[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for atum0:AAK85845.1

[Show Plain Result]


## Summary of Sequence Search
    1::298
    1::289     6e-76  48%  289 aa  ACCD_METFK RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    3::284     6e-74  46%  324 aa  ACCD_METCA RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::287     2e-73  48%  304 aa  ACCD_SHIBS RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::283     7e-73  48%  303 aa  ACCD_YERE8 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::283     9e-73  48%  304 aa  ACCD_YERPY RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::283     9e-73  48%  304 aa  ACCD_YERPS RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::283     9e-73  48%  304 aa  ACCD_YERPG RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::283     9e-73  48%  304 aa  ACCD_YERPE RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::283     9e-73  48%  304 aa  ACCD_YERPB RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::283     9e-73  48%  304 aa  ACCD_YERPA RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::283     9e-73  48%  304 aa  ACCD_YERP3 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::283     1e-72  48%  304 aa  ACCD_YERPP RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::283     2e-72  48%  304 aa  ACCD_YERPN RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    3::286     7e-72  47%  290 aa  ACCD_PSEAE RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    3::286     7e-72  47%  290 aa  ACCD_PSEAB RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    5::282     9e-72  48%  316 aa  ACCD_MICAN RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::287     1e-71  47%  304 aa  ACCD_ECOL6 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::287     2e-71  47%  304 aa  ACCD_SALTY RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::287     2e-71  47%  304 aa  ACCD_SALTI RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::287     2e-71  47%  304 aa  ACCD_SALSV RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::287     2e-71  47%  304 aa  ACCD_SALPK RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::287     2e-71  47%  304 aa  ACCD_SALPB RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::287     2e-71  47%  304 aa  ACCD_SALPA RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::287     2e-71  47%  304 aa  ACCD_SALNS RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::287     2e-71  47%  304 aa  ACCD_SALHS RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::287     2e-71  47%  304 aa  ACCD_SALG2 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::287     2e-71  47%  304 aa  ACCD_SALEP RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::287     2e-71  47%  304 aa  ACCD_SALDC RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::287     2e-71  47%  304 aa  ACCD_SALCH RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::287     2e-71  47%  304 aa  ACCD_SALA4 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    3::286     2e-71  47%  290 aa  ACCD_PSEA7 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::287     2e-71  47%  304 aa  ACCD_SALAR RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::287     2e-71  46%  290 aa  ACCD_BURP8 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::287     3e-71  47%  295 aa  ACCD_XANAC RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::287     3e-71  47%  304 aa  ACCD_SHISS RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::291     3e-71  44%  314 aa  ACCD_PHOLL RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::284     3e-71  46%  296 aa  ACCD_HAEIN RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::284     3e-71  46%  296 aa  ACCD_HAEIG RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::284     3e-71  46%  296 aa  ACCD_HAEIE RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::284     3e-71  46%  296 aa  ACCD_HAEI8 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::287     3e-71  47%  304 aa  ACCD_ECOL5 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::291     3e-71  47%  310 aa  ACCD_CHRSD RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::281     4e-71  46%  320 aa  ACCD_PROMH RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::289     4e-71  46%  306 aa  ACCD_ENTS8 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::287     4e-71  47%  304 aa  ACCD_ECOUT RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::287     4e-71  47%  304 aa  ACCD_ECOSM RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::287     4e-71  47%  304 aa  ACCD_ECOLI RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::287     4e-71  47%  304 aa  ACCD_ECOLC RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::287     4e-71  47%  304 aa  ACCD_ECOK1 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::287     4e-71  47%  304 aa  ACCD_ECOHS RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::287     4e-71  47%  304 aa  ACCD_ECODH RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::287     4e-71  47%  304 aa  ACCD_ECO57 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::287     4e-71  47%  304 aa  ACCD_ECO24 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::287     6e-71  47%  295 aa  ACCD_XANOR RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::287     6e-71  47%  295 aa  ACCD_XANOP RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::287     6e-71  47%  295 aa  ACCD_XANOM RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::287     6e-71  47%  304 aa  ACCD_SHIDS RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::287     6e-71  47%  304 aa  ACCD_SHIB3 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::287     8e-71  47%  295 aa  ACCD_XANC5 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::282     8e-71  49%  294 aa  ACCD_ACTSZ RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::287     1e-70  47%  291 aa  ACCD_STRM5 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::294     2e-70  45%  302 aa  ACCD_SERP5 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    3::269     3e-70  49%  294 aa  ACCD_PSEMY RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::287     4e-70  46%  291 aa  ACCD_STRMK RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    3::285     4e-70  47%  306 aa  ACCD_PSESM RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    3::282     4e-70  48%  309 aa  ACCD_MARAV RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::281     4e-70  49%  291 aa  ACCD_COXBN RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::284     5e-70  45%  284 aa  ACCD_THICR RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    3::285     5e-70  47%  306 aa  ACCD_PSEU2 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    3::285     7e-70  46%  306 aa  ACCD_PSEPF RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    3::285     7e-70  47%  306 aa  ACCD_PSE14 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::281     7e-70  49%  291 aa  ACCD_COXBU RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::281     7e-70  49%  291 aa  ACCD_COXBR RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::287     9e-70  46%  304 aa  ACCD_SHIFL RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    3::297     1e-69  45%  297 aa  ACCD_PSEE4 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    5::287     2e-69  45%  304 aa  ACCD_ACAM1 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    3::282     3e-69  47%  297 aa  ACCD_PSEPG RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::283     3e-69  46%  305 aa  ACCD_ERWCT RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::284     3e-69  44%  297 aa  ACCD_ACTPJ RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::284     3e-69  44%  297 aa  ACCD_ACTP7 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    3::282     4e-69  47%  297 aa  ACCD_PSEPK RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    3::282     4e-69  47%  297 aa  ACCD_PSEP1 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    3::285     4e-69  45%  306 aa  ACCD_PSEF5 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::285     4e-69  45%  296 aa  ACCD_HAEDU RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::284     4e-69  44%  297 aa  ACCD_ACTP2 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::283     6e-69  45%  291 aa  ACCD_PSEHT RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
   32::289     7e-69  49%  314 aa  ACCD_SYNJA RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::287     1e-68  46%  304 aa  ACCD_SHIF8 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::274     1e-68  48%  282 aa  ACCD_PSEA6 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    3::287     1e-68  45%  287 aa  ACCD_MARMS RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::287     1e-68  45%  289 aa  ACCD_DECAR RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::279     1e-68  47%  287 aa  ACCD_AERHH RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    3::282     2e-68  46%  297 aa  ACCD_PSEPW RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::287     2e-68  46%  295 aa  ACCD_XANCP RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::287     2e-68  46%  295 aa  ACCD_XANC8 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::279     2e-68  47%  287 aa  ACCD_AERS4 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::287     3e-68  46%  295 aa  ACCD_XANCB RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    5::280     3e-68  45%  293 aa  ACCD_PROMM RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    5::280     3e-68  45%  293 aa  ACCD_PROM3 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
