGIDYPIHYSNAISSNTTESDKKYGASSEKMXXXXXXXXNGGTYYKPMYIH
2zc6B           AVETLNKVGLNRAKTFLNGLGIDYPIHYSNAISSNTTESDKKYGASSEKMXXXXXXXXNGGTYYKPMYIH


                         .         .         .         *         .         .         .:630
query           GNVLYDFSHDEPPAKRVLSEEANSKMNQMLVTIPVMGTARRGALDNGIVSGGKTGTSQAYRDAWYVGFTG
3dwkC           GETI-EYDH---TSHKAMSDYTAYMLAEMLKTFKPYGSA-YGHGVSGVNMGAKTGTDNAAKDVWINGFTP
3dwkB           GETI-EYDH---TSHKAMSDYTAYMLAEMLKTFKPYGSA-YGHGVSGVNMGAKTGTDNAAKDVWINGFTP
3fwmA           GKVLYQ---SFPQAERAVPAQAAYLTLWTMQQVVQRGTGRQGAKYPNLHLAGKTGTTNNNVDTWFAGIDG
3dwkD           GETI-EYDH---TSHKAMSDYTAYMLAEMLKTFKPYGSA-YGHGVSGVNMGAKTGTDNAAKDVWINGFTP
3dwkA           GETI-EYDH---TSHKAMSDYTAYMLAEMLKTFKPYGSA-YGHGVSGVNMGAKTGTDNAAKDVWINGFTP
2olvB           GETI-EYDHTSHKA-----SDYTAYLAELKGTFKPYGSAYGHGVSG--VNGAKTGTDNAAKDVWINGFTP
2olvA           GETI-EYDHTSHKA-----SDYTAYLAELKGTFKPYGSAYGHGVSG--VNGAKTGTDNAAKDVWINGFTP
2oqoA           ----------------------------------------------------------------------
3fwlA           GKVLYQ---SFPQAERAVPAQA-AYLTLWTQQVVQRGTGRQGAKYPNLHLAGKTGTTNNNVDTWFAGIDG
3d3hA           ----------------------------------------------------------------------
2oluA           GETI-EYDHTSHKA-----SDYTAYLAELKGTFKPYGSAYGHGVSG--VNGAKTGTDNAAKDVWINGFTP
3hzsA           ----------------------------------------------------------------------
2bg4B           GRVVYEY-QDKP--VQVYSKATATIMQGLLLSSRVTTTFKSNSLNPTLANAGKTGTTNQDENMWLMLSTP
2uwxA           GRVVYEY-QDKP--VQVYSKATATIMQGLLLSSRVTTTFKSNSLNPTLANAGKTGTTNQDENMWLMLSTP
2jchA           GRVVYEY-QDKP--VQVYSKATATIMQGLLLSSRVTTTFKSNSLNPTLANAGKTGTTNQDENMWLMLSTP
2je5B           GRVVYEY-QDKP--VQVYSKATATIMQGLLLSSRVTTTFKSNSLNPTLANAGKTGTTNQDENMWLMLSTP
2je5A           GRVVYEY-QDKP--VQVYSKATATIMQGLLLSSRVTTTFKSNSLNPTLANAGKTGTTNQDENMWLMLSTP
2jciA           GRVVYEY-QDKP--VQVYSKATATIMQGLLLSSRVTTTFKSNSLNPTLANAGKTGTTNQDENMWLMLSTP
2bg4A           GRVVYEY-QDKP--VQVYSKATATIMQGLLLSSRVTTTFKSNSLNPTLANAGKTGTTNQDENMWLMLSTP
2bg1A           GRVVYEY-QDKP--VQVYSKATATIMQGLLLSSRVTTTFKSNSLNPTLANAGKTGTTNQDENMWLMLSTP
2uwyB           GRVVYEY-QDKP--VQVYSKATATIMQGLLLSSRVTTTFKSNSLNPTLANAGKTGTTNQDENMWLMLSTP
2jciB           GRVVYEY-QDKP--VQVYSKATATIMQGLLLSSRVTTTFKSNSLNPTLANAGKTGTTNQDENMWLMLSTP
2fffB           GRVVYEY-QDKP--VQVYSKATATIMQGLLLSSRVTTTFKSNSLNPTLANAGKTGTTNQDENMWLMLSTP
2v2fF           KVVFSDGSKKEDVGTRAMKETTAYMMTEMMKTVLAYGTGR-GAYLPWLAQAGKTGTSNVAPDEMFVGYTR
2c6wB           KVVFSDGSEKENVGTRAMKETTAYMMTDMMKTVLTYGTGRNAYL-AWLPQAGKTGTSNVAPDELFAGYTR
2c5wB           KVVFSDGSEKENVGTRAMKETTAYMMTDMMKTVLTYGTGRNAYL-AWLPQAGKTGTSNVAPDELFAGYTR
2zc6B           KVVFSDGSEKENVGTRAMKETTAYMMTDMMKTVLSYGTGQNAYL-AWLPQAGKTGTSNVAPDELFAGYTR


                         .         +         .         .         .         .         *:700
query           NYTTAVWFGNDEFTPMNNMTGGALPAMTYKRLMDYAHQGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3dwkC           QYTMSVWMG-------------------------------------------------------------
3dwkB           QYTMSVWMG-------------------------------------------------------------
3fwmA           STVTITWVGRDNNQP-TKLYGASGAMSIYQRYL-------------------------------------
3dwkD           QYTMSVWMG-------------------------------------------------------------
3dwkA           QYTMSVWMG-------------------------------------------------------------
2olvB           QY-TSVW---------------------------------------------------------------
2olvA           QY-TSVW---------------------------------------------------------------
2oqoA           ----------------------------------------------------------------------
3fwlA           STVTITWVGRDNNQP--TKLYGASGASIYQRYL-------------------------------------
