[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for atum0:nouD

[Show Plain Result]

#ERROR : Can't open dsspfile "3iam4.bssp"
#ERROR : Can't open dsspfile "3i9v4.bssp"
#ERROR : Can't open dsspfile "2fug4.bssp"

## Summary of PDB Search
:396
    6e-92  44%  3iam4  [x.x.x] NADH-QUINONE OXIDOREDUCTASE SUBUNIT 4
    6e-92  44%  3i9v4  [x.x.x] NADH-QUINONE OXIDOREDUCTASE SUBUNIT 4
    6e-92  45%  2fug4  [x.x.x] NADH-QUINONE OXIDOREDUCTASE CHAIN 4
:396

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxPSAHGVLRLVLELDGEIVERVDPHIGLLHRGTEKLIETKTYLQAVPYFDRLDY
3iam4           ---------------------GVLRLMVTLSGEEVLEVVPHIGYLHTGFEKTMEHRTYLQNITYTPRMDY
3i9v4           ---------------------GVLRLMVTLSGEEVLEVVPHIGYLHTGFEKTMEHRTYLQNITYTPRMDY
2fug4           -----------------PSTHGVLRLMVTLSGEEVLEVVPHIGYLHTGFEKTMEHRTYLQNITYTPRMDY


                         .         .         *         .         .         .         .:140
query           VAPMNQEHAFALAVEKLLGLEIPMRGQLIRVLYSEIGRILSHIMNVTTQAMDVGAMTPPVWGFEEREKLM
3iam4           LHSFAHDLAYALAVEKLLGAVVPPRAETIRVILNELSRLASHLVFXXXXXXXXXXXXPFFYAFRERETIL
3i9v4           LHSFAHDLAYALAVEKLLGAVVPPRAETIRVILNELSRLASHLVFXXXXXXXXXXXXPFFYAFRERETIL
2fug4           LHSFAHDLAYALAVEKLLGAVVPPRAETIRVILNELSRLASHLVFXXXXXXXXXXXXPFFYAFRERETIL


                         +         .         .         .         .         *         .:210
query           VFYERACGARMHSAYVRPGGVHQDLPPELVDDIGKWCDPFLTVLDNIEGLLTDNRIYKQRNVDIGVVSLE
3iam4           DLFEWVTGQRFHHNYIRIGGVKEDLPEEFVPELKKLLEVLPHRIDEYEALFAESPIFYERARGVGVIPPE
3i9v4           DLFEWVTGQRFHHNYIRIGGVKEDLPEEFVPELKKLLEVLPHRIDEYEALFAESPIFYERARGVGVIPPE
2fug4           DLFEWVTGQRFHHNYIRIGGVKEDLPEEFVPELKKLLEVLPHRIDEYEALFAESPIFYERARGVGVIPPE


                         .         .         .         +         .         .         .:280
query           DAFAWGFTGVMVRGSGAAWDLRRSQPYECYSDLEFDIPVGKNGDCYDRYLIRMQEMRESVKIMKQCVDRL
3iam4           VAIDLGLTGGSLRASGVNYDVRKAYPYSGYETYTFDVPLGERGDVFDRMLVRIREMRESVKIIKQALERL
3i9v4           VAIDLGLTGGSLRASGVNYDVRKAYPYSGYETYTFDVPLGERGDVFDRMLVRIREMRESVKIIKQALERL
2fug4           VAIDLGLTGGSLRASGVNYDVRKAYPYSGY-----DVPLGERGDVFDRMLVRIREMRESVKIIKQALERL


                         .         *         .         .         .         .         +:350
query           SGKHRIGPVSSLDGKVVPPKRGEMKRSMEALIHHFKLYTEGYHVPAGEVYAAVEAPKGEFGVYVVADGSN
3iam4           EP----GPVRDPNPQITPPPRHLLETSMEAVIYHFKHYTEGFHPPKGEVYVPTESARGELGYYIVSDGGS
3i9v4           EP----GPVRDPNPQITPPPRHLLETSMEAVIYHFKHYTEGFHPPKGEVYVPTESARGELGYYIVSDGGS
2fug4           EP----GPVRDPNPQITPPPRHLLETSMEAVIYHFKHYTEGFHPPKGEVYVPTESARGELGYYIVSDGGS


                         .         .         .         .         *         .         .:420
query           KPYRCKIRAPGYAHLQAMDFLCKGHQLADVTAVLGSLDIVFGEVDR
3iam4           MPYRVKVRAPSFVNLQSLPYACKGEQVPDMVAIIASLDPVMGDVDR
3i9v4           MPYRVKVRAPSFVNLQSLPYACKGEQVPDMVAIIASLDPVMGDVDR
2fug4           MPYRVKVRAPSFVNLQSLPYACKGEQVPDMVAIIASLDPVMGDVDR