   25::283     3e-68  48%  317 aa  ACCD_CYAA5 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
   17::283     5e-68  48%  294 aa  ACCD_BLOPB RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    5::282     6e-68  45%  292 aa  ACCD_SYNS3 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    5::282     8e-68  44%  292 aa  ACCD_SYNPW RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::285     2e-67  45%  286 aa  ACCD_CELJU RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    5::285     2e-67  46%  326 aa  ACCD_SYNY3 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    3::265     2e-67  48%  297 aa  ACCD_PSEU5 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
   15::292     4e-67  45%  316 aa  ACCD_NOSP7 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
   24::282     5e-67  46%  305 aa  ACCD_SYNP6 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
   24::282     5e-67  46%  305 aa  ACCD_SYNE7 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
   27::297     5e-67  46%  605 aa  ACCDA_NATTJ RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
   24::282     9e-67  48%  292 aa  ACCD_PROMA RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
   26::285     2e-66  45%  288 aa  ACCD_PORPU RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
   23::291     3e-66  46%  291 aa  ACCD_SYNR3 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
   28::285     3e-66  45%  575 aa  ACCDA_CLOTE RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    4::291     5e-66  45%  314 aa  ACCD_SYNJB RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
   18::279     5e-66  47%  282 aa  ACCD_GEOBB RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::283     6e-66  45%  306 aa  ACCD_SODGM RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    5::282     6e-66  43%  294 aa  ACCD_PROM1 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::280     6e-66  44%  289 aa  ACCD2_VIBPA RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    5::271     1e-65  46%  293 aa  ACCD_SYNPX RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::282     1e-65  44%  301 aa  ACCD_ENT38 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    5::282     1e-65  43%  294 aa  ACCD_PROMT RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
   26::283     1e-65  45%  288 aa  ACCD_PORYE RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::274     1e-65  45%  285 aa  ACCD_COLP3 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::280     1e-65  44%  308 aa  ACCD1_VIBPA RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::285     2e-65  43%  304 aa  ACCD_PASMU RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
   21::282     3e-65  47%  304 aa  ACCD_GLOVI RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::288     5e-65  46%  295 aa  ACCD_MANSM RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::280     7e-65  43%  308 aa  ACCD_VIBCH RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    5::293     7e-65  42%  293 aa  ACCD_SYNSC RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::282     7e-65  46%  311 aa  ACCD_ALHEH RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::287     9e-65  44%  304 aa  ACCD_CITK8 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    4::291     9e-65  44%  411 aa  ACCD_CHLVU RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::280     9e-65  43%  308 aa  ACCD1_VIBHB RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
   28::284     1e-64  46%  289 aa  ACCD_CLOBK RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
   20::283     1e-64  43%  285 aa  ACCD_CLOAB RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::280     1e-64  42%  308 aa  ACCD_VIBC3 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::288     2e-64  44%  292 aa  ACCD_IDILO RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::283     2e-64  45%  295 aa  ACCD_BAUCH RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
   15::297     2e-64  42%  316 aa  ACCD_ANAVT RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
   15::297     2e-64  42%  316 aa  ACCD_ANASP RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::294     3e-64  42%  302 aa  ACCD_ERWT9 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::280     4e-64  43%  308 aa  ACCD_VIBVY RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::280     4e-64  43%  310 aa  ACCD_VIBVU RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::284     4e-64  43%  284 aa  ACCD_PELPD RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::290     6e-64  43%  306 aa  ACCD_KLEP7 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    3::283     7e-64  42%  310 aa  ACCD_HAHCH RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::280     7e-64  43%  289 aa  ACCD2_VIBHB RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    4::282     9e-64  42%  292 aa  ACCD_PROM5 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::290     9e-64  43%  307 aa  ACCD_PHOPR RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
   25::283     2e-63  46%  319 aa  ACCD_SYNP2 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    4::282     3e-63  42%  293 aa  ACCD_PROM0 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::270     5e-63  45%  290 aa  ACCD_CUPTR RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
   24::282     6e-63  45%  290 aa  ACCD_PROM4 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
   21::284     6e-63  45%  299 aa  ACCD_HAES2 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
   21::284     6e-63  45%  299 aa  ACCD_HAES1 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::293     1e-62  42%  294 aa  ACCD_VIBF1 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::293     3e-62  42%  294 aa  ACCD_VIBFM RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    4::282     5e-62  41%  293 aa  ACCD_PROM2 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    5::287     2e-61  42%  293 aa  ACCD_ALCBS RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
   20::281     3e-61  43%  286 aa  ACCD_WIGBR RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
   23::284     4e-61  44%  284 aa  ACCD_CLOD6 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::274     8e-60  43%  290 aa  ACCD_BURM1 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::274     8e-60  43%  290 aa  ACCD_BURCJ RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::274     8e-60  43%  290 aa  ACCD_BURCA RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    5::293     1e-59  41%  293 aa  ACCD_SYNS9 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    5::282     1e-59  40%  326 aa  ACCD_TRIEI RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    4::271     1e-59  41%  293 aa  ACCD_PROM9 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    4::269     2e-59  41%  292 aa  ACCD_PROMP RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::255     2e-59  45%  281 aa  ACCD_ALTMD RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::281     4e-59  40%  287 aa  ACCD_BLOFL RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    4::269     5e-59  41%  293 aa  ACCD_PROMS RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
   22::272     9e-59  43%  287 aa  ACCD_CLOB8 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
   42::311     2e-58  41%  313 aa  ACCD_ANTFO RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
   11::262     3e-58  46%  566 aa  ACCDA_SALTO RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
   21::282     6e-58  39%  291 aa  ACCD_CLOBB RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
   21::282     8e-58  39%  291 aa  ACCD_CLOBA RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
   42::306     2e-57  41%  316 aa  ACCD_MARPO RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
    1::260     2e-57  47%  336 aa  ACCD_HALHL RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
   29::286     9e-57  41%  292 aa  ACCD_CLOP1 RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
   29::286     1e-56  40%  292 aa  ACCD_CLOPS RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
   36::286     1e-56  42%  287 aa  ACCD_CLONN RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
   45::306     2e-55  42%  310 aa  ACCD_ADICA RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
   53::313     1e-54  40%  471 aa  ACCD_HELSJ RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
   42::312     2e-54  40%  315 aa  ACCD_PHYPA RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  219::489     2e-54  38%  490 aa  ACCD_SOLTU RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  219::489     2e-54  38%  490 aa  ACCD_SOLBU RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
   24::277     2e-54  41%  305 aa  ACCD_PARUW RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  219::489     4e-54  38%  490 aa  ACCD_SOLLC RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  225::494     5e-54  38%  495 aa  ACCD_NICTO RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  197::464     7e-54  39%  466 aa  ACCD_FAGEA RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  217::486     7e-54  38%  487 aa  ACCD_ATRBE RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  225::494     1e-53  38%  495 aa  ACCD_TOBAC RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  225::494     1e-53  38%  495 aa  ACCD_NICSY RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
