[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for atum0:cbiC

[Show Plain Result]

#ERROR : Can't open dsspfile "1f2vA.bssp"
#ERROR : Can't open dsspfile "3e7dC.bssp"
#ERROR : Can't open dsspfile "3e7dB.bssp"
#ERROR : Can't open dsspfile "3e7dA.bssp"
#ERROR : Can't open dsspfile "1v9cB.bssp"
#ERROR : Can't open dsspfile "2afvA.bssp"
#ERROR : Can't open dsspfile "2afrA.bssp"
#ERROR : Can't open dsspfile "1v9cA.bssp"
#ERROR : Can't open dsspfile "1ou0B.bssp"
#ERROR : Can't open dsspfile "1ou0C.bssp"
#ERROR : Can't open dsspfile "1ou0A.bssp"

## Summary of PDB Search
:210
    3e-84  72%  1f2vA  [c.23.17] PRECORRIN-8X METHYLMUTASE
    1e-66  62%  3e7dC  [x.x.x] COBH, PRECORRIN-8X METHYLMUTASE
    1e-66  62%  3e7dB  [x.x.x] COBH, PRECORRIN-8X METHYLMUTASE
    1e-66  62%  3e7dA  [x.x.x] COBH, PRECORRIN-8X METHYLMUTASE
    3e-25  40%  1v9cB  [c.23.17] PRECORRIN-8X METHYL MUTASE
    8e-25  34%  2afvA  [x.x.x] COBALAMIN BIOSYNTHESIS PRECORRIN ISOMERASE
    8e-25  34%  2afrA  [x.x.x] COBALAMIN BIOSYNTHESIS PRECORRIN ISOMERASE
    6e-23  37%  1v9cA  [c.23.17] PRECORRIN-8X METHYL MUTASE
    2e-17  36%  1ou0B  [c.23.17] PRECORRIN-8X METHYLMUTASE RELATED PROTEIN
    5e-17  36%  1ou0C  [c.23.17] PRECORRIN-8X METHYLMUTASE RELATED PROTEIN
    5e-17  36%  1ou0A  [c.23.17] PRECORRIN-8X METHYLMUTASE RELATED PROTEIN
:210

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxDYDYIRDGNAIYERSFAIIREEADLSAFTEEQADIAIRMIHACGQVEAAGHFRFSPDFVSAARGALLA
1f2vA           --EYDYIRDGNAIYERSFAIIRAEADLSRFSEEEADLAVRMVHACGSVEATRQFVFSPDFVSSARAALKA
3e7dC           -----YIRDGQAIYDRSFAIIRAEADLRHIPADLEKLAVRVIHACGMVDVANDLAFSEGAGKAGRNALLA
3e7dB           -----YIRDGQAIYDRSFAIIRAEADLRHIPADLEKLAVRVIHACGMVDVANDLAFSEGAGKAGRNALLA
3e7dA           -----YIRDGQAIYDRSFAIIRAEADLRHIPADLEKLAVRVIHACGMVDVANDLAFSEGAGKAGRNALLA
1v9cB           ---------GRAIEEESFRIVDQEAGPHGFSPLEWPVVRRMIHATADFEYKALTRFSQGAVEAGLKAIQA
2afvA           ---------GRNIENKSFSIIDEEAGPHSFAQEEWEVVRRIIHATADFDYKNITKIHPQAIDSGIQALKK
2afrA           ---------GRNIENKSFSIIDEEAGPHSFAQEEWEVVRRIIHATADFDYKNITKIHPQAIDSGIQALKK
1v9cA           -----------AIEEESFRIVDQEAGPHGFSPLEWPVVRRMIHATADFEYKALTRFSQGAVEAGLKAIQA
1ou0B           ----------------------EERSLAAIDSIDPDISVKAIHAAGDFAIAPLIRYSDGFFKSL-AKLKE
1ou0C           ------------------------------------IVVKAIHAAGDFAIAPLIRYSDGFFKSL-AKLKE
1ou0A           ------------------------------------IVVKAIHAAGDFAIAPLIRYSDGFFKSL-AKLKE


