[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for atum0:AAK87429.2

[Show Plain Result]

#ERROR : Can't open dsspfile "2isjA.bssp"
#ERROR : Can't open dsspfile "3ge5B.bssp"
#ERROR : Can't open dsspfile "3ge5A.bssp"
#ERROR : Can't open dsspfile "3gh8D.bssp"
#ERROR : Can't open dsspfile "3gh8B.bssp"
#ERROR : Can't open dsspfile "3gh8A.bssp"
#ERROR : Can't open dsspfile "3gfdB.bssp"
#ERROR : Can't open dsspfile "3gfdA.bssp"
#ERROR : Can't open dsspfile "3gb5A.bssp"
#ERROR : Can't open dsspfile "2i7hE.bssp"
#ERROR : Can't open dsspfile "2i7hA.bssp"
#ERROR : Can't open dsspfile "3g14B.bssp"
#ERROR : Can't open dsspfile "3g14A.bssp"
#ERROR : Can't open dsspfile "3gr3A.bssp"
#ERROR : Can't open dsspfile "1bkjA.bssp"
#ERROR : Can't open dsspfile "3h4oA.bssp"

## Summary of PDB Search
:228
    6e-98  75%  2isjA  [x.x.x] BLUB
    2e-07  35%  3ge5B  [x.x.x] PUTATIVE NAD(P)H:FMN OXIDOREDUCTASE
    2e-07  35%  3ge5A  [x.x.x] PUTATIVE NAD(P)H:FMN OXIDOREDUCTASE
    6e-07  35%  3gh8D  [x.x.x] IODOTYROSINE DEHALOGENASE 1
    6e-07  35%  3gh8B  [x.x.x] IODOTYROSINE DEHALOGENASE 1
    6e-07  35%  3gh8A  [x.x.x] IODOTYROSINE DEHALOGENASE 1
    6e-07  35%  3gfdB  [x.x.x] IODOTYROSINE DEHALOGENASE 1
    6e-07  35%  3gfdA  [x.x.x] IODOTYROSINE DEHALOGENASE 1
    6e-07  35%  3gb5A  [x.x.x] IODOTYROSINE DEHALOGENASE 1
    3e-05  29%  2i7hE  [x.x.x] NITROREDUCTASE-LIKE FAMILY PROTEIN
    3e-05  29%  2i7hA  [x.x.x] NITROREDUCTASE-LIKE FAMILY PROTEIN
    7e-05  27%  3g14B  [x.x.x] NITROREDUCTASE FAMILY PROTEIN
    7e-05  27%  3g14A  [x.x.x] NITROREDUCTASE FAMILY PROTEIN
    1e-04  30%  3gr3A  [x.x.x] NITROREDUCTASE
    1e-04  30%  1bkjA  [d.90.1] NADPH-FLAVIN OXIDOREDUCTASE
    8e-04  30%  3h4oA  [x.x.x] NITROREDUCTASE FAMILY PROTEIN
:228