   36::276     2e-53  43%  609 aa  ACCDA_FRAAA RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  225::486     1e-52  39%  494 aa  ACCD_COFAR RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  228::484     1e-52  40%  496 aa  ACCD_PIPCE RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  215::476     1e-52  39%  480 aa  ACCD_HELAN RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  218::479     1e-52  39%  483 aa  ACCD_GUIAB RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  227::483     1e-52  40%  490 aa  ACCD_EUCGG RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  222::489     2e-52  39%  491 aa  ACCD_DAUCA RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  221::488     3e-52  38%  489 aa  ACCD_BUXMI RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  228::484     4e-52  39%  496 aa  ACCD_RANMC RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  222::478     5e-52  39%  487 aa  ACCD_PANGI RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  228::484     5e-52  39%  491 aa  ACCD_LEMMI RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
   45::311     5e-52  40%  314 aa  ACCD_ANGLY RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  243::504     6e-52  39%  508 aa  ACCD_LACSA RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  230::497     1e-51  39%  498 aa  ACCD_MORIN RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  221::489     1e-51  38%  491 aa  ACCD_CERDE RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  229::485     1e-51  40%  497 aa  ACCD_CARPA RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  203::475     2e-51  40%  487 aa  ACCD_LOBMA RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  206::466     2e-51  41%  486 aa  ACCD_NYMAL RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  220::476     2e-51  39%  489 aa  ACCD_DIOEL RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  227::488     3e-51  39%  492 aa  ACCD_CITSI RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  163::419     4e-51  39%  432 aa  ACCD_SOYBN RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  223::479     5e-51  39%  491 aa  ACCD_VITVI RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  222::478     5e-51  39%  491 aa  ACCD_SPIOL RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  218::473     5e-51  40%  485 aa  ACCD_AETCO RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  229::485     7e-51  38%  494 aa  ACCD_DRIGR RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  204::463     2e-50  40%  483 aa  ACCD_NUPAD RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  205::477     2e-50  38%  480 aa  ACCD_ILLOL RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  226::481     2e-50  39%  502 aa  ACCD_CHLSC RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  225::507     2e-50  40%  509 aa  ACCD_IPOPU RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  227::483     2e-50  38%  505 aa  ACCD_CALFG RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  226::491     3e-50  38%  498 aa  ACCD_POPTR RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  226::491     3e-50  38%  498 aa  ACCD_POPAL RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  229::485     3e-50  39%  497 aa  ACCD_PLAOC RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  229::486     3e-50  39%  493 aa  ACCD_EPIVI RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  223::479     6e-50  38%  488 aa  ACCD_LIRTU RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  225::477     6e-50  41%  489 aa  ACCD_DRANE RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  268::522     6e-50  38%  540 aa  ACCD_AMBTC RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  229::486     8e-50  38%  501 aa  ACCD_LOTJA RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  226::485     1e-49  39%  497 aa  ACCD_GOSHI RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  203::475     2e-49  39%  484 aa  ACCD_OLIPU RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  203::475     2e-49  38%  487 aa  ACCD_LEPVR RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  217::484     2e-49  37%  497 aa  ACCD_CUSRE RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
   45::311     3e-49  41%  321 aa  ACCD_PINTH RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  203::480     3e-49  38%  487 aa  ACCD_NASOF RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  204::476     3e-49  39%  488 aa  ACCD_ARAHI RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  223::488     4e-49  38%  497 aa  ACCD_PHAAO RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  226::485     9e-49  39%  497 aa  ACCD_GOSBA RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  223::475     2e-48  39%  487 aa  ACCD_BARVE RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  221::476     2e-48  39%  488 aa  ACCD_AETGR RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  207::477     3e-48  39%  489 aa  ACCD_BRANA RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
   47::314     3e-48  39%  320 aa  ACCD_PINKO RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  223::522     3e-48  39%  523 aa  ACCD_CUCSA RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  203::475     3e-48  38%  484 aa  ACCD_CAPBU RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  207::479     3e-48  38%  488 aa  ACCD_ARATH RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
   47::315     4e-48  39%  319 aa  ACCD_PICAB RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  203::475     4e-48  38%  484 aa  ACCD_CRUWA RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  242::495     7e-48  39%  517 aa  ACCD_OENEH RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  229::496     1e-47  37%  497 aa  ACCD_NANDO RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  177::448     1e-47  38%  460 aa  ACCD_CICAR RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
   22::259     4e-47  40%  568 aa  ACCDA_SACEN RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
  395::582     3e-40  43%  590 aa  ACCD_PEA RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
   70::205     3e-33  48%  495 aa  ACCD_MYCTU RecName: Full=Putative acetyl-coenzyme A carboxylase
   70::205     3e-33  48%  495 aa  ACCD_MYCBO RecName: Full=Putative acetyl-coenzyme A carboxylase
  302::488     4e-33  38%  491 aa  ACCD_CUSGR RecName: Full=Acetyl-coenzyme A carboxylase carboxyl
   17::203     8e-13  29%  507 aa  PCCB_BACSU RecName: Full=Putative propionyl-CoA carboxylase beta
   77::243     3e-10  25%  541 aa  PCCB_MOUSE RecName: Full=Propionyl-CoA carboxylase beta chain,
   96::230     5e-10  30%  548 aa  PCC5_MYCTU RecName: Full=Probable propionyl-CoA carboxylase beta
   77::243     6e-10  25%  541 aa  PCCB_RAT RecName: Full=Propionyl-CoA carboxylase beta chain,
   96::228     6e-10  30%  549 aa  PCCB_MYCLE RecName: Full=Probable propionyl-CoA carboxylase beta
  105::241     8e-10  26%  539 aa  PCCB_HUMAN RecName: Full=Propionyl-CoA carboxylase beta chain,
  105::241     1e-09  25%  539 aa  PCCB_BOVIN RecName: Full=Propionyl-CoA carboxylase beta chain,
  112::224     2e-09  33%  546 aa  PCCB_SACEN RecName: Full=Propionyl-CoA carboxylase beta chain;     
  105::241     2e-09  25%  539 aa  PCCB_PIG RecName: Full=Propionyl-CoA carboxylase beta chain,
   43::174     2e-08  27%  476 aa  PCCB_RHOER RecName: Full=Propionyl-CoA carboxylase beta chain;     
   42::171     3e-08  25%  473 aa  PCC6_MYCTU RecName: Full=Probable propionyl-CoA carboxylase beta
   42::171     3e-08  25%  473 aa  PCC6_MYCBO RecName: Full=Probable propionyl-CoA carboxylase beta
   84::152     7e-08  38%  611 aa  12S_PROFR RecName: Full=Methylmalonyl-CoA carboxyltransferase 12S
    1::298

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNWITNYVRPRINSMLGRRPEVPENLWIKCPETGEMVFHKDLEDNKWVIPASGYHMKMPAKARLADLFDG
ACCD_METFK      MSWLQKLLPPKINRPAGNRKTVPEGLWSKCPSCESVLYRTDLESNSEVCPKCSYHNRISARTRLNFLLDA
ACCD_METCA      LSWFHKLVPSKIRTEASTKSTVPEGLWCKCPSCNAILYKSEVERNLEVCPKCSHHMRISARKRLHLFLDP
ACCD_SHIBS      MSWIE---RIKSNITPTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMTARNRLHSLLDE
ACCD_YERE8      MSWIERILN-KSNITQTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMSARARLHMLLDA
ACCD_YERPY      MSWIERILN-KSNITQTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMSARARLHMLLDA
ACCD_YERPS      MSWIERILN-KSNITQTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMSARARLHMLLDA
ACCD_YERPG      MSWIERILN-KSNITQTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMSARARLHMLLDA
ACCD_YERPE      MSWIERILN-KSNITQTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMSARARLHMLLDA
ACCD_YERPB      MSWIERILN-KSNITQTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMSARARLHMLLDA
ACCD_YERPA      MSWIERILN-KSNITQTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMSARARLHMLLDA
ACCD_YERP3      MSWIERILN-KSNITQTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMSARARLHMLLDA
ACCD_YERPP      MSWIERILN-KSNITQTRKAGIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMSARARLHMLLDA
ACCD_YERPN      MSWIERILN-KSNITQTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMSARARLHMLLDA
