[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for atum0:AAK86987.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1s76D.bssp"
#ERROR : Can't open dsspfile "1mswD.bssp"
#ERROR : Can't open dsspfile "1s77D.bssp"
#ERROR : Can't open dsspfile "1cezA.bssp"
#ERROR : Can't open dsspfile "1h38A.bssp"
#ERROR : Can't open dsspfile "3e2eA.bssp"
#ERROR : Can't open dsspfile "3e3jC.bssp"
#ERROR : Can't open dsspfile "1aroP.bssp"

## Summary of PDB Search
:863
    e-136  41%  1s76D  [e.8.1] DNA-DIRECTED RNA POLYMERASE
    e-135  41%  1mswD  [e.8.1] DNA-DIRECTED RNA POLYMERASE
    e-134  41%  1s77D  [e.8.1] DNA-DIRECTED RNA POLYMERASE
    e-133  40%  1cezA  [e.8.1] PROTEIN (BACTERIOPHAGE T7 RNA POLYMERASE)
    e-133  40%  1h38A  [e.8.1] DNA-DIRECTED RNA POLYMERASE
    e-132  41%  3e2eA  [x.x.x] DNA-DIRECTED RNA POLYMERASE
    e-130  40%  3e3jC  [x.x.x] DNA-DIRECTED RNA POLYMERASE
    e-123  41%  1aroP  [e.8.1] T7 RNA POLYMERASE
:863

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxKQIALEEEMRSAGIARFEKGLEKNREKNAEASNLSSRRMIIHAH
1s76D           --------------------------EQLALEHESYEMGEARFRKMFERQLKAGEVADNAAAKPLITTLL
1mswD           --------------------------EQLALEHESYEMGEARFRKMFERQLKAGEVADNAAAKPLITTLL
1s77D           --------------------------EQLALEHESYEMGEARFRKMFERQLKAGEVADNAAAKPLITTLL
1cezA           --------------------------EQLALEHESYEMGEARFRKMFP----------------LITTLL
1h38A           --------------------------EQLALEHESYEMGEARFRKMFERQLKAGEVADNAAAKPLITTLL
3e2eA           --------------------------EQLALEHESYEMGEARFRKMFE---------------RLITTLL
3e3jC           --------------------------EQLALEHESYEMGEARFRKMF-----------------LITTLL
1aroP           --------------------------EQLALEHESYEMGEARFRKMFER-------------QLLITTLL


                         .         .         *         .         .         .         .:140
query           AQVIAGLEAFLAEASSGKAGKKHTAVAYLKDADLDVVAHLTLRNLFDYVSMRMKLTPLSIRLAAMVEDEL
1s76D           PKMIARINDWFEEVKA-KRGKRPTAFQFLQEIKPEAVAYITIKTTLACLTSADNTTVQAVASAIAIEDEA
1mswD           PKMIARINDWFEEVKA-KRGKRPTAFQFLQEIKPEAVAYITIKTTLACLTSADNTTVQAVASAIAIEDEA
1s77D           PKMIARINDWFEEVKA-KRGKRPTAFQFLQEIKPEAVAYITIKTTLACLTSADNTTVQAVASAIAIEDEA
1cezA           PKMIARINDWFEEVKA-KRGKRPTAFQFLQEIKPEAVAYITIKTTLACLTSADNTTVQAVASAIAIEDEA
1h38A           PKMIARINDWFEEVKA-KRGKRPTAFQFLQEIKPEAVAYITIKTTLACLTSADNTTVQAVASAIAIEDEA
3e2eA           PKMIARINDWFEEVKA-KRGKRPTAFQFLQEIKPEAVAYITIKTTLACLTSADNTTVQAVASAIAIEDEA
3e3jC           PKMIARINDWFEEVKA-KRGKRPTAFQFLQEIKPEAVAYITIKTTLACLTSADNTTVQAVASAIAIEDEA
1aroP           PKMIARINDWFEEVKA-KRGKRPTAFQFLQEIKPEAVAYITIKTTLACLTSADNTTVQAVASAIAIEDEA