3d3hA           ----------------------------------------------------------------------
2oluA           QY-TSVW---------------------------------------------------------------
3hzsA           ----------------------------------------------------------------------
2bg4B           RLTLGGWIGHDDNHSLSQQAG-------------------------------------------------
2uwxA           RLTLGGWIGHDDNHSLSQQAG-------------------------------------------------
2jchA           RLTLGGWIGHDDNHSLSQQAG-------------------------------------------------
2je5B           RLTLGGWIGHDDNHSLSQQAG-------------------------------------------------
2je5A           RLTLGGWIGHDDNHSLSQQAG-------------------------------------------------
2jciA           RLTLGGWIGHDDNHSLSQQAG-------------------------------------------------
2bg4A           RLTLGGWIGHDDNHSLSQQAG-------------------------------------------------
2bg1A           RLTLGGWIGHDDNHSLSQQAG-------------------------------------------------
2uwyB           RLTLGGWIGHDDNHSLSQQAG-------------------------------------------------
2jciB           RLTLGGWIGHDDNHSLSQQAG-------------------------------------------------
2fffB           RLTLGGWIGHDDNHSLSRRAG-------------------------------------------------
2v2fF           KYSMAVWTGSNRLTPIVG-DGFLVAAKVYRSMITYLSEG-------------------------------
2c6wB           KYSMAVWTGSNRLTPLVG-NGLTVAAKVYRSMMTYLSEG-------------------------------
2c5wB           KYSMAVWTGSNRLTPLVG-NGLTVAAKVYRSMMTYLSEG-------------------------------
2zc6B           KYSMAVWTGSNRLTPLVG-NGLTVAAKVYRSMMTYLSEG-------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3dwkC           ---------------------------------------------------------
3dwkB           ---------------------------------------------------------
3fwmA           ---------------------------------------------------------
3dwkD           ---------------------------------------------------------
3dwkA           ---------------------------------------------------------
2olvB           ---------------------------------------------------------
2olvA           ---------------------------------------------------------
2oqoA           ---------------------------------------------------------
3fwlA           ---------------------------------------------------------
3d3hA           ---------------------------------------------------------
2oluA           ---------------------------------------------------------
3hzsA           ---------------------------------------------------------
2bg4B           ---------------------------------------------------------
2uwxA           ---------------------------------------------------------
2jchA           ---------------------------------------------------------
2je5B           ---------------------------------------------------------
2je5A           ---------------------------------------------------------
2jciA           ---------------------------------------------------------
2bg4A           ---------------------------------------------------------
2bg1A           ---------------------------------------------------------
2uwyB           ---------------------------------------------------------
2jciB           ---------------------------------------------------------
2fffB           ---------------------------------------------------------
2v2fF           ---------------------------------------------------------
2c6wB           ---------------------------------------------------------
2c5wB           ---------------------------------------------------------
2zc6B           ---------------------------------------------------------