ACCD_PSEAE      -NWLVDKLIPSIMRSESQKSSVPEGLWHKCPSCEAVLYRPELEKTLDVCPKCDHHMRINARTRLDIFLDE
ACCD_PSEAB      -NWLVDKLIPSIMRSESQKSSVPEGLWHKCPSCEAVLYRPELEKTLDVCPKCDHHMRINARTRLDIFLDE
ACCD_MICAN      -DWFANRQKTEPKVQQQQEREIADGLWTKCPNCGVLAYTKDLLANQLVCLDCGHHNRVESEERIRQLVDA
ACCD_ECOL6      MSWIE---RIKSNITPTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMTARNRLHXXXXX
ACCD_SALTY      MSWIE---RIKSNITPTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMSARNRLHXXXXX
ACCD_SALTI      MSWIE---RIKSNITPTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMSARNRLHXXXXX
ACCD_SALSV      MSWIE---RIKSNITPTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMSARNRLHXXXXX
ACCD_SALPK      MSWIE---RIKSNITPTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMSARNRLHXXXXX
ACCD_SALPB      MSWIE---RIKSNITPTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMSARNRLHXXXXX
ACCD_SALPA      MSWIE---RIKSNITPTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMSARNRLHXXXXX
ACCD_SALNS      MSWIE---RIKSNITPTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMSARNRLHXXXXX
ACCD_SALHS      MSWIE---RIKSNITPTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMSARNRLHXXXXX
ACCD_SALG2      MSWIE---RIKSNITPTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMSARNRLHXXXXX
ACCD_SALEP      MSWIE---RIKSNITPTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMSARNRLHXXXXX
ACCD_SALDC      MSWIE---RIKSNITPTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMSARNRLHXXXXX
ACCD_SALCH      MSWIE---RIKSNITPTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMSARNRLHXXXXX
ACCD_SALA4      MSWIE---RIKSNITPTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMSARNRLHXXXXX
ACCD_PSEA7      -NWLVDKLIPSIMRSESQKSSVPEGLWHKCPSCEAVLYRPELEKTLDVCPKCDHHMRINARTRLDIFLDE
ACCD_SALAR      MSWIE---RIKSNITPTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMSARNRLHXXXXX
ACCD_BURP8      MSWLDKLLPPKIKQTDPKRKGIPEGLWIKCPSCEAVLYRNDVEANLHVCPKCDHHMRIGARERLDGLLDP
ACCD_XANAC      MSWLSKLMPSRTENTPAKKRSVPEGLWEKCSNCGSALYGPELEENLEVCPKCDHHMAIRARARLNSLFDP
ACCD_SHISS      MSWIE---RIKSNITPTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMTARNRLHXXXXX
ACCD_PHOLL      MSWIEKILN-KSNITQTRKANIPEGVWTKCDSCSQVLYRAELERNLEVCPKCDHHMRISARTRLATFLDX
ACCD_HAEIN      MSWI-NRIFSKSPSSSTRKANVPEGVWTKCTACEQVLYSEELKRNLYVCPKCGHHMRIDARERLLNLLDE
ACCD_HAEIG      MSWI-NRIFSKSPSSSTRKANVPEGVWTKCTACEQVLYSEELKRNLYVCPKCGHHMRIDARERLLNLLDE
ACCD_HAEIE      MSWI-NRIFSKSPSSSTRKANVPEGVWTKCTSCEQVLYSEELKRNLYVCPKCGHHMRIDARERLLKLLDE
ACCD_HAEI8      MSWI-NRIFSKSPSSSTRKANVPEGVWTKCTACEQVLYSEELKRNLYVCPKCGHHMRIDARERLLNLLDE
ACCD_ECOL5      MSWIE---RIKSNITPTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMTARNRLHXXXXX
ACCD_CHRSD      MSWLDKIVPSMSRTQRARRKSVPDGLWRKCPNCEAVLYLPELERHQSVCPKCDHHLRLTARKRLNWFLDT
ACCD_PROMH      MSWIEKILN-KSNITSSRKANIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRISARRRLETFLDT
ACCD_ENTS8      MSWIERILN-KSNITPTRRANIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMAARDRLHXXXXX
ACCD_ECOUT      MSWIE---RIKSNITPTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMTARNRLHXXXXX
ACCD_ECOSM      MSWIE---RIKSNITPTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMTARNRLHXXXXX
ACCD_ECOLI      MSWIE---RIKSNITPTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMTARNRLHXXXXX
ACCD_ECOLC      MSWIE---RIKSNITPTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMTARNRLHXXXXX
ACCD_ECOK1      MSWIE---RIKSNITPTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMTARNRLHXXXXX
ACCD_ECOHS      MSWIE---RIKSNITPTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMTARNRLHXXXXX
ACCD_ECODH      MSWIE---RIKSNITPTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMTARNRLHXXXXX
ACCD_ECO57      MSWIE---RIKSNITPTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMTARNRLHXXXXX
ACCD_ECO24      MSWIE---RIKSNITPTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMTARNRLHXXXXX
ACCD_XANOR      MSWLSKLMPSRTENTPAKKRSVPEGLWEKCSNCGSALYGPELEENLEVCPKCDHHMAIRARARLNSLFDP
ACCD_XANOP      MSWLSKLMPSRTENTPAKKRSVPEGLWEKCSNCGSALYGPELEENLEVCPKCDHHMAIRARARLNSLFDP
ACCD_XANOM      MSWLSKLMPSRTENTPAKKRSVPEGLWEKCSNCGSALYGPELEENLEVCPKCDHHMAIRARARLNSLFDP
ACCD_SHIDS      MSWIE---RIKSNITPTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMTARNRLHXXXXX
ACCD_SHIB3      MSWIE---RIKSNITPTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMTARNRLHXXXXX
ACCD_XANC5      MSWLSKLMPSRTENTPAKKRSVPEGLWEKCSNCGSALYGPELEENLEVCPKCDHHMAIRARARLNSLFDP
ACCD_ACTSZ      MSWIDKIFSKKPSSD-SRRANVPEGVWTKCTACEQVLYRDELKRHLEVCPKCGHHMRIDARERLEYLLDK
ACCD_STRM5      MSWLSKLMPSRTDNTPSKKRSVPEGLWEKCSNCGSALYRPELEENLEVCPKCGHHMXXXXXXXXXXXFDA
ACCD_SERP5      MSWIERILN-KSNITQTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMTARMRLHTXXXX
ACCD_PSEMY      -NWLVDKLIPSIMRSEVKKSSVPEGLWHKCPSCDAVLYRPELEKTLDVCPKCNHHMRIGARARLDIFLDQ
ACCD_STRMK      MSWLSKLMPSRTDNTPSKKRSVPEGLWEKCSNCGSALYRPELEENLEVCPKCGHHMXXXXXXXXXXXFDA
ACCD_PSESM      -NWLVDKLIPSIMRSEVKKSSVPEGLWHKCPSCDAVLYRPELEKTLDVCPKCNHHMRIGARARLNIFLDV
ACCD_MARAV      -NWLDKIMPSKIRSESRQRTGVPEGLWKKCPKCGAFLYKPELEKNLDVCPKCNHHLRVSARRRLDIFLDK
ACCD_COXBN      MNWFTKLL-PKIST--AKKKGVPEGVWHKCPSCTAVLYRVELERNLEVCPKCYYHIRLDPRKRLAQFLDE
ACCD_THICR      MSWFEK-ILPSIKQVTERKKNVPEGLWTKCPKCESTLYRAEVRRNLEVCPKCDHHMRLGGRDRLEAFFDE
ACCD_PSEU2      -NWLVDKLIPSIMRSEVKKSSVPEGLWHKCPSCEAVLYRPELEKTLDVCPKCNHHMRIGARARLNIFLDV
ACCD_PSEPF      -NWLVDKLIPSIMRSEVKKSSVPEGLWHKCPSCEAVLYRPELEKTLDVCPKCNHHMRIGARARIDIFLDA
ACCD_PSE14      -NWLVDKLIPSIMRSEVKKSSVPEGLWHKCPSCEAVLYRPELEKTLDVCPKCNHHMRIGARARLNIFLDV
ACCD_COXBU      MNWFTKLL-PKIST--ANKKGVPEGVWHKCPSCTAVLYRVELERNLEVCPKCYYHIRLDPRKRLAQFLDE
ACCD_COXBR      MNWFTKLL-PKIST--ANKKGVPEGVWHKCPSCTAVLYRVELERNLEVCPKCYYHIRLDPRKRLAQFLDE
ACCD_SHIFL      MSWIE---RIKSNITPTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMTARNRLHXXXXX
ACCD_PSEE4      -NWLVDKLIPSIMRSEVKKSSVPEGLWHKCPSCEAVLYRPELEKTLDVCPKCNHHMRIGARARIDIFLDK
ACCD_ACAM1      -DWFANRRKSHPVTKAQPEREISDGLWSKCESCGALTYTKDLRANQMVCLECGHHLRVTSDERIAQLIDA
ACCD_PSEPG      -NWLVDKLIPSIMRSEVKKSSVPEGLWHKCPSCEAVLYRPELEKTLDVCPKCNHHMRIGARARIDIFLDA
ACCD_ERWCT      MSWIERILN-KSNITPTRKANIPEGVWTKCDSCGQVLYRAELERNLGVCPKCDHHMRLSARARLQAFLDK
ACCD_ACTPJ      MSWIERILGRTXXXXXXXXXXVPEGVWTKCTSCEQVLYSEELKRNMHVCPKCNHHMRFDARTRLLSLLDQ
ACCD_ACTP7      MSWIERILGRTXXXXXXXXXXVPEGVWTKCTSCEQVLYSEELKRNMHVCPKCNHHMRFDARTRLLSLLDQ
ACCD_PSEPK      -NWLVDKLIPSIMRSEVKKSSVPEGLWHKCPSCEAVLYRPELEKTLDVCPKCNHHMRIGARARIDIFLDA
ACCD_PSEP1      -NWLVDKLIPSIMRSEVKKSSVPEGLWHKCPSCEAVLYRPELEKTLDVCPKCNHHMRIGARARIDIFLDA
ACCD_PSEF5      -NWLVDKLIPSIMRSEVKKSSVPEGLWHKCPSCEAVLYRPELEKTLDVCPKCNHHMRIGARARIDIFLDA
ACCD_HAEDU      MSWIERILGRTAXXXXXXXXXVPEGVWTKCTNCEQVLYSEELKRNMQVCPKCDHHMRFDARTRLLSLLDQ
ACCD_ACTP2      MSWIERILGRTXXXXXXXXXXVPEGVWTKCTSCEQVLYSEELKRNMHVCPKCNHHMRFDARTRLLSLLDQ
ACCD_PSEHT      MSWLEK-ILPKTTKASGRK-EIPEGVWAKCTSCDSILYKAELEKALNVCPKCDHHMRISGRKRLEYFLDE
ACCD_SYNJA      --------------------EIADGLWQKCPACDALTYTKDLQQNWQVCPSCGYHHRITAPQRLQQLLDP
ACCD_SHIF8      MSWIE---RIKSNITPTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMTARNRLHXXXXX
ACCD_PSEA6      MSWIEK-ILPRTKSPT--KSNVPEGIWTKCGQCDAVLYKTELEKQLGVCPKCNHHMRVSARARLNQFLDQ
ACCD_MARMS      -SWLDKFVPSIVRSESKRSASVPEGLWKKCPKCENVLYRPELEKNLDVCPKCSHHLRVSARRRLDIFLDK
ACCD_DECAR      MSWLTKLLPPKIKREQGRRGNLPEGLWSKCPSCEAVLYATDLENNLQVCPKCGHHNRLNSRQRLDLLLDS
ACCD_AERHH      MSWLEK-ILPKSKITTPRRHNIPEGVWTKCSACEQVLYRAELERNLEVCPKCDHHMRISARARLESFLDE
ACCD_PSEPW      -NWLVDKLIPSIMRSEVKKSSVPEGLWHKCPACEAVLYRPELEKTLDVCPKCNHHMRIGARQRIDIFLDX
ACCD_XANCP      MSWLSKLMPSRTENTPAKKRSVPEGLWEKCSNCGSALYGPELEENLEVCPKCDHHMXXXXXXXXXXXFDD
ACCD_XANC8      MSWLSKLMPSRTENTPAKKRSVPEGLWEKCSNCGSALYGPELEENLEVCPKCDHHMXXXXXXXXXXXFDD
ACCD_AERS4      MSWLEK-ILPKSKITTPRRHNIPEGVWTKCSACEQVLYRAELERNLEVCPKCDHHMRISARARLESFLDE
ACCD_XANCB      MSWLSKLMPSRTENTPAKKRSVPEGLWEKCSNCGSALYGPELEENLEVCPKCDHHMXXXXXXXXXXXFDD
ACCD_PROMM      -DWFADRRKGQFVGKVSQETEESDGLWVKCPECGQVVYRKDLHANASVCSNCGYHHRIDSDERIVLIADQ
ACCD_PROM3      -DWFADRRKGQFVGKVSQETEESDGLWVKCPECGQVVYRKDLHANASVCSNCGYHHRIDSDERIVLIADQ
ACCD_CYAA5      --------------------EIADGLWTKCVACTALTYTKDLQANQLVCTECGHHFRVESSERIAQLMDK
ACCD_BLOPB      -----------------RKIDIPKGIWTKCDNCGQLLYKKELERNLEVCPKCDHHMRIAARVRLFSFLDK
ACCD_SYNS3      -DWFADRRKGQYVGKVNQEPDEGDGLWSKCPECGQVVYRKDLLSNASVCGNCGYHHRIDSTERIAVLVDP
ACCD_SYNPW      -DWFADRRKEQSVVKVAQEPEEGDGLWSKCPECGQVVYRKDLLANASVCSNCGHHHRINSAERIALIADE
ACCD_CELJU      MSWLEKIIPSISRTETKRSNKVPEGLWEKCVKCDAVLYKPELEKNLDVCPKCDHHMRIGARSRLNIFLDP
ACCD_SYNY3      -DWFANREKPVLQPQSPQEREVADGLWTKCPACGVLTYTKDLQGNWMVCVECGHHLRVDSDERIRQLIDA
ACCD_PSEU5      -NWLVDKLIPSIMRSETQKSSVPEGLWHKCPSCEAVLYRPELEKTLDVCPKCHHHMRIDARTRLDIFLDA
ACCD_NOSP7      -DWFANRRKSGSTSLERQEREIADGLWHKCSKCGVLAYTKDLKANQMVCIECGHHNRVDSDERIRQLIDN
ACCD_SYNP6      --------------------EIADGLWTKCESCDALTYTKDLQANLMVCLQCGHHLRIYSDERIRQLIDP
ACCD_SYNE7      --------------------EIADGLWTKCESCDALTYTKDLQANLMVCLQCGHHLRIYSDERIRQLIDP
ACCDA_NATTJ     ------------NDNKSNKPHIPDGLWEKCDSCKSIIYAEDLKKNYHICHECGHHFRIGAQERINQIIDE
ACCD_PROMA      --------------------EESDGLWGKCPECGQVVYRKDLLTNANVCSNCGHHSRINSEERIKLIVDQ
ACCD_PORPU      ---------------------IPDGLWVKCFDCGLLMYSKVLKRNLKVCPQCSYHFQASSNERIDQLIDQ
ACCD_SYNR3      -------------------PDEGDGLWSKCPECGEVVYRKDLIANASVCASCGYHHRIHSEERLRILLDP
ACCDA_CLOTE     ------------------KPLIPDCMWSKCEKCGQIIYSKDLRKNHSICGFCKNHFRISAYDRVKQIIDE
ACCD_SYNJB      LDWFAERRRQTSLNLTGSSPEIADGLWQKCPACDTLTYTKDLQQNWQVCPSCGHHHRITAPERLEQLLDP
ACCD_GEOBB      ------------------RVKVPEGLWTKCVSCGETIYTKDIENNLNVCPKCNHHYRVSSKKRLELLLDE