                         +         .         .         .         .         *         .:210
query           FFNAFKGHDKDAYEYARKKISEQTHNAVHQKRAMTKHAKHKGAEWQDWSQDVKAKVGLKLIEIAVEQTGL
1s76D           RFGRIR--DLEAKHF-KKNVEEQLNKRVGHKKAFMQVVESKGA-WSSWHKEDSIHVGVRCIEMLIESTGM
1mswD           RFGRIR--DLEAKHF-KKNVEEQLNKRVGHKKAMLSKGLLGGEAWSSWHKEDSIHVGVRCIEMLIESTGM
1s77D           RFGRIR--DLEAKHF-KKNVEEQLNKRVGHKKAFMQVVESKGA-WSSWHKEDSIHVGVRCIEMLIESTGM
1cezA           RFGRIR--DLEAKHF-KKNVEEQLNKRVGHKKAMLSKGLLGGEAWSSWHKEDSIHVGVRCIEMLIESTGM
1h38A           RFGRIR--DLEAKHF-KKNVEEQLNKRVGHKKAMLSKGLLGGEAWSSWHKEDSIHVGVRCIEMLIESTGM
3e2eA           RFGRIR--DLEAKHF-KKNVYKKAFMQVVEADMLSKGLLG-GEAWSSWHKEDSIHVGVRCIEMLIESTGM
3e3jC           RFGRIRDLEAKHFKKNVKAFMQVVEADMLSKGLLG------GEAWSSWHKEDSIHVGVRCIEMLIESTGM
1aroP           RFGRIR--DLEAKHF--KKFMQVVEADMLSKGLLG------GEAWSSWHKEDSIHVGVRCIEMLIESTGM


                         .         .         .         +         .         .         .:280
query           FEIVRQSEGAHNTNIYVVATKETLDWLATENSRLAPLSPVYLPTLVPPRPWTSPFRGGYWSGRVRNLRLI
1s76D           VSLHRQSETIELAPEYAEA-------IATRAGALAGISPMFQPCVVPPKPWTGITGGGYWANGRRPLALV
1mswD           VSLHRQSETIELAPEYAEA-------IATRAGALAGISPMFQPCVVPPKPWTGITGGGYWANGRRPLALV
1s77D           VSL-------HSETIELAP--EYAEAIATRAGALAGISPMFQPCVVPPKPWTGITGGGYWANGRRPLALV
1cezA           VSLHRQNAGVVGQDSETIEAPEYAEAIATRAGALAGISPMFQPCVVPPKPWTGITGGGYWANGRRPLALV
1h38A           VSLHRQNAGVVGQDSETIEAPEYAEAIATRAGALAGISPMFQPCVVPPKPWTGITGGGYWANGRRPLALV
3e2eA           VSLHRQNAGV------VGQDSETIE-LAPEYAE-AIISLMFQPCVVPPKPWTGITGGGYWANGRRPLALV
3e3jC           VSLHRQNAGV------VGQDSETIELAPEYAEAIAGISLMFQPCVVPPKPWTGITGGGYWANGRRPLALV
1aroP           VSLHRQNSET------IELAPEYAEAIATRAGALAGISPMFQPCVVPPKPWTGITGGGYWANGRRPLALV


                         .         *         .         .         .         .         +:350
query           KTGNRQYLMDLESVDMPKVYHSINAMQNTAWSINHRVYEVMASLWDNQSTLACIPQADDMPLPEKPMWLA
1s76D           RTHSKKALMRYEDVYMPEVYKAINIAQNTAWKINKKVLAVVITKWKH-----C------------PVEDI
1mswD           RTHSKKALMRYEDVYMPEVYKAINIAQNTAWKINKKVLAVVITKWKH-----C--PVEDIPAIER-----
1s77D           RTHSKKALMRYEDVYMPEVYKAINIAQNTAWKINKKVLAVVITKWKH-----C------------PVEDI
1cezA           RTHSKKALMRYEDVYMPEVYKAINIAQNTAWKINKKVLAVVITKWKH-CPVEDIPAIEREELPMKPEDI-
1h38A           RTHSKKALMRYEDVYMPEVYKAINIAQNTAWKINKKVLAVVITKWKH-----C--PVEDIPA--------
3e2eA           RTHSKKALMRYEDVYMPEVYKAINIAQNTAWKINKKVLAVVITKWKH-CPVEDIPAIEREELPMKP----
3e3jC           RTHSKKALMRYEDVYMPEVYKAINIAQNTAWKINKKVLAVVITKWKH-CPVEDIPAIEREELPMKPEDI-
1aroP           RTHSKKALMRYEDVYMPEVYKAINIAQNTAWKINKKVLAVANVI--------------------------


