[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for atum0:AAK87977.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3exzC.bssp"
#ERROR : Can't open dsspfile "3exzB.bssp"
#ERROR : Can't open dsspfile "3exzA.bssp"
#ERROR : Can't open dsspfile "1q6wG.bssp"
#ERROR : Can't open dsspfile "1q6wC.bssp"
#ERROR : Can't open dsspfile "1q6wA.bssp"

## Summary of PDB Search
:155
    2e-19  41%  3exzC  [x.x.x] MAOC-LIKE DEHYDRATASE
    2e-19  41%  3exzB  [x.x.x] MAOC-LIKE DEHYDRATASE
    2e-19  41%  3exzA  [x.x.x] MAOC-LIKE DEHYDRATASE
    6e-06  29%  1q6wG  [d.38.1] MONOAMINE OXIDASE REGULATORY PROTEIN, PUTATIVE
    6e-06  29%  1q6wC  [d.38.1] MONOAMINE OXIDASE REGULATORY PROTEIN, PUTATIVE
    6e-06  29%  1q6wA  [d.38.1] MONOAMINE OXIDASE REGULATORY PROTEIN, PUTATIVE
:155

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxIGERVTLDTLHFSAEDIIRFARDFDPQPFHLDAEAARNSVFGGLCASGWHTGAGWMKSFLSH
3exzC           --------VGDRFDSARHRVEAAAIKAFAGEFDPQPFHLDEEAARHSLFGGLAASGWHTAA---------
3exzB           --------VGDRFDSARHRVEAAAIKAFAGEFDPQPFHLDEEAARHSLFGGLAASGWHTAA---------
3exzA           --------VGDRFDSARHRVEAAAIKAFAGEFDPQPFHLDEEAARHSLFGGLAASGWHTAA---------
1q6wG           --------IGEKIEGLPRTVTETDIWTFAYTADFFPLHTDVEFAKKTIFGKPIAQG----------LVLS
1q6wC           --------IGEKIEGLPRTVTETDIWTFAYTADFFPLHTDVEFAKKTIFGKPIAQG----------LVLS
1q6wA           --------IGEKIEGLPRTVTETDIWTFAYTADFFPLHTDVEFAKKTIFGKPIAQG----------LVLS


                         .         .         *         .         .         .         .:140
query           WAKEVKRLKLQGLEPPKLGPSPGFRELKWKKPVFAGDDVTYFVTLLDARPLESRPGIWLNITFNEGVNQS
3exzC           ----ITRLLVTSGLPLAQGIIGAGTELSWPNPTRPGDELHVETTVLAITPSKSRPDRAIVTCQSDTLNQR
3exzB           ----ITRLLVTSGLPLAQGIIGAGTELSWPNPTRPGDELHVETTVLAITPSKSRPDRAIVTCQSDTLNQR
3exzA           ----ITRLLVTSGLPLAQGIIGAGTELSWPNPTRPGDELHVETTVLAITPSKSRPDRAIVTCQSDTLNQR
1q6wG           IALGVDQVILSNYDVSSVIAFFGIKDVRFLRPVFIGDTIAASAEVVEKQDFDEKSGV---VTYKEVKNQR
1q6wC           IALGVDQVILSNYDVSSVIAFFGIKDVRFLRPVFIGDTIAASAEVVEKQDFDEKSGV---VTYKEVKNQR
1q6wA           IALGVDQVILSNYDVSSVIAFFGIKDVRFLRPVFIGDTIAASAEVVEKQDFDEKSGV---VTYKEVKNQR


                         +         .         .         .         .         *         .:210
query           GETVLTFQSGVLEFx
3exzC           GEVVQRSTAKVVVF-
3exzB           GEVVQRSTAKVVVF-
3exzA           GEVVQRSTAKVVVF-
1q6wG           GELVLT---------
1q6wC           GELVLT---------
1q6wA           GELVLT---------