ACCD_SODGM      MSWIERILN-KSTITSARRANIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMTARARLHAFLDK
ACCD_PROM1      -DWFADRRKGQFVGKVTQESEESDGLWEKCPECGQVVYRKDLIDNCSVCSNCGHHNRIDSKERIRIISDP
ACCD2_VIBPA     MSWLEKLLDKK-NIINTRKASIPEGVWTKCPSCDQVLYRIALKENLEVCPKCQHHLRMSARHRLDGFLDK
ACCD_SYNPX      -DWFADRRKGQSTGKITQEPEEGDGLWSKCPECGLVVYVKDLKGNASVCAGCGHHHRIDSHERIALIADP
ACCD_ENT38      MSWIE---RIKSNIAPTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMSARNRLHSLLDE
ACCD_PROMT      -DWFADRRKGQFVGKVTQESEESDGLWEKCPECGQVVYRKDLIDNCSVCSNCGHHNRIDSKERIRLISDP
ACCD_PORYE      ---------------------IPDGLWIKCFDCGLLMYSKVLKRNLKVCPQCSYHFQASSNERIDQLIDQ
ACCD_COLP3      MSWIEK-ILPKAKTT--QKSSIPEGVWSKCSSCNAVLYKAELERQISVCPKCDHHMRISARKRIDSFLDH
ACCD1_VIBPA     MSWLEKILE-KSNLVSSRKASIPEGVWTKCTSCEQVLYHAELERNLEVCPKCNHHMRMKARRRLETFLDE
ACCD_PASMU      MSWIDRIFNKDTSSTSSRKANVPEGVWTKCTSCEQVLYRDELRRHLEVCPKCGHHMRIDARERLLALLDK
ACCD_GLOVI      -----------------RQREIADGLWTKCVSCAALHYTKDFQLNLCVCPACGHHERVGAPERIPQLVDP
ACCD_MANSM      MSWIDKFSKSPISS--SRKANVPEGVWTKCTSCEQVLYRDELKRHLEVCPKCGHHMRIDARERLLALLDK
ACCD_VIBCH      MSWLEKILE-KSNIVSSRKASIPEGVWTKCTSCEQVLYYAELERNLEVCPKCDHHMRMKARRRLETFLDQ
ACCD_SYNSC      -DWFADRRKGQYVANVKQEPDEGDGLWSKCPECGQVVYLKDLKLNASVCANCGHHHRIDSAERIALIADP
ACCD_ALHEH      MSWFQKLMPSRIRTDASERSRVPEGLWTKCGHCSAVLYRPELERNQEVCPKCGDHMRIGARRRLAGFLDA
ACCD_CITK8      MSWIE---RIKSNITPTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMSARNRLHXXXXX
ACCD_CHLVU      LSWIENQRKLKLNAPKYNHPEVSQGLWTRCDHCGVILYIKHLKENQRVCFGCGYHLQMSSTERIESLVDA
ACCD1_VIBHB     MSWLEKILE-KSNLVSSRKASIPEGVWTKCTSCEQVLYHAELERNLEVCPKCNHHMRMKARRRLETFLDE
ACCD_CLOBK      -------------------PTIPDGMWVKCNKCGEILYQNDLEKNYMVCNLCGNHFRIGVKERIKYLFDK
ACCD_CLOAB      ------------NNDVENQPTIPDGMWIKCSKCGKILYKSDVDDNFKVCPKCNAHLRMNARERIEFIIDE
ACCD_VIBC3      MSWLEKILE-KSNIVSSRKASIPEGVWTKCTSCEQVLYYAELERNLEVCPKCDHHMRMKARRRLETFLDQ
ACCD_IDILO      MSWIERILKPKINKRRG----VPEGVWSKCTACGNIIYKADLERSLNVCPKCDHHMRVTGRSRLDIFLDK
ACCD_BAUCH      MSWIERIINKSIITPT-RKANIPEGIWTKCDSCGQVLYRAELERNLEVCLKCNHHMRISARVRLHAFLDQ
ACCD_ANAVT      -DWFANRRKAGATNPERQEREIADGLWHKCSKCGVLTYTKDLRANQMVCVECGHHNRVDSDERIRQLIDQ
ACCD_ANASP      -DWFANRRKAGATNPERQEREIADGLWHKCSKCGVLTYTKDLRANQMVCVECGHHNRVDSDERIRQLIDQ
ACCD_ERWT9      MSWIERILN-KSTTTPSRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMHGRARLHSVXXX
ACCD_VIBVY      MSWLEKILE-KSNIVSSRKASIPEGVWTKCTSCEQVLYHAELERNLEVCPKCNHHMRMKARRRLETFLDE
ACCD_VIBVU      MSWLEKILE-KSNIVSSRKASIPEGVWTKCTSCEQVLYHAELERNLEVCPKCNHHMRMKARRRLETFLDE
ACCD_PELPD      MSWF-HRERAGINRTQIKKSRVPQGMWVKCPGCSATLLAKDLDANLNVCPTCGHHHRIGARRRLESLLDA
ACCD_KLEP7      MSWIE---RIKSNITPTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMSARNRLHXXXXX
ACCD_HAHCH      -NWLEKIIPGMGGAQSKHKSNVPEGLWKKCPKCSAVLYRPELEKNLDVCPKCQHHMRISARRRIDIFLDG
ACCD2_VIBHB     MSWLEKLL-DKNNIINTRKTSIPEGVWTKCPSCEQVLYRIALKENLEVCPKCNHHMRMTARDRLDSFLDK
ACCD_PROM5      IDWFAARRKDQFVGKVSQDTEESDGLWVKCSECGQVAYRKDLISNFNVCSNCSHHNRINSDERINIIADK
ACCD_PHOPR      MSWLEK-ILTKSNIVSSRKVSIPEGVWTKCTSCEQVLYHADLERNLEVCPKCDHHMRMKARRRLETFLDT
ACCD_SYNP2      --------------------EIADGLWTKCKSCDALTYTKDLRNNQMVCKECGFHNRVGSRERVRQLIDE
ACCD_PROM0      IDWFAARRKDQFVGKVSQDADEGDGLWVKCSECSQVAYRKDLISNFNVCSNCGHHNRINSDERINIIADK
ACCD_CUPTR      MSWLDKLLPPKIQQTPSTRKGIPEGLWVKCPSCESTLYRTDVEANLHVCPKCDHHMRISXXXXXXXXXXX
ACCD_PROM4      --------------------EEADGLWGKCPECSQVVYRKDLLENANVCSNCGHHNRINSDERIKLIADQ
ACCD_HAES2      ---------------------VPEGVWTKCTSCEQVLYRDELKRHLEVCPKCGHHMRIDARERLVALLDK
ACCD_HAES1      ---------------------VPEGVWTKCTSCEQVLYRDELKRHLEVCPKCGHHMRIDARERLVALLDK
ACCD_VIBF1      MSWLEKIFNTS-NIVSSRKASIPEGVWTKCTSCEQVLYSAELERNLEVCPKCDHHMRMKARKRLETFLDA
ACCD_VIBFM      MSWLEKIFNTS-NIVSSRKASIPEGVWTKCTSCEQVLYSAELERNLEVCPKCDHHMRMKARKRLETFLDA
ACCD_PROM2      IDWFAARRKDQFVGKVSQDTDEGDGLWVKCSECSQVAYRKDLISNFNVCSNCNHHNRINSDERINIVADK
ACCD_ALCBS      -NWLEKILPAVRRPQESRRNNIPEGLWRKCPRCEGVVYRPELDRNMDVCPKCDHHLRISARRRLKLFLDE
ACCD_WIGBR      ----------------------PEGIWVKCNNCNQMIYKIELEKNLEVCPKCNFHMRISARKRLEKFLDK
ACCD_CLOD6      -----------------KKNSVDDKFWTYCKGCDSHVFRKDIEENSFVCPKCSRHYGLRARKRINLLIDK
ACCD_BURM1      MSWLDKLLPPKIKQTDPKRKGIPEGLWVKCPSCEAVLYRNDVDANLHVCPKCDHHMRIGARERLDALLDP
ACCD_BURCJ      MSWLDKLLPPKIKQTDPKRKGIPEGLWVKCPSCEAVLYRNDVDANLHVCPKCDHHMRIGARERLDGLLDP
ACCD_BURCA      MSWLDKLLPPKIKQTDPKRKGIPEGLWVKCPSCEAVLYRNDVDANLHVCPKCDHHMRIGARERLDGLLDP
ACCD_SYNS9      -DWFADRRKGQYVGNVKQEPEEGDGLWSKCPECGLVVYLKDLRLNASVCAGCGYHHRIDSSERLALIADP
ACCD_TRIEI      -DWFANRRKSSQDPQQRPEREIADGLWIKCEACGTLTYTKDLQANQMVCPECTHHIRVSSEQRIQQLIDF
ACCD_PROM9      IDWFAARRKDQFVGKVSQDTDEGDGLWVKCSECSQVAYRKDLISNFNVCSNCGHHNRINSDERINIIADK
ACCD_PROMP      IDWFAARRKDQFVGKVSQDPEESDGLWVKCSECGQVAYRKDLISNFNVCSNCGHHNRINSDERINIIADK
ACCD_ALTMD      MSWIQK-ILPRTQT--SHKGNVPEGIWTKCGSCQAVLYKSELEKLQEVCPKCDHHMRITARRRIDAFLDD
ACCD_BLOFL      MNWIERIINKNI-VLTTKKMHVPEGIWTKCSGCVQLLYTKELERNLQVCPKCDFHMKISARSRLLAFLDQ
ACCD_PROMS      IDWFAARRKDQFVGKVSQDTDEGDGLWVKCSECSQVAYRKDLISNFNVCNNCGHHNRINSDERINIIADK
ACCD_CLOB8      -------------SISEEKPNIPSGMWEKCDKCNSMIYAEDLENSKFVCATCGHHFRLNAKERIKVFFDK
ACCD_ANTFO      --------------------DTTKGLWTRCDNCENMLYIRFLRQNKRICEECGYHLQMSSTERIESLIDR
ACCDA_SALTO     -------------------------LWSRCGGCASLLYRKRLRRNLDVCPECGAHSRLDAPARLAQLVDP
ACCD_CLOBB      ------------SKVVEEKPNIPSGMWTKCSNCNNMIYYEDLENNKYVCTKCNQHFRISPKERIKQIFDK
ACCD_CLOBA      ------------SKVVEEKPNIPSGMWTKCSNCNSMIYYEDLENNKYVCTKCNQHFRISPKERIKQIFDK
ACCD_MARPO      --------------------DTTKGLWTRCDNCENMLYVRFLRQNKRICEECGYHLQMSSTERIELLIDR
ACCD_HALHL      MSWFQKLMPRRIRTDAGPRSRVPEGLWTKCESCQGILYRPDLERNLEVCPKCGAHMRISARQRLRLFLDE
ACCD_CLOP1      ------------------KPNIPSGMWSKCEKCAKILYTEDLRENFNVCPNCGHHFKLGAYERIKYLTDE
ACCD_CLOPS      ------------------KPNIPSGMWSKCEKCAKILYTEDLRENFNVCPNCGHHFKLGAYERIKYLTDE
ACCD_CLONN      -------------------------MWVKCDRCGKTLYKKDLDENLKVCKFCNKHYRMNAWERIDLIVDT
ACCD_ADICA      -----------------------KGLWARCDNCGNMLYVKFLKQNRSVCEECGYHLSMSSMERIELLIDP
ACCD_HELSJ      -------------------------LWTRCEKCGMIQFMRFFKENANLCLSCSYHHIMTSDERIALLVEK
ACCD_PHYPA      --------------------DTTKGLWTRCDSCENMLYVRFLKQNKRICEECGYHLQMSSIERIELLIDH
ACCD_SOLTU      -----------------------KHLWVQCENCYGLNYKKFLKSKMNICEQCGYHLKMSSSDRIELLIDP
ACCD_SOLBU      -----------------------KHLWVQCENCYGLNYKKFLKSKMNICEQCGYHLKMSSSDRIELLIDP
ACCD_PARUW      --------------------------WLKCTHCNELIHANELEQNSNCCPKCDYHYRLSTEDRIKSLSNP
ACCD_SOLLC      -----------------------KHLWVQCENCYGLNYKKFLKSKMNICEQCGYHLKMSSSDRIELLIDP
ACCD_NICTO      ------------------------HLWVQCENCYGLNYKKFFKSKMNICEQCGYHLKMSSSDRIELLIDP
ACCD_FAGEA      ------------------------NLWIQCENCYELNYKKLLKSKMRICDECGYHLKMSSSERIELSIDP
ACCD_ATRBE      ------------------------HLWVQCENCYGLNYKKFLKSKMNICEQCGYHLKMSSSDRIELLIDA
ACCD_TOBAC      ------------------------HLWVQCENCYGLNYKKFLKSKMNICEQCGYHLKMSSSDRIELLIDP
ACCD_NICSY      ------------------------HLWVQCENCYGLNYKKFLKSKMNICEQCGYHLKMSSSDRIELLIDP
ACCDA_FRAAA     ----------------------PGSSWLLCGGCGTMLYERRFAREGRVCADCSWHAPMTIQQRXXXXXXX
ACCD_COFAR      ------------------------HLWVQCENCYGLNYKKFLKSKMNICEQCGYHLKMNSSERIELSIDP
ACCD_PIPCE      ------------------------HLWVQCENCYGLNYKKFFQSKMNICEQCGYHLKMSSSDRIELSIDP
ACCD_HELAN      ------------------------HLWVQCENCYGLNYKKFFKSKMNLCEQCGYHLKMSSSDRIELSIDP
ACCD_GUIAB      ------------------------HLWVQCENCYGLNYKKFFKSKMNLCEQCGYHLKMSSSDRIELSIDP
ACCD_EUCGG      ------------------------HLWVQCENCYGLNYKKLLKSKMNICDQCGYHLKMSSSDRIELSIDP
ACCD_DAUCA      ------------------------HLWVQCENCYGLNYKKILKSKMNLCEQCGYHLKMSSSDRIELSIDP
ACCD_BUXMI      ------------------------HLWVQCENCYGLNYKKFFRSKMNICEQCGYHLKMSSSDRIELSIDT
ACCD_RANMC      ------------------------HLWVQCENCYGLNYKKFFRLKLHICEQCGYHLKMSSSERIEILIDP
ACCD_PANGI      ------------------------HLWVQCENCYGLNYKKSFKSKMNLCEQCGYHLKMSSSDRIELLIDP
ACCD_LEMMI      ------------------------HLWVQCENCYGLNYKQFFRSRLNICEHCGYHLKMSSSERIELLIDP
ACCD_ANGLY      -----------------------KGLWTRCDNCENMLYIKFLKQNKGVCEECGYHLQINSTERIELLIDR
ACCD_LACSA      ------------------------HLWVQCENCYGLNYKKFFKSKMHLCEQCGYHLKMSSSDRIELLIDP
ACCD_MORIN      ------------------------HLWVQCENCYGLNYKRFLKSKMNICEHCGCHLKMSSSDRIELLIDP
ACCD_CERDE      ------------------------HLWVQCDNCYGLNYKKIFSSKMNICEQCGYHLKMSSSERIELSIDS
ACCD_CARPA      ------------------------HLWVQCENCYGLNYKKFLKSKMNICEQCGYYLKMSSSDRIELLVDP
ACCD_LOBMA      --------RHRSNLMSSKNLDITKNLWIQCDNCYGLMYKK-AEMN--VCEDCGHYLKMTSSERIELLIDP
ACCD_NYMAL      ------------DSDFGRHNDLDRNLWVQCENCYGLNYKKFFSSKMNICEQCGYHLKMSSSDRIELLIDP
ACCD_DIOEL      ------------------------HLWVQCENCYGLNYKKFFRSKMNICEQCGYHLKMSSSDRIEVSIDP
ACCD_CITSI      ------------------------HLWVQCENCYGLNYKKFLKSKMYLCEQCGYHLKMISSDRIDLLVDP
ACCD_SOYBN      -----------------------KHLWLECENCYGLNYKKFFKSKMNICEYCGYHLKMGSSDRIELSIDS
ACCD_VITVI      ------------------------HLWIQCENCYGLNYKKNLKSKINICEQCGYHLKMSSSDRIELSIDP
ACCD_SPIOL      ------------------------HLWVQCESCYALNYKKLLKSKMGICEQCGYHLKISSSDRIELLIDP
ACCD_AETCO      -------------------------LWIQCDNCYALIYKKALKFKMNVCEQCGYYLKISSSDRIELSIDP
ACCD_DRIGR      ------------------------HLWVQCENCYGLNYKKFFRSKMNICEQCGYHLKMSSSDRIELSIDP
ACCD_NUPAD      -------------SDFGRHSDLDRNLWVQCENCYGLNYKKFFSSKMNICEQCGYHLKMSSSDRIELLIDP
ACCD_ILLOL      -----------INTKYGR-------LWVQCENCYGLNYQKFFRSKMNICERCGYYLKMSSSDRIELSIDP
ACCD_CHLSC      -------------------------LWVQCENCYELNYRSFFRSKMNICEQCGYHLKMNSLDRIELSIDS