                         .         .         .         .         *         .         .:420
query           PEMKREDMSPEQLEEFSRWKSERTTIYEANARAVSKRLAFSRMLGVATRFKDEEEFYFPHQMDFRGRVYA
1s76D           PAIEREELP------MTAWKRAAAAVYRKDKARKSRRISLEFMLEQANKFANHKAIWFPYNMDWRGRVYA
1mswD           ----------EELPMKTAWKRAAAAVYRKDKARKSRRISLEFMLEQANKFANHKAIWFPYNMDWRGRVYA
1s77D           PAIEREELP---------WKRAAAAVYRKDKARKSRRISLEFMLEQANKFANHKAIWFPYNMDWRGRVYA
1cezA           ------DMNPEAL---TAWKRAAAAVYRKDKARKSRRISLEFMLEQANKFANHKAIWFPYNMDWRGRVYA
1h38A           ------------IEALTAWKRAAAAVYRKDKARKSRRISLEFMLEQANKFANHKAIWFPYNMDWRGRVYA
3e2eA           ------DMNPEAL---TAWKRAAAAVYRKDKARKSRRISLEFMLEQANKFANHKAIWFPYNMDWRGRVYA
3e3jC           ------DMNPEAL---TAWKRAAAAVYRKDKARKSRRISLEFMLEQANKFANHKAIWFPYNMDWRGRVYA
1aroP           ----------------TKW------VYRKDKARKSRRISLEFMLEQANKFANHKAIWFPYNMDWRGRVYA


                         .         .         +         .         .         .         .:490
query           VPLFLNPQGDDASHGLLQFANSVPITNEEGADWLAIHGAGLWGVDKCSMNERVEWVMANQREILASAENP
1s76D           VSMF-NPQGNDMTKGLLTLAKGKPI-GKEGYYWLKIHGANCAGVDKVPFPERIKFIEENHENIMACAKSP
1mswD           VSMF-NPQGNDMTKGLLTLAKGKPI-GKEGYYWLKIHGANCAGVDKVPFPERIKFIEENHENIMACAKSP
1s77D           VSMF-NPQGNDMTKGLLTLAKGKPI-GKEGYYWLKIHGANCAGVDKVPFPERIKFIEENHENIMACAKSP
1cezA           VSMF-NPQGNDMTKGLLTLAKGKPI-GKEGYYWLKIHGANCAGVDKVPFPERIKFIEENHENIMACAKSP
1h38A           VSMF-NPQGNDMTKGLLTLAKGKPI-GKEGYYWLKIHGANCAGVDKVPFPERIKFIEENHENIMACAKSP
3e2eA           VSMF-NPQGNDMTKGLLTLAKGKPI-GKEGYYWLKIHGANCAGVDKVPFPERIKFIEENHENIMACAKSP
3e3jC           VSMF-NPQGNDMTKGLLTLAKGKPI-GKEGYYWLKIHGANCAGVDKVPFPERIKFIEENHENIMACAKSP
1aroP           VSMF-NPQGNDMTKGLLTLAKGKPI-GKEGYYWLKIHGANCAGVDKVPFPERIKFIEENHENIMACAKSP


