[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for atum0:csaA

[Show Plain Result]

#ERROR : Can't open dsspfile "2q2iA.bssp"
#ERROR : Can't open dsspfile "2q2hA.bssp"
#ERROR : Can't open dsspfile "2q2iB.bssp"
#ERROR : Can't open dsspfile "2q2hB.bssp"
#ERROR : Can't open dsspfile "2nzoA.bssp"
#ERROR : Can't open dsspfile "2nzhB.bssp"
#ERROR : Can't open dsspfile "2nzhA.bssp"
#ERROR : Can't open dsspfile "2nzoC.bssp"
#ERROR : Can't open dsspfile "3g48A.bssp"
#ERROR : Can't open dsspfile "3g48B.bssp"
#ERROR : Can't open dsspfile "1gd7A.bssp"
#ERROR : Can't open dsspfile "1mkhA.bssp"
#ERROR : Can't open dsspfile "1pybA.bssp"
#ERROR : Can't open dsspfile "1pxfA.bssp"
#ERROR : Can't open dsspfile "3ersX.bssp"

## Summary of PDB Search
:113
    9e-62 100%  2q2iA  [x.x.x] SECRETION CHAPERONE
    9e-62 100%  2q2hA  [x.x.x] SECRETION CHAPERONE, PHAGE-DISPLAY DERIVED
    2e-58 100%  2q2iB  [x.x.x] SECRETION CHAPERONE
    2e-56 100%  2q2hB  [x.x.x] SECRETION CHAPERONE, PHAGE-DISPLAY DERIVED
    6e-35  64%  2nzoA  [x.x.x] PROTEIN CSAA
    6e-35  64%  2nzhB  [x.x.x] PROTEIN CSAA
    6e-35  64%  2nzhA  [x.x.x] PROTEIN CSAA
    7e-31  64%  2nzoC  [x.x.x] PROTEIN CSAA
    2e-28  51%  3g48A  [x.x.x] CHAPERONE CSAA
    3e-25  50%  3g48B  [x.x.x] CHAPERONE CSAA
    2e-22  49%  1gd7A  [b.40.4] CSAA PROTEIN
    2e-10  35%  1mkhA  [b.40.4] C-TERMINAL DOMAIN OF METHIONYL-TRNA SYNTHETASE
    2e-09  33%  1pybA  [b.40.4] METHIONYL-TRNA SYNTHETASE BETA SUBUNIT
    2e-07  30%  1pxfA  [b.40.4] HYPOTHETICAL PROTEIN YGJH
    2e-07  30%  3ersX  [x.x.x] TRNA-BINDING PROTEIN YGJH
:113

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xSGEISYADFEKVDIRVGTIVEAVPFPEARKPAIKVKIDFGPEIGIKKSSAQITVHYTPESLVGRQVLGV
2q2iA           -SGEISYADFEKVDIRVGTIVEAVPFPEARKPAIKVKIDFGPEIGIKKSSAQITVHYTPESLVGRQVLGV
2q2hA           -SGEISYADFEKVDIRVGTIVEAVPFPEARKPAIKVKIDFGPEIGIKKSSAQITVHYTPESLVGRQVLGV
2q2iB           -SGEISYADFEKVDIRVGTIVEAVPFPE---PAIKVKIDFGPEIGIKKSSAQITVHYTPESLVGRQVLGV
2q2hB           --GEISYADFEKVDIRVGTIVEAVPFP-----AIKVKIDFGPEIGIKKSSAQITVHYTPESLVGRQVLGV
2nzoA           --------DFEKLDIRTGTIVKAEEFPEARVPAIKLVIDFGTEIGIKQSSAQITKRYKPEGLINKQVIAV
2nzhB           --------DFEKLDIRTGTIVKAEEFPEARVPAIKLVIDFGTEIGIKQSSAQITKRYKPEGLINKQVIAV
2nzhA           --------DFEKLDIRTGTIVKAEEFPEARVPAIKLVIDFGTEIGIKQSSAQITKRYKPEGLINKQVIAV
2nzoC           --------DFEKLDIRTGTIVKAEEFP-----AIKLVIDFGTEIGIKQSSAQITKRYKPEGLINKQVIAV
3g48A           -----NFEDFLTLDLRIGTVTHAEEFKEARVPAIRLEIDFG-ELGMKQSSAQITKRYNPEDLIGQQIVAV
3g48B           -----NFEDFLTLDLRIGTVTHAEEFP-----AIRLEIDFG-ELGMKQSSAQITKRYNPEDLIGQQIVAV
1gd7A           ---------FQILDLRVGRVLRAEPHEKARKPSYKLWVDLGP-LGVKQSSAQITELYRPEDLVGRLVVCA
1mkhA           ----VKFDDFAKLDLRVGKIIEVKDHPNADKLYV-VKVDLGDE--VRTLVAGLKKYYKPEELLNRYVVVV
1pybA           ----IGIEDFLKVDLRVAKVLSAERV-EGSEKLLKLTLSLGDEE--RTVVAGIAKYYTPEELVGKKIVIV
1pxfA           ----VAYADFARLEMRVGKIVEVKRHENADKLYI-VQVDVGQK--TLQTVTSLVPYYSEEELMGKTVVVL
3ersX           ----VAYADFARLEMRVGKIVEVKRHENADKLYI-VQVDVGQK--TLQTVTSLVPYYSEEELMGKTVVVL


                         .         .         *         .         .         .         .:140
query           VNFPPRQIGPFRSEVLTLGFADANGDIVLAAVERPVPNGEKMC
2q2iA           VNFPPRQIGPFRSEVLTLGFADANGDIVLAAVERPVPNGEKMC
2q2hA           VNFPPRQIGPFRSEVLTLGFADANGDIVLAAVERPVPNGEKMC
2q2iB           VNFPPRQIGPFRSEVLTLGFADANGDIVLAAVERPVPNGEKMC
2q2hB           VNFPPRQIGPFRSEVLTLGFADANGDIVLAAVERPVPNGEKMC
2nzoA           VNFPPRRIAGFKSEVLVLGGIPGQGDVVLLQPDQPVPNGTKI-
2nzhB           VNFPPRRIAGFKSEVLVLGGIPGQGDVVLLQPDQPVPNGTKI-
2nzhA           VNFPPRRIAGFKSEVLVLGGIPGQGDVVLLQPDQPVPNGTKI-
2nzoC           VNFPPRRIAGFKSEVLVLGGIPGQGDVVLLQPDQPVPNGTKI-
3g48A           VNFPPKRVAGFKSEVLVLGGVPEAGDVVLLQPNMELPNGTKI-
3g48B           VNFPPKRVAGFKSEVLVLGGVPEAGDVVLLQPNMELPNGTKI-
1gd7A           VNLGAKRVAGFLSEVLVLGVPDEAGRVVLLAPDREVPLGGKV-
1mkhA           ANLEPKKLG-IGSQGMLLA-ADDGERVALLMPDKEVKLGAKV-
1pybA           ANLKPRKIFGIESQGMILAASDGE-NLSVIVPDRDVKEGAKL-
1pxfA           CNLQKAKMRGETSECMLLAETDDGSESVLLTPERMMPAGVRV-
3ersX           CNLQKAKMRGETSECMLLAETDDGSESVLLTPERMMPAGVRV-