[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for atum0:ordL.3

[Show Plain Result]

#ERROR : Can't open dsspfile "1ryiA.bssp"
#ERROR : Can't open dsspfile "1ng3A.bssp"
#ERROR : Can't open dsspfile "2fjcC.bssp"
#ERROR : Can't open dsspfile "2fjcB.bssp"
#ERROR : Can't open dsspfile "2fjcA.bssp"

## Summary of PDB Search
:427
    3e-06  21%  1ryiA  [x.x.x] GLYCINE OXIDASE
    3e-06  21%  1ng3A  [c.3.1 - d.16.1] GLYCINE OXIDASE
    7e-04  35%  2fjcC  [x.x.x] ANTIGEN TPF1
    7e-04  35%  2fjcB  [x.x.x] ANTIGEN TPF1
    7e-04  35%  2fjcA  [x.x.x] ANTIGEN TPF1
:427

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ryiA           ----------------------------------------------------------------------
1ng3A           ----------------------------------------------------------------------
2fjcC           ----------------------------------------------------------------------
2fjcB           ----------------------------------------------------------------------
2fjcA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxETYGERLLDLLGDAPVLVRELVEKHGIPCEIEKNGTLHCAVGEKGLAEI
1ryiA           -----------------------HSQRLYKGLGE------ELYALSGVDIRQHNGGMFKLAFSEEDVLQL
1ng3A           -----------------------HSQRLYKGLGE------ELYALSGVDIRQHNGGMFKLAFSEEDVLQL
2fjcC           ---------------------DTIAERLLQLGAQAPASMAEYLALSGIAEETEKEITIVSA-----LARV
2fjcB           ---------------------DTIAERLLQLGAQAPASMAEYLALSGIAEETEKEITIVSA-----LARV
2fjcA           ---------------------DTIAERLLQLGAQAPASMAEYLALSGIAEETEKEITIVSA-----LARV


                         +         .         .         .         .         *         .:210
query           RERCEQWSARGAPVRVLDADETASYIGSTAYSGALLDSRAGTIQPLAYVRGLAGAALKAGVRLHTASPVN
1ryiA           RQMDDSWYSKEEVL------EKEPYASGDIFGASFIQDDVH-VEPYFVCKAYVKAAKMLGAEIFEHTPVL
1ng3A           RQMDDSWYSKEEVL------EKEPYASGDIFGASFIQDDVH-VEPYFVCKAYVKAAKMLGAEIFEHTPVL
2fjcC           KRDFEYLSTRFSQTQVLAAES-----GDAVTDGIITD----ILRTLGKAIWMLGATLKA-----------
2fjcB           KRDFEYLSTRFSQTQVLAAES-----GDAVTDGIITD----ILRTLGKAIWMLGATLKA-----------
2fjcA           KRDFEYLSTRFSQTQVLAAES-----GDAVTDGIITD----ILRTLGKAIWMLGATLKA-----------


                         .         .         .         +         .         .         .:280
query           ETGRNGAKWVVKTPEGSVTAKWIVVATEAYSTGPWQIIREEQVYLPYFNFATRPLSDNLQKSILPGRQGC
1ryiA           HVERDGEALFIKTPSGDVWANHVVVASGVWSGMFFKQLGLNNAFLPVKGECLSVWNDDIPLTKTLYHDHC
1ng3A           HVERDGEALFIKTPSGDVWANHVVVASGVWSGMFFKQLGLNNAFLPVKGECLSVWNDDIPLTKTLYHDHC
2fjcC           ----------------------------------------------------------------------
2fjcB           ----------------------------------------------------------------------
2fjcA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           WDTKEILSSFRMDKAGRLVFGSVGALRGTGTAIHRAWAKRSLKRLFPQLGDTEFECEWYGQIGMTDNAVP
1ryiA           YIVPR--------KSGRLVVGATGDWSETPDLGGLESVMKKAKTMLPAIQNMKVDRFWAGLRPGTKDGKP
1ng3A           YIVPR--------KSGRLVVGATGDWSETPDLGGLESVMKKAKTMLPPIQNMKVDRFWAGLRPGTKDGKP
2fjcC           ----------------------------------------------------------------------
2fjcB           ----------------------------------------------------------------------
2fjcA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           RFHKFAENVIGFSGYNGRGIAPGTAFGKVIAQHILGEIAEADxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ryiA           YIGRHPEDILFAAGHFRNGILLAPATGALISDLIMNKEVNQD----------------------------
1ng3A           YIGRHPEDILFAAGHFRNGILLAPATGALISDLIMNKEVNQD----------------------------
2fjcC           ----------------------------------------------------------------------
2fjcB           ----------------------------------------------------------------------
2fjcA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxx
1ryiA           -------
1ng3A           -------
2fjcC           -------
2fjcB           -------
2fjcA           -------