                         .         .         *         .         .         .         .:140
query           GKPVLCDAQMVAHGVTHARLPADNAVICTLRDPRTPELAKNIGNTRSXXXXXXXXXXXXXXXVAIGNAPT
1f2vA           GAPILCDAEMVAHGVTRARLPAGNEVICTLRDPRTPALAAEIGNTRSAAALKLWSERLAGSVVAIGNAPT
3e7dC           GAPILCDARMVAEGITRSRLPADNRVIYTLSDPSVPELAKKIGNTRSAAALDLWLPHIEGSIVAIGNAPT
3e7dB           GAPILCDARMVAEGITRSRLPADNRVIYTLSDPSVPELAKKIGNTRSAAALDLWLPHIEGSIVAIGNAPT
3e7dA           GAPILCDARMVAEGITRSRLPADNRVIYTLSDPSVPELAKKIGNTRSAAALDLWLPHIEGSIVAIGNAPT
1v9cB           GARILVDARMIACGLNPERLRLGNEVVELLAHPEVXXXXXXXXXXXXXXXXXXXXGLLDGAIVGVGNAPT
2afvA           GCPIVCDVQMILSGLNPERLKVYGCTYCFISDEDVIENAKRKNSTRASIQKANSFNLLNESIIVIGNAPT
2afrA           GCPIVCDVQMILSGLNPERLKVYGCTYCFISDEDVIENAKRKNSTRASIQKANSFNLLNESIIVIGNAPT
1v9cA           GARILVDARMIACGLNPERLRLGNEVVELLAHPXXXXXXXXXXXXXXXWEKGLLDGAI----VGVGNAPT
1ou0B           GCTIICDSEVRA-GIYSRPVLERNRVVCYLNDVRSKEADVN-GITRSAAGIRIAQDHRNSVIV-IGNAPT
1ou0C           GCTIICDSEVRA-GIYSRPVLERNRVVCYLNDVRSKEADVN-GITRSAAGIRIAQDHRNSVIV-IGNAPT
1ou0A           GCTIICDSEVRA-GIYSRPVLERNRVVCYLNDVRSKEADVN-GITRSAAGIRIAQDHRNSVIV-IGNAPT


                         +         .         .         .         .         *         .:210
query           ALFYLLEMLEKGGPRPAAIIGMPVGFVGAAESKDALEASALGIPYAIVKGRLGGSAMTAAAINAVARAGL
1f2vA           ALFFLLEMLRDGAPKPAAILGMPVGFVGAAESKDALAENSYGVPFAIVRGRLGGSAMTAAALNSLARPGL
3e7dC           ALFRLFELLDAGAPKPALIIGMPVGFVGAAESKDELAANSRGVPYVIVRGRRGGSAMTAAAVNALA----
3e7dB           ALFRLFELLDAGAPKPALIIGMPVGFVGAAESKDELAANSRGVPYVIVRGRRGGSAMTAAAVNALA----
3e7dA           ALFRLFELLDAGAPKPALIIGMPVGFVGAAESKDELAANSRGVPYVIVRGRRGGSAMTAAAVNALA----
1v9cB           FLLALVEAIRQGA-RPALVLGMPVGFVNVLEAKRALMEAP--VPWIVTEGRKGGSTLVVAALHALIR---
2afvA           ALLEIEKLIRQEGIKPALIVGVPVGFVSAKESKESIYYNVTSIPYILTMGRKGGS---------------
2afrA           ALLEIEKLIRQEGIKPALIVGVPVGFVSAKESKESIYYNVTSIPYILTMGRKGGS---------------
1v9cA           FLLALVEAIRQGA-RPALVLGMPVGFVNVLEAKRALMEAP--VPWIVTEGRKGGSTLVVAALHALIR---
1ou0B           AL--LEARIEENGWYDIPIVGIPVGFINASKAKEGLVSS--HIEYISVEGHRGGSPIAASIVNGFGR---
1ou0C           AL--LEARIEENGWYDIPIVGIPVGFINASKAKEGLVSS--HIEYISVEGHRGGSPIAASIVNGFGR---
1ou0A           AL--LEARIEENGWYDIPIVGIPVGFINASKAKEGLVSS--HIEYISVEGHRGGSPIAASIVNGFGR---