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxPFDHALSPARPFSGAEREAIYRAIETRRDVRDQFLPDPLPEELVERLLKAAHSAPSVGFMQPWNFT
2isjA           ---------LTAAGAFSSDERAAVYRAIETRRDVRDEFLPEPLSEELIARLLGAAHQAPSVGFMQPWNFV
3ge5B           ------------------------FRLIETRRSVR-KFIDRPVEEEKLA-ILEAGRIAPSAHNYQPWHFL
3ge5A           ------------------------FRLIETRRSVR-KFIDRPVEEEKLA-ILEAGRIAPSAHNYQPWHFL
3gh8D           ----PFSHTRYPEQEMRMRSQE-FYELLNKRRSVRF-ISSEHVPMEVIENVIKAAGTAPSGAHTEPWTFV
3gh8B           ----PFSHTRYPEQEMRMRSQE-FYELLNKRRSVRF-ISSEHVPMEVIENVIKAAGTAPSGAHTEPWTFV
3gh8A           ----PFSHTRYPEQEMRMRSQE-FYELLNKRRSVRF-ISSEHVPMEVIENVIKAAGTAPSGAHTEPWTFV
3gfdB           ----PFSHTRYPEQEMRMRSQE-FYELLNKRRSVRF-ISSEHVPMEVIENVIKAAGTAPSGAHTEPWTFV
3gfdA           ----PFSHTRYPEQEMRMRSQE-FYELLNKRRSVRF-ISSEHVPMEVIENVIKAAGTAPSGAHTEPWTFV
3gb5A           ----PFSHTRYPEQEMRMRSQE-FYELLNKRRSVRF-ISSEHVPMEVIENVIKAAGTAPSGAHTEPWTFV
2i7hE           ----------------------SIANVIKERRSVRT-FTDKAVEKDLLIELLNDATWAPNHKHREPWNCK
2i7hA           ----------------------SIANVIKERRSVRT-FTDKAVEKDLLIELLNDATWAPNHKHREPWNCK
3g14B           ------------------------YEVIKKRKSIK-KFEQTAIDRDKLLKIIDAR--APSWKNKTPYKFI
3g14A           ------------------------YEVIKKRKSIK-KFEQTAIDRDKLLKIIDAR--APSWKNKTPYKFI
3gr3A           -----------------------IFQSILSRKSIR-AFTDQPVTQETIREILKLAARAPSGTNLQPWQVI
1bkjA           ---------------------------ILAHRSIR-KFTAVPITDEQRQTIIQAGLAASSSSMLQVVSIV
3h4oA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           LVTDGGVRQAAWVAFSRANEEAAAMFEGEKQALYRSLKLEGIRKAPLSICVTCDPTRGGKVVLGRTHNPR
2isjA           LVRQDETREKVWQAFQRANDEAAEMFSGERQAKYRSLKLEGIRKAPLSICVTCDRTRGGAVVLGRTHNPQ
3ge5B           VVREE---------------------EGRKR-LAPCSQQPWFPGAPIYIITLGDHQRAWK----RGAGDS
3ge5A           VVREE---------------------EGRKR-LAPCSQQPWFPGAPIYIITLGDHQRAWK----RGAGDS
3gh8D           VVKD------------------------------------------------------------------
3gh8B           VVKD------------------------------------------------------------------
3gh8A           VVKD------------------------------------------------------------------
3gfdB           VVKD------------------------------------------------------------------
3gfdA           VVKD------------------------------------------------------------------
3gb5A           VVKD------------------------------------------------------------------
2i7hE           LYIGEGRKKLV--------DAVLNSFTEEERAKRGKILSDRFLSTPAQIVVYNEDPR---------QIQR
2i7hA           LYIGEGRKKLV--------DAVLNSFTEEERAKRGKILSDRFLSTPAQIVVYNEDPR---------QIQR
3g14B           VVESDKLKLD--IANAIENKTSAAS--------------EAVLNSPTIVAVA-NPEESGDV-------SG
3g14A           VVESDKLKLD--IANAIENKTSAAS--------------EAVLNSPTIVAVA-NPEESGDV-------SG
3gr3A           VLTGSGIRQWREPYLSRRRKVGLDLYKGDQEKLHQKAKNFLFYGAPVGLLFTIDHDEGSWLDLG------
1bkjA           RVTDSEKRELAQFAGNQAYVESAAEF--------LVFCIDYQRHATINPDVQADFTE--LTLIGA-----
3h4oA           ----------------------------EKEGINKLSKAANIYDAPLAILVCGDKDK----VWTRPFDGK


                         +         .         .         .         .         *         .:210
query           TDVYSTVCAIQNLWLAARAEGIGVGWVSIFHDSDVRAILDIPEHIEIVAWLCLGRVDALYTEPELAVKGW
2isjA           MDLYSTVCAVQNLWLAARAEGVGVGWVSIFHESEIKAILGIPDHVEIVAWLCLGFVDRLYQEPELAAKGW
3ge5B           VDIDTSIAT----YLEAHSLGLGCTWVCAFDQALCSEIFDIPSHTP-VSILALG-----YGDPTVPPREA
3ge5A           VDIDTSIAT----YLEAHSLGLGCTWVCAFDQALCSEIFDIPSHTP-VSILALG-----YGDPTVPPREA
3gh8D           ----------------------------------------------------------------------
3gh8B           ----------------------------------------------------------------------
3gh8A           ----------------------------------------------------------------------
3gfdB           ----------------------------------------------------------------------
3gfdA           ----------------------------------------------------------------------
3gb5A           ----------------------------------------------------------------------
2i7hE           DEDYAATCAFQNFQLLAWERGLGCVWKS------------------------------------------
2i7hA           DEDYAATCAFQNFQLLAWERGLGCVWKS------------------------------------------
3g14B           KEIYLIDTAIEHIVLGATDEGYGTCWIAAFNENKIKEALKIPDNLRVVALTPLG----------------
3g14A           KEIYLIDTAIEHIVLGATDEGYGTCWIAAFNENKIKEALKIPDNLRVVALTPLG----------------
3gr3A           ---FQTI-------LAARGFGLDTCAQAAFADKQIRSLLSVPSDRHII----------------------
1bkjA           --VDSGIMA-QNCLLAAESMGLGGVYIGGLRNSQVDELLGLPENSAVLFGMCLGHPD---QNPEV-----
3h4oA           TDIDTSIVTDH---LQATELGLASVWVCYFNPDIIREEFSLPDNLEPIN-ILLGYESKIPESPE---RHE


                         .         .         .         +         .         .         .:280
query           RQRVPLEELVFRNRWGGR
2isjA           RQRLPLEDLVFEEGWGVR
3ge5B           FNRKTIEEVV--------
3ge5A           FNRKTIEEVV--------
3gh8D           ------------------
3gh8B           ------------------
3gh8A           ------------------
3gfdB           ------------------
3gfdA           ------------------
3gb5A           ------------------
2i7hE           ------------------
2i7hA           ------------------
3g14B           ------------------
3g14A           ------------------
3gr3A           ------------------
1bkjA           KPRLPAHVVVHENQY---
3h4oA           KTRVPLSEIV--------