ACCD_IPOPU      ------------------------DLWLQCENCYGLNYKKFLKSKMNICEQCGYHLKMSSSDRIELLIDP
ACCD_CALFG      ------------------------HLWVQCENCYGLNYKKFVSFKMHICEQCGYHLKMSSSERIELSIDS
ACCD_POPTR      -----------------------KHLWVQCEICYGLNYKKFFKSKMNICEQCGYHLKMSSSDRIELSIDP
ACCD_POPAL      -----------------------KHLWVQCEICYGLNYKKFFKSKMNICEQCGYHLKMSSSDRIELSIDP
ACCD_PLAOC      ------------------------HLWIQCENCYGLNYKKFFRSKMNICEQCGYHLKMSSSDRIELSIDP
ACCD_EPIVI      -----------------------KHLWVQCENCYGLNYKKFLKSKINLCEQCGYHFKMSSSERIEVLVDP
ACCD_LIRTU      ------------------------HLWVQCENCYGLNYKKFFKSKMNICEQCGYHLKMSSSDRIELSIDP
ACCD_DRANE      -------------------------LWIQCDNCYGLMYKK-VEMN--VCEECGHYLKMTSSERIELLIDP
ACCD_AMBTC      --------------------------WVQCENCYALNYNKLFRSKMNVCEQCGYHLKMSSSDRIELSIDP
ACCD_LOTJA      -----------------------KHLWIECENCYGLNYKKILKSKMNICEHCGYHLKMSSSDRIELSIDP
ACCD_GOSHI      -----------------------KDLWVQCENCYGVNYKKSLNSKMNICEQCGYHLKMRSSDRIELSIDP
ACCD_OLIPU      --------RNRSNLISSKDFDITQNLWIQCDNCYGLMYKKVKMN---VCEQCGHYLKMMSSERIELSIDP
ACCD_LEPVR      --------RNRSNLMSSKDFDITQNLWIQCDNCYGLMYKKVKMN---VCEQCGHYLKMSSSERIELSIDP
ACCD_CUSRE      -------------------------LWLQCDNCYGLNYKKVLKSKMTICEQCGYHLQMSSSDRIELLIDP
ACCD_PINTH      -----------------------KKLWAQCDNCENLLYLRFLRENQSVCKECGYYLQMNSSDRIELPIDR
ACCD_NASOF      --------RNRSNLMSSKDFDITQNLWIQCDNCYGLMYKKVKMN---VCEQCGHYLKMSSSERIELSIDP
ACCD_ARAHI      --------RNRNNLMSSKDFDITKNLWIQCDNCYGLMYKK-VEMN--VCEECGHYLKMTSSERIELSIDP
ACCD_PHAAO      -----------------------KQLWVQCENCYGLNYKKFFSSKMNICEYCGYHLKMSSSDRIELFIDP
ACCD_GOSBA      -----------------------KDLWVQCENCYGVNYKKSLNSKMNICEQCGYHLKMRSSDRIELSIDP
ACCD_BARVE      -------------------------LWIQCDNCYGLMYKKVKMN---VCEQCGHYLKMSSSERIELSIDP
ACCD_AETGR      -------------------------LWIQCDNCXXXXXXXXXXXXXNVCEQCGYYLKISSSDRIELSIDP
ACCD_BRANA      ----------RNNLMSSKDFDITKNLWIQCDNCYGLKYKK-VEMN--VCEECGHYLKMTSSERIELSIDP
ACCD_PINKO      -------------------------LWAQCDNCESLLYIRFLRENQSVCKECGYYLQMNSSDRIELPIDR
ACCD_CUCSA      ------------------------DFWVICENCHKFNYKRLFKSKMNICEECGYHLKMNSSDRIELLIDP
ACCD_CAPBU      --------RNRSNLISSKDFDITQNLWIQCDNCYGLMYKK-VKIN--VCEQCGHYLKMSSSERIELSIDP
ACCD_ARATH      --------RNRSNLISSKDFDITQNLWIQCDNCYGLMYKKVKMN---VCEQCGHYLKMSSSERIELSIDP
ACCD_PICAB      -------------------------LWVQCDNCESLLYIRFLRENKSVCEECGYYLQMNSSDRIELLIDR
ACCD_CRUWA      --------RNRSNLISSKDFDITQNLWIQCDNCYGLMYKKVKMN---VCEQCGHYLKMSSSERIELSIDP
ACCD_OENEH      ------------------------HLWVHCKLCSGFNYKKILKSKNNVCEQCGSHLKMHSSDRIDLMLDP
ACCD_NANDO      ------------------------HLWVQCENCYGLNYKKFFRSKFNICEQCGYHLKMSSSDRIELSIDP
ACCD_CICAR      -----------------------KHLWVQCESCYGLNYKKFFKSKMNICEHCGDHLKMSSSDRIELLIDP
ACCDA_SACEN     --------------------------WTRCPNCRSLVYLRRLRRNGHVCPDCAHHMRMGVHDRIESLLDA
ACCD_PEA        ----------------------------------------------------------------------
ACCD_MYCTU      ----------------------------------------------------------------------
ACCD_MYCBO      ----------------------------------------------------------------------
ACCD_CUSGR      ----------------------------------------------------------------------
PCCB_BACSU      --------------------------------------------------------------------EG
PCCB_MOUSE      ----------------------------------------------------------------------
PCC5_MYCTU      ----------------------------------------------------------------------
PCCB_RAT        ----------------------------------------------------------------------
PCCB_MYCLE      ----------------------------------------------------------------------
PCCB_HUMAN      ----------------------------------------------------------------------
PCCB_BOVIN      ----------------------------------------------------------------------
PCCB_SACEN      ----------------------------------------------------------------------
PCCB_PIG        ----------------------------------------------------------------------
PCCB_RHOER      ----------------------------------------------------------------------
PCC6_MYCTU      ----------------------------------------------------------------------
PCC6_MYCBO      ----------------------------------------------------------------------
12S_PROFR       ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GIYEALAQPKVAQDPLKFRDSKKYTDRLRDSRAKTEQEDTILAGVGLLKGLKIVAVVHEFQFMAGSLGIA
ACCD_METFK      EGRSEIGMEVQPVDPLKFKDSKRYIDRLKTTQAEVGETDALIVMQGSIKAVGVVAAAFEFKFMGGSMGSV
ACCD_METCA      GNRLEIGEGLAPLDPLKFKDSKKYKDRLQQAQKATGEKDALIVVAGQLLGLPVVAGAFNFEFMGGSMGSV
ACCD_SHIBS      GSLVEMGSELEPKDVLKFRDSKKYKDRLASAQKETGEKDALVVMKGTLYGMPVVAAAFEFAFMGGSMGSV
ACCD_YERE8      GSEVELGSELEPKDILKFKDSKKYKDRLSAAQKETGEKDALVAMKGTLQGMPIVAASFEFAFMGGSMASV
ACCD_YERPY      GSEVELGSELEPKDILKFRDSKKYKDRISAAQKDTGEKDALVAMKGTLQGMPIVAASFEFAFMGGSMASV
ACCD_YERPS      GSEVELGSELEPKDILKFRDSKKYKDRISAAQKDTGEKDALVAMKGTLQGMPIVAASFEFAFMGGSMASV
ACCD_YERPG      GSEVELGSELEPKDILKFRDSKKYKDRISAAQKDTGEKDALVAMKGTLQGMPIVAASFEFAFMGGSMASV
ACCD_YERPE      GSEVELGSELEPKDILKFRDSKKYKDRISAAQKDTGEKDALVAMKGTLQGMPIVAASFEFAFMGGSMASV
ACCD_YERPB      GSEVELGSELEPKDILKFRDSKKYKDRISAAQKDTGEKDALVAMKGTLQGMPIVAASFEFAFMGGSMASV
ACCD_YERPA      GSEVELGSELEPKDILKFRDSKKYKDRISAAQKDTGEKDALVAMKGTLQGMPIVAASFEFAFMGGSMASV
ACCD_YERP3      GSEVELGSELEPKDILKFRDSKKYKDRISAAQKDTGEKDALVAMKGTLQGMPIVAASFEFAFMGGSMASV
ACCD_YERPP      GSEVELGSELEPKDILKFRDSKKYKDRISAAQKDTGEKDALVAMKGTLQGMPIVAASFEFAFMGGSMASV
ACCD_YERPN      GSEVELGSELEPKDILKFRDSKKYKDRISAAQKDTGEKDALVAMKGTLQGMPIVAASFEFAFMGGSMASV
ACCD_PSEAE      DGREELGADLEPVDRLKFRDSKKYKDRLAAAQKDTGEKDALIAMSGKLQGMPVVACAFEFSFMGGSMGAI
ACCD_PSEAB      DGREELGADLEPVDRLKFRDSKKYKDRLAAAQKDTGEKDALIAMSGKLQGMPVVACAFEFSFMGGSMGAI
ACCD_MICAN      NTWNCLDEQIRPTDPLKFRDRKSYSDRLRETQEKTGLTDAVRTGTGTIDGLPLALGVMDFRFMGGSMGSV
ACCD_ECOL6      XXXXXXXXXXXPKDVLKFRDSKKYKDRLASAQKETDEKDALVVMKGTLYGMPVVAAAFEFAFMGGSMGSV
ACCD_SALTY      XXXXXXXXXXXPKDVLKFRDSKKYKDRLASAQKETGEKDALVVMKGTLHGMPVVAAAFEFAFMGGSMGSV
ACCD_SALTI      XXXXXXXXXXXPKDVLKFRDSKKYKDRLASAQKETGEKDALVVMKGTLHGMPVVAAAFEFAFMGGSMGSV
ACCD_SALSV      XXXXXXXXXXXPKDVLKFRDSKKYKDRLASAQKETGEKDALVVMKGTLHGMPVVAAAFEFAFMGGSMGSV
ACCD_SALPK      XXXXXXXXXXXPKDVLKFRDSKKYKDRLASAQKETGEKDALVVMKGTLHGMPVVAAAFEFAFMGGSMGSV
ACCD_SALPB      XXXXXXXXXXXPKDVLKFRDSKKYKDRLASAQKETGEKDALVVMKGTLHGMPVVAAAFEFAFMGGSMGSV
ACCD_SALPA      XXXXXXXXXXXPKDVLKFRDSKKYKDRLASAQKETGEKDALVVMKGTLHGMPVVAAAFEFAFMGGSMGSV
ACCD_SALNS      XXXXXXXXXXXPKDVLKFRDSKKYKDRLASAQKETGEKDALVVMKGTLHGMPVVAAAFEFAFMGGSMGSV
ACCD_SALHS      XXXXXXXXXXXPKDVLKFRDSKKYKDRLASAQKETGEKDALVVMKGTLHGMPVVAAAFEFAFMGGSMGSV
ACCD_SALG2      XXXXXXXXXXXPKDVLKFRDSKKYKDRLASAQKETGEKDALVVMKGTLHGMPVVAAAFEFAFMGGSMGSV
ACCD_SALEP      XXXXXXXXXXXPKDVLKFRDSKKYKDRLASAQKETGEKDALVVMKGTLHGMPVVAAAFEFAFMGGSMGSV
ACCD_SALDC      XXXXXXXXXXXPKDVLKFRDSKKYKDRLASAQKETGEKDALVVMKGTLHGMPVVAAAFEFAFMGGSMGSV
ACCD_SALCH      XXXXXXXXXXXPKDVLKFRDSKKYKDRLASAQKETGEKDALVVMKGTLHGMPVVAAAFEFAFMGGSMGSV
ACCD_SALA4      XXXXXXXXXXXPKDVLKFRDSKKYKDRLASAQKETGEKDALVVMKGTLHGMPVVAAAFEFAFMGGSMGSV
ACCD_PSEA7      EGREELGADLEPVDRLKFRDSKKYKDRLSAAQKDTGEKDALIAMSGKLEGMPVVACAFEFSFMGGSMGAI
ACCD_SALAR      XXXXXXXXXXXPKDVLKFRDSKKYKDRLASAQKETGEKDALVVMKGTLHGMPVVAAAFEFAFMGGSMGSV
ACCD_BURP8      GRYE-IGQEILPVDALKFKDSRKYPDRLKEAMDETDETDAMVVMGGAIHTLPVVVACFEFAFMGGSMGSV
ACCD_XANAC      DTATTIAAQLGPVDALKFKDQKRYGERIKASQKASGEYDALIAMRGTLKGNPLVAAAFDFAFMGGSMGSV
ACCD_SHISS      XXXXXXXXXXXPKDVLKFRDSKKYKDRLASAQKETGEKDALVVMKGTLYGMPVVAAAFEFAFMGGSMGSV
ACCD_PHOLL      XXXXXXXXXXXPKDILKFRDSKKYKDRISAAQKQTQEKDALVVMKGTLSGMSVVAAAFEFAFMGGSMASV
ACCD_HAEIN      DSSQEIAADLEPKDILKFKDLKKYKDRINAAQKETGEKDALITMTGTLYNMPIVVAASNFAFMGGSMGSV
ACCD_HAEIG      DSSQEIAADLEPKDILKFKDLKKYKDRINAAQKETGEKDALITMTGTLYNMPIVVAASNFAFMGGSMGSV
ACCD_HAEIE      GSSQEIAADLEPKDILKFKDLKKYKDRINAAQKETGEKDALITMTGTLYDMPIVVAASNFAFMGGSMGSV
ACCD_HAEI8      DSSQEIAADLEPKDILKFKDLKKYKDRINAAQKETGEKDALITMTGTLYNMPIVVAASNFAFMGGSMGSV
ACCD_ECOL5      XXXXXXXXXXXPKDVLKFRDSKKYKDRLASAQKETGEKDALVVMKGTLYGMPVVAAAFEFAFMGGSMGSV
ACCD_CHRSD      EGREEIAADLQPVDRLKFRDSKKYKDRLAAAQKETDENDALIAMRGKLDGLPVVAVAFEFSFMGGSMGAV
ACCD_PROMH      GSTTELGSELEPKDILKFRDSKKYKDRIAAAQKQTHEKDALVVMKGTLKEMPVVAASFEFAFMGGSMASV
ACCD_ENTS8      XXXXXXXXXXXPKDVLKFRDSKKYKDRLATAQKETGEKDALVVMKGTLHGMPVVAAAFEFAFMGGSMGSV
ACCD_ECOUT      XXXXXXXXXXXPKDVLKFRDSKKYKDRLASAQKETGEKDALVVMKGTLYGMPVVAAAFEFAFMGGSMGSV
ACCD_ECOSM      XXXXXXXXXXXPKDVLKFRDSKKYKDRLASAQKETGEKDALVVMKGTLYGMPVVAAAFEFAFMGGSMGSV
ACCD_ECOLI      XXXXXXXXXXXPKDVLKFRDSKKYKDRLASAQKETGEKDALVVMKGTLYGMPVVAAAFEFAFMGGSMGSV
ACCD_ECOLC      XXXXXXXXXXXPKDVLKFRDSKKYKDRLASAQKETGEKDALVVMKGTLYGMPVVAAAFEFAFMGGSMGSV
ACCD_ECOK1      XXXXXXXXXXXPKDVLKFRDSKKYKDRLASAQKETGEKDALVVMKGTLYGMPVVAAAFEFAFMGGSMGSV
ACCD_ECOHS      XXXXXXXXXXXPKDVLKFRDSKKYKDRLASAQKETGEKDALVVMKGTLYGMPVVAAAFEFAFMGGSMGSV
ACCD_ECODH      XXXXXXXXXXXPKDVLKFRDSKKYKDRLASAQKETGEKDALVVMKGTLYGMPVVAAAFEFAFMGGSMGSV
ACCD_ECO57      XXXXXXXXXXXPKDVLKFRDSKKYKDRLASAQKETGEKDALVVMKGTLYGMPVVAAAFEFAFMGGSMGSV
ACCD_ECO24      XXXXXXXXXXXPKDVLKFRDSKKYKDRLASAQKETGEKDALVVMKGTLYGMPVVAAAFEFAFMGGSMGSV
ACCD_XANOR      DTATTIAAQLGPVDVLKFKDQKRYGERIKASQKASGEYDALIAMRGTLKGNPLVAAAFDFAFMGGSMGSV
ACCD_XANOP      DTATTIAAQLGPVDVLKFKDQKRYGERIKASQKASGEYDALIAMRGTLKGNPLVAAAFDFAFMGGSMGSV
ACCD_XANOM      DTATTIAAQLGPVDVLKFKDQKRYGERIKASQKASGEYDALIAMRGTLKGNPLVAAAFDFAFMGGSMGSV
ACCD_SHIDS      XXXXXXXXXXXPKDVLKFRDSKKYKDRLASAQKETGEKDALVVMKGTLYGMPVVAAAFEFAFMGGSMGSV
ACCD_SHIB3      XXXXXXXXXXXPKDVLKFRDSKKYKDRLASAQKETGEKDALVVMKGTLYGMPVVAAAFEFAFMGGSMGSV