                         *         .         .         .         .         +         .:560
query           YDNRFWLTAEKPWQALAFCFEWQGYVAEGFAFHSHLPVQMDGTCNGLQNFSAMLLDEIGGAAVNLVPSDK
1s76D           LENTWWAEQDSPFCFLAFCFEYAGVQHHGLSYNCSLPLAFDGSCSGIQHFSAMLRDEVGGRAVNLLPSET
1mswD           LENTWWAEQDSPFCFLAFCFEYAGVQHHGLSYNCSLPLAFDGSCSGIQHFSAMLRDEVGGRAVNLLPSET
1s77D           LENTWWAEQDSPFCFLAFCFEYAGVQHHGLSYNCSLPLAFDGSCSGIQHFSAMLRDEVGGRAVNLLPSET
1cezA           LENTWWAEQDSPFCFLAFCFEYAGVQHHGLSYNCSLPLAFDGSCSGIQHFSAMLRDEVGGRAVNLLPSET
1h38A           LENTWWAEQDSPFCFLAFCFEYAGVQHHGLSYNCSLPLAFDGSCSGIQHFSAMLRDEVGGRAVNLLPSET
3e2eA           LENTWWAEQDSPFCFLAFCFEYAGVQHHGLSYNCSLPLAFDGSCSGIQHFSAMLRDEVGGRAVNLLPSET
3e3jC           LENTWWAEQDSPFCFLAFCFEYAGVQHHGLSYNCSLPLAFDGSCSGIQHFSAMLRDEVGGRAVNLLPSET
1aroP           LENTWWAEQDSPFCFLAFCFEYAGVQHHGLSYNCSLPLAFDGSCSGIQHFSAMLRDEVGGRAVNLLPSET


                         .         .         .         *         .         .         .:630
query           PNDIYATVASVLIAKLRDIAAACPXXXXXXXXXXXXXXXXXXIVVESDGSMARKWLAYGITRKVTKRPVM
1s76D           VQDIYGIVAK----KVNEILQADAINGTDN---------------EGTKALAGQWLAYGVTRSVTKRSVM
1mswD           VQDIYGIVAK----KVNEILQADAINGTDNEVVTVTDENTGEIVKLGTKALAGQWLAYGVTRSVTKRSVM
1s77D           VQDIYGIVAK----KVNEILQA-----------DAINGTDNEVVKLGTKALAGQWLAYGVTRSVTKRSVM
1cezA           VQDIYGIVAK----KVNEILQADAINGTDNEVVTVTDENTGEIVKLGTKALAGQWLAYGVTRSVTKRSVM
1h38A           VQDIYGIVAK----KVNEILQADAINGTDNEVVTVTDENTGEIVKLGTKALAGQWLAYGVTRSVTKRSVM
3e2eA           VQDIYGIVAK----KVNEILQADAINGTDNEVVTVTISEKVKLGTK---ALAGQWLAYGVTRSVTKRSVM
3e3jC           VQDIYGIVAK----KVNEILQADAINGTDNEVVTVTISEKVKLGTK---ALAGQWLAYGVTRSVTKRSVM
1aroP           VQDIYGIVAK----KVNEILQA-------------------DAINGGTKALAGQWLAYGVTRSVTKRSVM


                         .         +         .         .         .         .         *:700
query           TLAYGASEFGFREQVFTDTVTPWKQAAGEAFPFEGTGFAAASFLGLLIWDCXXXXXXXXXXXMDWLQKVA
1s76D           TLAYGSKEFGFRQQVLEDTIQP-AIDSGKGLMFTQPN-QAAGYMAKLIWXXXXXXXXXXXXXMNWLKSAA
1mswD           TLAYGSKEFGFRQQVLEDTIQP-AIDSGKGLMFTQPN-QAAGYMAKLIWXXXXXXXXXXXXXMNWLKSAA
1s77D           TLAYGSKEFGFRQQVLEDTIQP-AIDSGKGLMFTQPN-QAAGYMAKLIWXXXXXXXXXXXXXMNWLKSAA
1cezA           TLAYGSKEFGFRQQVLEDTIQP-AIDSGKGLMFTQPN-QAAGYMAKLIWXXXXXXXXXXXXXMNWLKSAA
1h38A           TLAYGSKEFGFRQQVLEDTIQP-AIDSGKGLMFTQPN-QAAGYMAKLIWXXXXXXXXXXXXXMNWLKSAA
3e2eA           TLAYGSKEFGFRQQVLEDTIQP-AIDSGKGLMFTQPN-QAAGYMAKLIWXXXXXXXXXXXXXMNWLKSAA
3e3jC           TLAYGSKEFGFRQQVLEDTIQP-AIDSGKGLMFTQPN-QAAGYMAKLIWXXXXXXXXXXXXXMNWLKSAA
1aroP           TLAYGSKEFGFRQQVLEDTIQP-AIDSGKGLMFTQPN-QAAGYMAKLIWXXXXXXXXXXXXXMNWLKSAA


