[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for atum0:dnaJ.3

[Show Plain Result]

#ERROR : Can't open dsspfile "2ochA.bssp"
#ERROR : Can't open dsspfile "2dn9A.bssp"
#ERROR : Can't open dsspfile "2o37A.bssp"
#ERROR : Can't open dsspfile "2cugA.bssp"
#ERROR : Can't open dsspfile "2ej7A.bssp"
#ERROR : Can't open dsspfile "2ctpA.bssp"
#ERROR : Can't open dsspfile "1hdjA.bssp"
#ERROR : Can't open dsspfile "2dmxA.bssp"
#ERROR : Can't open dsspfile "2ctrA.bssp"
#ERROR : Can't open dsspfile "2ctwA.bssp"
#ERROR : Can't open dsspfile "1gh6A.bssp"
#ERROR : Can't open dsspfile "2yuaA.bssp"
#ERROR : Can't open dsspfile "1xblA.bssp"
#ERROR : Can't open dsspfile "1bq0A.bssp"
#ERROR : Can't open dsspfile "3hhoC.bssp"
#ERROR : Can't open dsspfile "3hhoB.bssp"
#ERROR : Can't open dsspfile "3hhoA.bssp"

## Summary of PDB Search
:200
    3e-11  47%  2ochA  [x.x.x] HYPOTHETICAL PROTEIN DNJ-12
    5e-11  46%  2dn9A  [x.x.x] DNAJ HOMOLOG SUBFAMILY A MEMBER 3
    1e-10  44%  2o37A  [x.x.x] PROTEIN SIS1
    2e-10  43%  2cugA  [x.x.x] MKIAA0962 PROTEIN
    1e-09  42%  2ej7A  [x.x.x] HCG3 GENE
    2e-09  42%  2ctpA  [x.x.x] DNAJ HOMOLOG SUBFAMILY B MEMBER 12
    3e-09  44%  1hdjA  [x.x.x] HUMAN HSP40
    2e-08  41%  2dmxA  [x.x.x] DNAJ HOMOLOG SUBFAMILY B MEMBER 8
    1e-07  39%  2ctrA  [x.x.x] DNAJ HOMOLOG SUBFAMILY B MEMBER 9
    3e-07  35%  2ctwA  [x.x.x] DNAJ HOMOLOG SUBFAMILY C MEMBER 5
    2e-06  42%  1gh6A  [a.2.3] LARGE T ANTIGEN
    5e-06  43%  2yuaA  [x.x.x] WILLIAMS-BEUREN SYNDROME CHROMOSOME REGION 18
    8e-06  37%  1xblA  [x.x.x] DNAJ
    8e-06  37%  1bq0A  [x.x.x] DNAJ
    6e-04  34%  3hhoC  [x.x.x] CO-CHAPERONE PROTEIN HSCB HOMOLOG
    6e-04  34%  3hhoB  [x.x.x] CO-CHAPERONE PROTEIN HSCB HOMOLOG
    6e-04  34%  3hhoA  [x.x.x] CO-CHAPERONE PROTEIN HSCB HOMOLOG
:200

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MIDPYVLLGVERDADEAAIKTAYRKVAKAAHPDSGGDGEQFARLQTAYELLKDPVRRRVFDDTGYDPQLA
2ochA           ----YDVLGVKPDASDNELKKAYRKMALKFHPDKNPDGEQFKQISQAYEVLSDEKKRQIYDQGG------
2dn9A           --DYYQILGVPRNASQKEIKKAYYQLAKKYHPDTNKDDEKFSQLAEAYEVLSDEVKRKQYDAYGSGP---
2o37A           ----YDLLGVSPSANEQELKKGYRKAALKYHPDKPGDTEKFKEISEAFEILNDPQKREIYDQYGLE----
2cugA           --DPYRVLGVSRTASQADIKKAYKKLAREWHPDKNGAEDRFIQISKAYEILSNEEKRTNYDHYGSGP---
2ej7A           MVDYYEVLDVPRQASSEAIKKAYRKLALKWHPDKNPENKEFKQVAEAYEVLSDAKKRDIYDRYGSGP---
2ctpA           --DYYEILGVSRGASDEDLKKAYRRLALKFHPDKNGATEAFKAIGTAYAVLSNPEKRKQYDQFGSGP---
1hdjA           --DYYQTLGLARGASDEEIKRAYRRQALRYHPDKNGAEEKFKEIAEAYDVLSDPRKREIFDRYG------
2dmxA           MANYYEVLGVQASASPEDIKKAYRKLALRWHPDKNPDNKEFKLVSEAYEVLSDSKKRSLYDRAGCD----
2ctrA           ----YDILGVPKSASERQIKKAFHKLAMKYHPDKNKSPDKFREIAEAYETLSDANRRKEYDTLGH-----
2ctwA           ----YHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDADKFKEINNAHAILTDATKRNIYDKYG------
1gh6A           ------LLGLERSANIPLMRKAYLKKCKEFHPDKGGDEEKMKKMNTLYKKMEDGVK--------------
2yuaA           ----YDLLGVPSTATQAQIKAAYYRQCFLYHPDSAEAAERFTRISQAYVVLGSATLRR-----KYDRGLL
1xblA           --DYYEILGVSKTAEEREIRKAYKRLAMKYHPDNQGDXXXXXXXXXXYEVLTDSQKRAAYDQYGH-----
1bq0A           --DYYEILGVSKTAEEREIRKAYKRLAMKYHPDNQGDXXXXXXXXXXYEVLTDSQKRAAYDQYGH-----
3hhoC           -------LPIQFELDGSLLSSQFRALQKRFHPDNFATAQQAAQINDAYQTLKDPLRR-------------
3hhoB           -------LPIQFELDGSLLSSQFRALQKRFHPDNFATAQQAAQINDAYQTLKDPLRR-------------
3hhoA           -------LPIQFELDGSLLSSQFRALQKRFHPDNFATAQQAAQINDAYQTLKDPLRR-------------


                         .         .         *         .         .         .         .:140
query           DAKDLKGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2ochA           ----------------------------------------------------------------------
2dn9A           ----------------------------------------------------------------------
2o37A           ----------------------------------------------------------------------
2cugA           ----------------------------------------------------------------------
2ej7A           ----------------------------------------------------------------------
2ctpA           ----------------------------------------------------------------------
1hdjA           ----------------------------------------------------------------------
2dmxA           ----------------------------------------------------------------------
2ctrA           ----------------------------------------------------------------------
2ctwA           ----------------------------------------------------------------------
1gh6A           ----------------------------------------------------------------------
2yuaA           SDEDLRG---------------------------------------------------------------
1xblA           ----------------------------------------------------------------------
1bq0A           ----------------------------------------------------------------------
3hhoC           ----------------------------------------------------------------------
3hhoB           ----------------------------------------------------------------------
3hhoA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2ochA           ------------------------------------------------------------
2dn9A           ------------------------------------------------------------
2o37A           ------------------------------------------------------------
2cugA           ------------------------------------------------------------
2ej7A           ------------------------------------------------------------
2ctpA           ------------------------------------------------------------
1hdjA           ------------------------------------------------------------
2dmxA           ------------------------------------------------------------
2ctrA           ------------------------------------------------------------
2ctwA           ------------------------------------------------------------
1gh6A           ------------------------------------------------------------
2yuaA           ------------------------------------------------------------
1xblA           ------------------------------------------------------------
1bq0A           ------------------------------------------------------------
3hhoC           ------------------------------------------------------------
3hhoB           ------------------------------------------------------------
3hhoA           ------------------------------------------------------------