ACCD_XANC5      DTATTIAAQLGPVDALKFKDQKRYGERIKASQKASGEYDALIAMRGTLKGNPLVAAAFDFAFMGGSMGSV
ACCD_ACTSZ      DSMTEIAADLEPKDILKFKDLKKYKDRLSAAQKDTGEKDALVAMSGTLYGMPIVAAASNFAFMGGSMGSV
ACCD_STRM5      DSTTEIAARLGPTDLLKFKDQKKYSERIKIAQKNTGEYDALIAMRGLLKGRALVASSFDFAFMGGSMGSV
ACCD_SERP5      XXXXXXXXXXXPKDVLKFKDSKKYKDRLVAAQKATGEKDALVVMKGTLYGMPIVAASFEFAFIGGSMSSV
ACCD_PSEMY      DGREEIGADLEPVDRLKFRDSKKYKDRLAAAQKQTGEKDALIAMSGTLEGMPIAVCAFEFSFMGGSMGAI
ACCD_STRMK      DSTTEIGARLGPTDLLKFKDQKKYSERIKIAQKNTGEYDALIAMRGLLKGRALVASSFDFAFMGGSMGSV
ACCD_PSESM      DGREELGVDLEPVDRLKFRDGKKYKDRLTAAQKQTGEKDALISMSGTLLGMPVVASAFEFSFMGGSMGAI
ACCD_MARAV      DGREELAAHLEPSDRLKFKDSKRYKDRLAAAQKSTGEKDALIAMRGTTMGVPLVACAFEFNFLGGSMGQV
ACCD_COXBN      GEQEELAEDILPVDRLKFRDSKKYKDRLSAAQKATEEKEALVVYKGNIYGNPIVXXXXXXXXVGGSMGAA
ACCD_THICR      GTGVEISAEVTPVDALKFKDIKPYKTRIAQAQKATGEKDSFITMTGKIQGLEVVAGAFEFKFMGGSMGSV
ACCD_PSEU2      EGREELGADLEPVDRLKFRDGKKYKDRLTAAQKQTGEKDALISMSGTLLGMPVVASAFEFSFMGGSMGAI
ACCD_PSEPF      EGRTELGADLEPVDRLKFRDGKKYKDRLVAAQKQTGEKDALVSMSGTLLGMPVVVSAFEFSFMGGSMGAI
ACCD_PSE14      EGREELGADLEPVDRLKFRDGKKYKDRLTAAQKQTGEMDALISMSGTLLGMPVVASAFEFSFMGGSMGAI
ACCD_COXBU      GEQEELAEDILPVDRLKFRDSKKYKDRLSAAQKATEEKEALVVYKGNIYGNPIVXXXXXXXXVGGSMGAA
ACCD_COXBR      GEQEELAEDILPVDRLKFRDSKKYKDRLSAAQKATEEKEALVVYKGNIYGNPIVXXXXXXXXVGGSMGAA
ACCD_SHIFL      XXXXXXXXXXXPKDELKFRDSKKYKDRLASAQKETGEKDALVVMKGTLYGMPVVAAAFEFAFMGGSMGSV
ACCD_PSEE4      DGRAELGADLEPVDRLKFRDGKKYKDRLTAAQKQTGEKDALISMSGNLMGLPVVVSAFEFSFMGGSMGAI
ACCD_ACAM1      ETWVAMDNNLVACDPLQFRDRKAYCDRIQEYQSKTGLQDAVQTGVGELDGLPLALGVMDFRFMGGSMGSV
ACCD_PSEPG      EGRAELGADLEPVDRLKFRDGKKYKDRLTGAQKQTGEKDALISMSGTLMGMPIVVSAFEFSFMGGSMGAI
ACCD_ERWCT      ENTVELGSELEPKDVLKFRDSKKYKDRLVSAQKQSDEKDAMVVMKGTLYGMPIVVASFEFAFMGGSMASV
ACCD_ACTPJ      DSAQEIAAELEPQDVLKFKDLKKYKDRLTAAQKQTGEKDSFITMYGTLHNMPVVVASFNFEFMGGSMGSV
ACCD_ACTP7      DSAQEIAAELEPQDVLKFKDLKKYKDRLTAAQKQTGEKDSFITMYGTLHNMPVVVASFNFEFMGGSMGSV
ACCD_PSEPK      EGRAELGADLEPVDRLKFRDGKKYKDRLTAAQKQTGEKDALISMSGTLMGMPIVVSAFEFSFMGGSMGAI
ACCD_PSEP1      EGRAELGADLEPVDRLKFRDGKKYKDRLTAAQKQTGEKDALISMSGTLMGMPIVVSAFEFSFMGGSMGAI
ACCD_PSEF5      EGRAELGADLEPVDRLKFRDGKKYKDRLTAAQKQTGEKDALISMSGTLLGMPVVVSAFEFSFMGGSMGAI
ACCD_HAEDU      GSAEEIAANLEPQDILKFKDLKKYKDRLTAAQKQTGEKDAFITMFGTLYEMPIVVASFNFEFMGGSMGAV
ACCD_ACTP2      DSAQEIAAELEPQDVLKFKDLKKYKDRLTAAQKQTGEKDSFITMYGTLHNMPVVVASFNFEFMGGSMGSV
ACCD_PSEHT      GDRVELGTQHEPKDVLKFRDSKKYSDRITAAQKSSGEKDALVAMKGHLKGIPVAAVAFEFSFMGGSMASV
ACCD_SYNJA      GSWQPLDEHLAPTDPLHFFDQKPYAERLASYQERTQLKDAVLTGLGSLEGIPVAMGVMDFRFMGGSMGSV
ACCD_SHIF8      XXXXXXXXXXXPKDELKFRDSKKYKDRLASAQKETGEKDALVVMKGTLYGMPVVAAAFEFAFMGVSMGSV
ACCD_PSEA6      GERTELGSELEPKDLLKFKDSKKYKDRLVAAQKATNEKDALVVMQGKLKGMPVVVAAFEFAFMGGSMASV
ACCD_MARMS      EGRHEIAAHLEPEDKLKFKDSKRYKDRLADAQKATGEKDALVAMQGALNGMPVVAVAFEFSFLGGSMGAI
ACCD_DECAR      EGRFEIGAEVLPVDSLKFKDSKKYPDRLMEANESTGESDSLVVLQGAIKTMPVVAAAFEFDFMGGSMGSV
ACCD_AERHH      QGRTEIGAELEPQDVLKFKDSKRYKDRLSAAQKETGEKDALVVMKGTLKGVPVVACSFEFSFIGGSMSSV
ACCD_PSEPW      XXXXXXXXXXXPVDRLKFRDGKKYKDRLVGAQKQTGEKDALISMSGTLMGMPIVVSAFEFSFMGGSMGAV
ACCD_XANCP      SPTTEIAAQLGPVDVLKFKDQKKYGERIKASQKSSGEYDALIAMRGMLKGNPLVAAAFDFAFMGGSMGSV
ACCD_XANC8      SPTTEIAAQLGPVDVLKFKDQKKYGERIKASQKSSGEYDALIAMRGMLKGNPLVAAAFDFAFMGGSMGSV
ACCD_AERS4      QGRTEVGAELEPQDILKFKDSKRYKDRLSAAQKATGEKDALVVMKGTLKGVPVVACSFEFSFIGGSMSSV
ACCD_XANCB      SPPTEIAAQLGPVDVLKFKDQKKYGERIKASQKSSGEYDALIAMRGMLKGNPLVAAAFDFAFMGGSMGSV
ACCD_PROMM      GSFKSLDRNLSPTDPLGFKDRRAYADRLRESQASTGMKDGVVTGLCQVEGMPMAMAVMDFRFMGGSMGSV
ACCD_PROM3      GSFKSLDRNLSPTDPLGFKDRRAYADRLRESQASTGMKDGVVTGLCQVEGMPMAMAVMDFRFMGGSMGSV
ACCD_CYAA5      NTWKPLNDHLTPTDPLKFCDRKPYSDRIKDTQEKTGLVDAVQTGTGLIDGLPLALGVMDFRFMGGSMGSV
ACCD_BLOPB      GSTSELGSEFEPKDVLKFRDSKRYKDRLISAQKITKEKDALIVMQGTLYGMKIVAASFEFAFIGGSMSSV
ACCD_SYNS3      NSFVPMDQELQPTDPLGFKDRRAYADRLRETQASTGLRDGVITGLCEVEGIPMALAVMDFRFMGGSMGSV
ACCD_SYNPW      GSFEAMDEALAPTDPLGFKDRRAYADRLRETQSGTGLRDGVITGMCRVDGIPMALAVMDFRFMGGSMGSV
ACCD_CELJU      QNRQELATDVEPVDRLKFKDIKKYKDRLSSAQKDTGEKDALIAMRGELKGMPVVAVAFEFAFHGGSMGYV
ACCD_SYNY3      KTWQPINEHLRPTDPLKFKDRKSYKDRIRDTQKATDLTDAVQTGHGRLDGLPIALGVMDFRFMGGSMGSV
ACCD_PSEU5      DGREEIAAELEPVDRLKFRDSKKYKDRLSAAQKQTGEKDALIAMSGKVLNVPVVACAFEFSFMGGSMGAI
ACCD_NOSP7      NTWKPLDEHLRPTDPLEFRDRKLYSDRLRETQDKIGLIDAVRTGLGQINGLPIALGVMDFRFMGGSMGSV
ACCD_SYNP6      GTWQFLDEAVSPTDPLGFRDRKSYSDRLKETQANTGLSDAVRTGVGLLEGQPVALGVMDFRFMGGSMGSV
ACCD_SYNE7      GTWQFLDEAVSPTDPLGFRDRKSYSDRLKETQANTGLSDAVRTGVGLLEGQPVALGVMDFRFMGGSMGSV
ACCDA_NATTJ     DTWVELDQNIISENPLEFEGYSEKVDKLQK---KTELKEAILTGLGKINGQQAVIGAMDSRFLMGSMGSV
ACCD_PROMA      GSFIALDKNLAPIDPLGFKDRRAYADRLRESQASTGLKDGVTTGVCRVEEIPLALAVMDFRFMGGSMGSV
ACCD_PORPU      GSWEPMDVHLISTDPLGFKDQKLYSQRLKDTAFKTSLQDAVQTGVGTMLGQKVCLGIMDFRFMGGSMGSV
ACCD_SYNR3      GSFIPVDGELSPTDPLAFKDRRAYADRLRDSQRQTGLRDAVVCGTGTIEGQGIALAVMDFRFMGGSMGSV
ACCDA_CLOTE     GTWAEMDKNLCSVNPLNF---KGYNDKIEKAQEKTDLNEAVITGVGSIKGEKTVICIMDSRFFMGSMGSV
ACCD_SYNJB      GSWQPLDEHLAPTDPLHFFDQKPYSERLATYQERTQLKDAVLTGLGSLEGIPVAIGVMDFRFMGGSMGSV
ACCD_GEOBB      GSFTEFDAGVVSVDFLEFKDSKSYQDRIDQALAKGGSKDAIICGSGRIEGTPVQICXXXXXXXXXXXXXX
ACCD_SODGM      XXXXXXXXXXXPKDILKFRDSKKYKDRLAAAQKATDEKDALVVMKGELYGMPVVVASFEFAFIGGSMSSV
ACCD_PROM1      NTFKSINNNLTPVDPLGFKDRRAYADRLRESQASTGLKDGVLTGTCEVNSIPMALAVMDFRFMGGSMGSV
ACCD2_VIBPA     GERIELASEYEPKDLLNFKDKKRYKERLALSQKSTGEKDALVVMKGELLGLPIVACAFEFSFMAGSMGSV
ACCD_SYNPX      GSFEALNEALEPTDPLTFKDRRAYADRLRESQAATGLRDGVVTGLCRVDGLAMALAVMDFRFMGGSMGSV
ACCD_ENT38      GTMVELGSELEPKDLLKFRDSKKYKDRIASAQKETGEKDALVVMKGTLHEMPVVAAAFEXXXXXXXXXXX
ACCD_PROMT      NTFKSINNHLTPVDPLGFKDRRAYADRLRESQAGTGLKDGVLTGTCEVNSIPMALAVMDFRFMGGSMGSV
ACCD_PORYE      GSWQPMDVHLISTDPLGFKDQKLYSQRLKDTAFKTGLQDAVQTGTGTMQGKKVCLGIMDFRFMGGSMGSV
ACCD_COLP3      DNRMELGEEFEAQDILKFKDSKRYKDRLSAAQKNTGEKDALVVMKGELHGMPVVVAAFEFAFLGGSMASV
ACCD1_VIBPA     GNRVELGTELEPQDKLKFKDSKRYKERISAAQKSSGEKDALIVMQGELLGMPLVACAFEXXXXXXXXXXX
ACCD_PASMU      DSSQELSAELEPKDILKFKDLKKYKDRISAAQKETGEKDALISMFGTLYGMPIVAAAXXXXXXXXXXXXX
ACCD_GLOVI      DSWVSTDDHLLANDPLGFNDIKSYPERLAQAREKTGLSDAIVTGLATLEGRPIALGVMDFRFMGGSMGSV
ACCD_MANSM      DGVTELAADLEPKDILKFRDLKKYKDRLTAAQKDTGEKDALVVLSGTLYGLPIVAAASNXXXXXXXXXXX
ACCD_VIBCH      GERVELGEELEPQDKLKFKDSKRYKERLAAAQKASGEKDALVVMKGAVLGVPVVACAFEXXXXXXXXXXX
ACCD_SYNSC      DSFQVLNADLAPVDPLGFKDRRAYADRLRESQASTGLRDGVVTGLCRVEGIPMGLAAMDFRFMGGSMGSV
ACCD_ALHEH      EGQVEIGADVQPVDALRFRDSKKYRDRLAQAQKGTGERDALVAMQGRLRGMPVVAVAXXXXXXXXXXXXX
ACCD_CITK8      XXXXXXXXXXXPKDVLKFRDSKKYKDRLASAQKETGEKDALVVMKGTLHDMPIVAAAFEXXXXXXXXXXX
ACCD_CHLVU      NTWRPFDEMVSPCDPLEFRDQKAYTERLKDAQERTGLQDAVQTGTGLLDGIPIALGVMDFHFMGGSMGSV
ACCD1_VIBHB     GERVELGTELEPQDKLKFKDSKRYKERISAAQKSSGEKDALIVMQGELLGMPLVACAFEXXXXXXXXXXX
ACCD_CLOBK      DTFKEWDYKIKTENPLDF---KGYDEKIEHIKEKTNLSEAVTTGKGKIAGMEAVVCIMDSKFMMGSMGCV
ACCD_CLOAB      GTFIEFDKNMMAANPLEFPN---YEAKIKSMQEKTGLKDGVVTGLGNINGYKTVIAVMDSNFMMGSMGSV
ACCD_VIBC3      GERVELGEELEPQDKLKFKDSKRYKERLAAAQKASGEKDALVVMKGAVLGVPVVACAFEXXXXXXXXXXX
ACCD_IDILO      DNREEIGTDLEPKDVLRFKDSKKYKDRIAAAQKSTGENDALIAEKGTVKGVPLVAVAFDFNFMGGSMASV
ACCD_BAUCH      CSKYELGSELEPKDILKFRDSKKYKDRLIAAQKATKEKDALVVMKGTLYGMPIVAASFEFGFIGGSMSSV
ACCD_ANAVT      NTWRPMDENLRATDPLQFRDRKAYSDRLREMEDKLGLLDAVKTGLGQINSSPVALAVMDFRFMGGSMGSV
ACCD_ANASP      NTWRPMDENLRATDPLQFRDRKAYSDRLREMEDKLGLLDAVKTGLGQINSSPVALAVMDFRFMGGSMGSV
ACCD_ERWT9      XXXXXXXXXXXPKDVLKFRDSKKYKDRLSAAQKDTSETDALIVMKGTLHGMPVVAAAFEXXXXXXXXXXX
ACCD_VIBVY      GNRVELGGELEPQDKLKFKDSKRYKERIAAAQKSSGEKDALVAMKGELLGMPIVACAFEXXXXXXXXXXX
ACCD_VIBVU      GNRVELGGELEPQDKLKFKDSKRYKERIAAAQKSSGEKDALVAMKGELLGMPIVACAFEXXXXXXXXXXX
ACCD_PELPD      ATWQELDSGMTSVDFLQFKDSKSYQERIDSALSKGGSRDAVVCVEGSIEGTAVQVAXXXXXXXXXXXXXX
ACCD_KLEP7      XXXXXXXXXXXPKDVLKFRDSKKYKDRLASAQKETGEKDALVVMKGTLYAMPVVAAAFEXXXXXXXXXXX
ACCD_HAHCH      ADRMEIAPELEPADRLKFKDTKRYKDRLVSNQKATGEKDALVAFKGTXXXXXXXXXXFEFNFLGGSMGAV
ACCD2_VIBHB     EKQSEIACEYEPKDVLNFKDKKRYKERIALAQKSTGEKDALVAMKGELLGLPIVACAFEFSFMAGSMGSV
ACCD_PROM5      DSFKEFDDSLSPTDPLKFKDRRSYSDRIKESQEGTGLKDGVITGICSINSMPLALAVMDFRFMGGSMGSV
ACCD_PHOPR      DSQVELAADLEPKDMLKFRDSKKYKDRISAAQKSSGEKDALIVMKGTLLEQPIVACAFEXXXXXXXXXXX
ACCD_SYNP2      GTWTEISQNVAPTDPLKFRDKKAYSDRLKDYQEKTNLTDAVITGTGLIDGLPLALAVMDXXXXXXXXXXX
ACCD_PROM0      NSFEEFDSLLSPTDPLGFKDRRSYADRIKESQAGTGLRDGVVTGICSVNSMPLALAVMDFRFMGGSMGSV
ACCD_CUPTR      GRYE-IGQEIVPVDALKFKDSKKYPDRIKAAMEDTGETDAMVVMGGAIHTIPVVASCFEFEFMGGSMGSV
ACCD_PROM4      NSFKSTDKHLSPVDPLGFKDRRAYADRLRESQSSTGMKDGVTTGVCQVEQIPLALAVMDFRFMGGSMGSV
ACCD_HAES2      DSIVEIAADLEPKDILKFRDLKKYKDRLSAAQKETGEKDALITVSATLYGMPIVVAALNXXXXXXXXXXX
ACCD_HAES1      DSIVEIAADLEPKDILKFRDLKKYKDRLSAAQKETGEKDALITVSATLYGMPIVVAALNXXXXXXXXXXX
ACCD_VIBF1      EGRVEIGAELEPKDVLKFKDSKRYKDRISAAQKSSEETDALVVMKGTLLELPVVACAFEXXXXXXXXXXX
ACCD_VIBFM      EGRVEIGAELEPKDVLKFKDSKRYKDRISAAQKSSDETDALVVMKGTLLELPVVACAFEXXXXXXXXXXX
ACCD_PROM2      DSFKEFDSSLSPTDPLGFKDRRSYADRIKDSQTSTGLRDGVITGFCSVNSMPLALAVMDFRFMGGSMGSV
ACCD_ALCBS      GVQTEIGTELSPVDRLKFKDSKKYKDRLVAAQKATDEKDALVVLKGALHGEPLVACAXXXXXXXXXXXXX
ACCD_WIGBR      NNILELGKNLEPKDILKFKDTKKYKDRLYIAQKLTKEKDAIIVMKGSLYKMPIVAAAFEFSFIGGSMSSV
ACCD_CLOD6      GTFMEFNSDVEFQNPLNF---PKYKEKVDSYKEKTKESEAVVTGYGRINGIKTVICVMNPDFMMGSMGSI
ACCD_BURM1      GRYE-IGQEIVPVDSLKFKDSRKYPDRLKEAMDETGETDAMVVMGGAIHTLPVVAACXXXXXXXXXXXXX
ACCD_BURCJ      GRYE-IGQEIVPVDTLKFKDSRKYPDRLKEAMDETGETDAMVVMGGAIHTLPVVAACXXXXXXXXXXXXX
ACCD_BURCA      GRYE-IGQEIVPVDTLKFKDSRKYPDRLKEAMDETGETDAMVVMGGAIHTLPVVAACXXXXXXXXXXXXX
ACCD_SYNS9      ESFQPLNEHLAPIDPLGFKDRRAYADRLRESQSATGLNDGVVTGLCRVDGIGMGLAVMDFRFMGGSMGSV