                         .         .         .         .         +         .         .:770
query           KIAAKESLPVIWNTPAGLKVMQEYTTSEQKRLELTFQKVRLQLSIDVASKKIDKRKQGSGISPNWVHSMD
1s76D           KLLAAERCAVHWVTPDGFPVWQEYKKPIQTRLNLMFGQFRLQPTINTKDSEIDAHKQESGIAPNFVHSQD
1mswD           KLLAAERCAVHWVTPDGFPVWQEYKKPIQTRLNLMFGQFRLQPTINTKDSEIDAHKQESGIAPNFVHSQD
1s77D           KLLAAERCAVHWVTPDGFPVWQEYKKPIQTRLNLMFGQFRLQPTINTKDSEIDAHKQESGIAPNFVHSQD
1cezA           KLLAAERCAVHWVTPDGFPVWQEYKKPIQTRLNLMFGQFRLQPTINTKDSEIDAHKQESGIAPNFVHSQD
1h38A           KLLAAERCAVHWVTPDGFPVWQEYKKPIQTRLNLMFLG-------QFRDSEIDAHKQESGIAPNFVHSQD
3e2eA           KLLAAERCAVHWVTPDGFPVWQEYKKPIQTRLNLMFGQFRLQPTINTKDSEIDAHKQESGIAPNFVHSQD
3e3jC           KLLAAERCAVHWVTPDGFPVWQEYKKPIQTRLNLMFGQFRLQPTINTKDSEIDAHKQESGIAPNFVHSQD
1aroP           KLLAAERSAVHWVTPDGFPVWQEYKKPIQTRLNLMFGQFRLQPTINTKDSEIDAHKQESGIAPNFVHSQD


                         .         .         *         .         .         .         .:840
query           AAHMQLTVSRCHDEGIRSFSLIHDSYGTHAGNAWAMAQFLREEFVKMYGDHDVLAEFGREITAMLPEGTQ
1s76D           GSHLRKTVVWAHEKGIESFALIHDSFGTIPADAANLFKAVRETMVDTYESCDVLADFYDQFADQLHESDK
1mswD           GSHLRKTVVWAHEKGIESFALIHDSFGTIPADAANLFKAVRETMVDTYESCDVLADFYDQFADQLHESDK
1s77D           GSHLRKTVVWAHEKGIESFALIHDSFGTIPADAANLFKAVRETMVDTYESCDVLADFYDQFADQLHESDK
1cezA           GSHLRKTVVWAHEKGIESFALIHDSFGTIPADAANLFKAVRETMVDTYESCDVLADFYDQFADQLHESDK
1h38A           GSHLRKTVVWAHEKGIESFALIHDSFGTIPADAANLFKAVRETMVDTYESCDVLADFYDQFADQLHESDK
3e2eA           GSHLRKTVVWAHEKGIESFALIHDSFGTIPADAANLFKAVRETMVDTYESCDVLADFYDQFADQLHESDK
3e3jC           GSHLRKTVVWAHEKGIESFALIHDSFGTIPADAANLFKAVRETMVDTYESCDVLADFYDQFADQLHESDK
1aroP           GSHLRKTVVWAHEKGIESFALIHDSFGTIPADAANLFKAVRETMVDTYESSDVLADFYDQFADQLHESDK


                         +         .         .         .         .         *         .:910
query           LPPLPEKGSLDLSQVLESAFFFA
1s76D           MPALPAKGNLNLRDILESDFAFA
1mswD           MPALPAKGNLNLRDILESDFAFA
1s77D           MPALPAKGNLNLRDILESDFAFA
1cezA           MPALPAKGNLNLRDILESDFAFA
1h38A           MPALPAKGNLNLRDILESDFAFA
3e2eA           MPALPAKGNLNLRDILESDFAFA
3e3jC           MPALPAKGNLNLRDILESDFAFA
1aroP           MPALPAKGNLNLRDILES-----