ACCD_TRIEI      NTWVPIDPELRATDPLKFSDRKPYSDRLLEYQRKTGLPDAVQTGIGNIETEPVALXXXXXXXXXXXXXXX
ACCD_PROM9      NSFKEFDSSLSPTDPLGFKDRRSYADRIKESQAGTGLRDGVITGFCSVNSMPLALAVMDFRFMGGSMGSV
ACCD_PROMP      DSFKEFDESLSPTDPLKFKDRRSYSERIKESQQGTGLKDGVITGLCSVNSMPLALAVMDFRFMGGSMGSV
ACCD_ALTMD      GDRVELGAEHEPQDVLKFKDSKRYKDRIVAAQKSTNEKDALVVMQGKLKGMPVVVACFEFAFMGGSMASV
ACCD_BLOFL      GSVCELGQELLPXXXXXXXXXXXXXXXLIDAQKKTQEKEALIVMQGTIYSMQVVVAAFEFDFIGGSMSSA
ACCD_PROMS      NSFKEFDSLLSPTDPLGFKDRRAYADRIKESQAGTGLRDGVVTGICSVNSMPLALAVMDFRFMGGSMGSV
ACCD_CLOB8      DTFKEFWKDLKTTNPLDF---KGYEEKLKST--KTDSTEAVVTGVGKLNGIEVACAIMDSFFMMGSMGTV
ACCD_ANTFO      GTWHPMDEDMVARDALKFSDEDSYKNRVLFYQKRTGLTDAIQTGIGKLNGIPIALGVMDFQFMGGSMGSV
ACCDA_SALTO     GSFTALADRAPEVDPIGFVDVLPYPHRLTAARSGTGLAEAVVCGTATVAGSRCVIAVMDFRFLGGSLGCA
ACCD_CLOBB      DTFKEMWKSLKTNNPIDFED---YEEKINQSQSNTGSKEAVVTGVGRINDLEVACAIMDSFFMMGSMGTV
ACCD_CLOBA      DTFKEMWKSLKTNNPIDFED---YEEKINKSQSNTGSKEAVVTGVGRINDLEVACAIMDSFFMMGSMGTV
ACCD_MARPO      GTWYPMDEDMTARDVLKFSDEDSYKNRIAFYQKRTGLTDAIQTGIGQLNGIPIALGVMDFQFMGGSMGSV
ACCD_HALHL      SCEAVIGAELQPSDFLRFRDSKRYRDRLNQAQKATGENDALVAMRGAVHQRPVVVCAFEFGFMGGSMGTI
ACCD_CLOP1      NTFVEFDKKMVGRNPLDFNG---YEEKIKGYQKKSHVIEGVVTGEAYIAQRKVVLCVMDSNFMMGSMGTA
ACCD_CLOPS      NTFVEFDKKMIGRNPLDFNG---YEEKIKGYQKKSHVIEGVVTGEAYIAQRKVVLCVMDSNFMMGSMGTA
ACCD_CLONN      GTFREFGENITSKNPLDFSG---YEDXXXXXXXXXXXXXXVITGKGKIYGKNVVIAVMDSRFMMGSMGSA
ACCD_ADICA      NTWIPLDEDMSARDILSFSDEDSYETRILLSQEKTGLTDAVQTGIGYLNGTLIALGVMDFHFMGGSMGSV
ACCD_HELSJ      GTWYPLNETISPKDPIKFTDTQSYAQRIQSTQEKLGMQDAVQTGTGLINGIPFAIGIMDFRFMGGSMGSV
ACCD_PHYPA      GTWQPMYEDMVARDVLKFSDEDSYKNRVIFYQKRTGLTDAIQTGIGKLNKNLVALGVMDFQFMGGSMGSV
ACCD_SOLTU      GTWDPMDEDMVSLDPIEFHSEEEYKDRIDSYQRKTGLTEAVQTGIGQLNGIPVAIGVMDFQFMGGSMGSV
ACCD_SOLBU      GTWDPMDEDMVSLDPIEFHSEEEYKDRIDSYQRKTGLTEAVQTGIGQLNGIPVAIGVMDFQFMGGSMGSV
ACCD_PARUW      NTFKPLFQNLQPVDTLNFVDTEPYPKRLANAQEKSTSNEAVVVGTCMINKHKIALGVLDXXXXXXXXXXX
ACCD_SOLLC      GTWDPMDEDMVSLDPIEFHSEEEYKDRIDSYQRKTGLTEAVQTGIGQLNGIPVAIGVMDFQFMGGSMGSV
ACCD_NICTO      GTWDPMDEDMVSLDPIEFHSEEEYKDRIDSYQRKTGLTEAVQTGIGQLNGIPVAIGVMDFQFMGGSMGSV
ACCD_FAGEA      GTWEPMDEDMVSTDPIEFHSQEEYKDRINSYQKETGLTDAVQTGIGQLNGIPVAIGVMDFQFMGGSMGSV
ACCD_ATRBE      GTWDPMDEDMVSLDPIEFHSEEEYKDRIDSYQRKTGLTEAVQTGIGQLNGIPVAIGVMDFQFMGGSMGSV
ACCD_TOBAC      GTWDPMDEDMVSLDPIEFHSEEEYKDRIDSYQRKTGLTEAVQTGIGQLNGIPVAIGVMDFQFMGGSMGSV
ACCD_NICSY      GTWDPMDEDMVSLDPIEFHSEEEYKDRIDSYQRKTGLTEAVQTGIGQLNGIPVAIGVMDFQFMGGSMGSV
ACCDA_FRAAA     XSARPVDVPAIDGDPLEFTDTRPYRDRLRDARASTGLDEAAACVRGTIDGNPVVVVVMDFRFLGGSLGAT
ACCD_COFAR      GTWDPMDEDMASLDPIEFHSEEEYKDRIDSYQKKTGLTEAVQTGIGQLNGIPVAVGVMDFQFMGGSMGSV
ACCD_PIPCE      GTWDPMDEDMVSIDPIEFHSEEEYKDRLDSYQRKTGLTEAVQTGVGQLNGIPVAIGVMDFQFMGGSMGSV
ACCD_HELAN      GTWEPMDEDMVSLDPIEFHSEEEYKNRIDSYQRKTGLTEAVQTGIGQLDGINVAIAVMDFQFMGGSMGSV
ACCD_GUIAB      GTWEPMDEDMVSLDPIEFHSEEEYKNRIDSYQRKTGLTEAVQTGIGQLDGINVAIAVMDFQFMGGSMGSV
ACCD_EUCGG      GTWDPMDEDMVSLDPIEFHSEEEYKDRIDSYQRKTGLTDAVQTGTGRLNGIPIAIGVMDFQFMGGSMGSV
ACCD_DAUCA      DTWDAMDEDMVSLDPIEFHSEEEYKDRIDSYQRKTGLTEAVQTGIGQLNGIPIALGVMDFQFMGGSMGSV
ACCD_BUXMI      GTWDPMDEDMVSMDPIEFHSEEEYKDRINSYQRKTGLTEAVQTGIGQLNGIPIAIGVMDFQFMGGSMGSV
ACCD_RANMC      GTWDAMDEDMVSVDPIEFHSEEEYKDRIDSYQKKTGLTEAVQTGIGQLNGISIAIGVMDFQFMGGSMGSV
ACCD_PANGI      GTWDPMDEDMVSLDPIEFHSEEEYKDRVDSYQRKTGLTEAVQTGIGQLNSIPVAIGVMDFQFMGGSMGSV
ACCD_LEMMI      GTWDPLDENMVSTDPIEFHSEEEYRDRIDSYQKKTGLTEAVQTGIGELNGIPIAIGVMDFQFMGGSMGSV
ACCD_ANGLY      DTWIPMDEDMVAQDVLKFSDEDSYRNRISLSQKRTGLTDAVQTGIGNLNGTPVALGVMDFQXXXXXXXXX
ACCD_LACSA      GTWEPMDEDMVSLDPIEFHSEEEYKNRIDSYQRNTGLTEAVQTGRGQLNGITVAIGVMDFQFMGGSMGSV
ACCD_MORIN      GTWDPMDEDMVSLDPIEFNSEEEYKDRIDSYQRKTGLTEAVQTGTGKLNGIPVAIGVMDFQFMGGSMGSV
ACCD_CERDE      GTWDPMNEDMVSTDPIEFHSEEEYRDRIDSYQIKTGLTEAVQTGIGQLNGMPIAIGVMDFQFMGGSMGSV
ACCD_CARPA      GTWNPMDENMVSLDPIEFHSEEEYKDRIDSYQRKTGLTEAVQTGTGQLNGIPIALGVMDFQFMGGSMGSV
ACCD_LOBMA      GTWNPMDEDMVSADPIKFHSKEEYKNRINSFQKKTGLTDAVQTGTGQLNGIPVALGVMDFQFMGGSMGSV
ACCD_NYMAL      GTWDPMDENMVSMDPIEFHSEEDYRDRINSYQIETGLAEAVQTGIGKLNGIPIAIGVMDFKFMGGSMGSV
ACCD_DIOEL      DTWDPMDEDMVSIDPIEFHSEEEYRDRIDSYQRKTGLTEAIQTGIGQLNGIPIAIGVMDFQFMGGSMGSV
ACCD_CITSI      GTWDPMDDDMVSIDPIEFSEEEPYKNRIDSYQSKTGLTEAVQTGTGQLNGIPIAIGVMDFQFMGGSMGSV
ACCD_SOYBN      GTWNPMDEDMVSLDPIEFHSEEEYKDRIDSYQRKTGLTEAVQTGTGQLNGIPVAIGIMDFQFMGGSMGSA
ACCD_VITVI      GTWDPVDEDMVSLDPIEFHSGEEYKERIDFYQRKTGLTEAVQTGTGQLNGIPVAIGVMDFQFMGGSMGSV
ACCD_SPIOL      GTWNPMDDDMVSMDPIGFHSEEEYKDRIDSYQIKTGLTEAVQTGIGQLNGIPVAIGVMDFQFMGGSMGSV
ACCD_AETCO      GTWNPMDEDMVSTDPIQFHSREEYQNRIDSAQKKTGLTDAVQTGTGQLNGIPVALGVMDFQFMGGSMGSV
ACCD_DRIGR      GTWDPMDEDMVSIDPIEFHSEEEYRDRIDSYQRKTGLTEAVQTGIGQLNGIPIAIGVMDFQFMGGSMGSV
ACCD_NUPAD      GTWDPMDENMVSIDPIEFHSEEEYRDRINSYQIETGLAEAVQTGIGKLNGIPIAIGVMDFKFMGGSMGSV
ACCD_ILLOL      GTWDPMDEDMISMDPIEFHSEEEYRDRIDFFQRTTGLTEAVQTGIGQLNGIPIAIGVMDFQFMGGSMGSV
ACCD_CHLSC      GTWNPMDDDMVSMDPIEFHSMEEYRDRIDSYQRNTGLTEAVQTGIGQLNGIPIAIGVMDFQFMGGSMGSV
ACCD_IPOPU      GTWDPMDEYMVSQDPIEF-DSETYKDRIDFYQTKTGLTEAVQTGIGQLNGIPVAIGVMDFHFLGGSMGSV
ACCD_CALFG      GTWDPMDEDMVSMDPIQFHSEEEYRDRIDSYQRKTGLTEAVQTGIGQLNGIPVAIGVMDFQFMGGSMGSV
ACCD_POPTR      GTWDPMDEEMFSLDPIDFHSEEEYKDRIDSYQKKTGLTEAIQTGIGQLNGIPVAIGVMDFQFMGGSMGSV
ACCD_POPAL      GTWDPMDEEMFSLDPIDFHSEEEYKDRIDSYQKKTGLTEAIQTGIGQLNGIPVAIGVMDFQFMGGSMGSV
ACCD_PLAOC      GTWDPMDEDMVSIDPIEFHSEEEYKDRIDSYQRKTGLTEAVQTGIGQLNGIPIAIGVMDFQFMGGSMGSV
ACCD_EPIVI      DTWYPMDEDMSSLDPIEFHSEEEYKDRIYSYQKRTGLTEAVQTGLGQLNGIPIAIGVMDFQFMGGSMGSV
ACCD_LIRTU      GTWDPMDEDMVSIDPIEFHSEEEYRDRIDSYQRKTGLTEAVQTGIGQLNGIPIAIGVMDFEFMGGSMGSV
ACCD_DRANE      GTWNPMDEDMVSADPIKFHSREEYKNRIDSAQKKTGLTDAVQTGTGQLNGIPVALGVMDFQFMGGSMGSV
ACCD_AMBTC      GTWHPMDEDMVSTDPIEFHSEEEYRDRIDSYQRQAGLTDAVQTGIGQLEGIPIAIGVMDFQFMGGSMGSV
ACCD_LOTJA      GTWNPMDEDMISVDPIEFHSEEEYKDRIDSYQKTTGLTEAVQTGTGHLNGIPVAIGIMDFEFMGGSMGSV
ACCD_GOSHI      GTWGPMDEDMISLDPIEFQSEEEYKDRIDFYQRKTGLTEAIQTGTGQLNGIPIAIGVMDFQFMGGSMGSV
ACCD_OLIPU      GTWNPMDEDMVSADPIKFHSKEEYKNRIDSAQKTTGLTDAVQTGTGQLNGIPVALGVMDFQFMGGSMGSV
ACCD_LEPVR      GTWNPMDEDMVSADPIKFHSREEYKNRIDSAQKTTGLTDAVQTGTGQLNGIPVALGVMDFKFLGGSMGSV
ACCD_CUSRE      GTWDPMDEDMVSRDPIKFDSGEAYKDRLYFYQRKTGLTEAVQTGIGQLNGIPVAIGVMDFKFMGGSMGSV
ACCD_PINTH      DTWRPMDEDMYTLDVLQFSEDESYKDHITFYQIETGLTDAIQTGIGQLNGLTIALGVMDFQFMGGSMGSV
ACCD_NASOF      GTWNPMDEDMVSADPIKFHKEEPYKNRIDSAQKTTGLTDAVQTGTGQLNGIPVALGVMDFQFMGGSMGSV
ACCD_ARAHI      GTWNPMDEDMVSTDPIKFHSGEEYKNRIDSAQKTTGLTDAVQTGIGQLNGIPTALGVMDFKFMGGSMGSV
ACCD_PHAAO      GTWEPMDEDMVSIDPIEFHEEEPYIDRISFYQTKTGLTEAVQTGVGQLNSIPIAIGVMDFQFMGGSMGSV
ACCD_GOSBA      GTWGPMDEDMISLDPIEFQSEEEYKDRIDFYQRKTGLTEAIQTGTGQLNGIPIAIGVMDFQFMGGSMRSV
ACCD_BARVE      GTWNPMDEDMVSADPIKFHSREEYKNRIDSAQKTTGLTDAVQTGTGQLNGIPVALGVMDFQFMGGSMGSV
ACCD_AETGR      GTWNPMDEDMVSTDPIQFHSREEYQNRIDSAQKKTGLTDAVQTGTGQLNGIPVALGVMDFQFMGGSMGSV
ACCD_BRANA      GSWNGMDEDMVSADPIKFHSREEYKKRIASAQKKTGLTDAIQTGTGQLNGIPVALGVMDFQFMGGSMGSV
ACCD_PINKO      DTWHPMDEDMYTLDVLQFHSENEYKDHISFYQIETGLTDAIQTGIGQLNGIPIALGVMDFKFMGGSMGSV
ACCD_CUCSA      GTWEPMDEDMVSVDPIEYKDSS-YKDRISSSQIETGLPEAIQTGTGKLNGIPVAIGVMEFEFMGGSMGSV
ACCD_CAPBU      GTWNPMDEDMVSADPIKFHSKEEYKNRIDSAQKTTGLTDAVQTGTGQLNGIPVALGVMDFRFMGGSMGSV
ACCD_ARATH      GTWNPMDEDMVSADPIKFHSKEEYKNRIDSAQKTTGLTDAVQTGTGQLNGIPVALGVMDFRFMGGSMGSV
ACCD_PICAB      GTRHPMDEDMYTLDVLQFHEDESYKDHITFCQIETGLTDAIQTGIGQLNGLPIALGVMDFKFMGGSMGSV
ACCD_CRUWA      GTWNPMDEDMVSADPIKFHSKEEYKNRIDSAQKTTGLTDAVQTGTGQLNGIPVALGVMDFQFMGGSMGSV
ACCD_OENEH      KTWAPMHEGLLSLDPIEFHSEKDYKDRVASYKRKTGLSEAIQTGRGYLKRIHLGIGLMDFQFMGGSMGSV
ACCD_NANDO      GTWXXXXXXXXXXXXIEFHSEEEYKDRIDSYQKKTGLTEAVQTGIGQLNGIPIAIGVMDFQFMGGSMGSV
ACCD_CICAR      GTWNPRDEDMVSLDPIEFSEDEPYKTRLDSYQKRTGLSEAVQTGTGQINGIPVAIGIMDFQFMGGSMGSV
ACCDA_SACEN     GSFERFGADVAPVDVLGFTDSRPYTERLAQAQRRSGSNEAVLCGTGTIDGAPLVVAAXXXXXXXXXXXXX
ACCD_PEA        ---------------------QSYIDRLDSYQEKTGLPEAVQTGTGQLNGIPLALAVMDSEFIAGSMGCV
ACCD_MYCTU      ----------------------------------------------------------EFDFLGGSIGVA
ACCD_MYCBO      ----------------------------------------------------------EFDFLGGSIGVA
ACCD_CUSGR      -----------------------YVERLAFYKKETGLLDAVQTGVGQLNGRPVALGVMDFRFLAGSMGCV
PCCB_BACSU      GGREKLAQQRTARERIIFQDSFIELHPFMESQVLTREQDGVVTGYGTIDGRSVYVFAQDFTVYGGALGET
PCCB_MOUSE      -------------DPGSFMESDMFVERCADFGMAADKNDSVVTGRGRINGRLVYVFSQDFTVFGGSLSGA
PCC5_MYCTU      --------------------------------------DGVVTGYGTIDGRDVCIFSQDATVFGGSLGEV
PCCB_RAT        -------------DPGSFLESDMFVERCADFGMAAEKNDSVVTGRGRINGRLVYVFSQDFTVFGGSLSGA
PCCB_MYCLE      --------------------------------------DGVVTGYGTIDGRDVCIFSQDVTVFGGSLGEV
PCCB_HUMAN      --------------------------------------DSVVTGRGRINGRLVYVFSQDFTVFGGSLSGA
PCCB_BOVIN      --------------------------------------DSVVTGRGRINGRLVYVFSQDFTVFGGSLSGA
PCCB_SACEN      ----------------------------------------------------------DFTVFGGSLGEV
PCCB_PIG        --------------------------------------DSVVTGRGRINGRLVYVFSQDFTVFGGSLSGA
PCCB_RHOER      ----------------------------------------VLAASGNIDGVRTIAYCSDATVMGGAMGVD
PCC6_MYCTU      ----------------------------------------VLAAAGTVNGVRTIAFCTDGTVMGGAMGVE
PCC6_MYCBO      ----------------------------------------VLAAAGTVNGVRTIAFCTDGTVMGGAMGVE
12S_PROFR       --------------------------------------DGVVTGRGTILGRPVHAASQDFTVMGGSAGET


                         +         .         .         .         .         *         .:210
query           AGEAIVKAFERAISERCPLVMFPASGGARMQEGILSLMQLPRTTVAVNMLKEAGMPYIVVLTNPTTGGVT
ACCD_METFK      VGERFVRGVQAAIDNNTPFICVSASGGARMQEGMFSLMQMAKTSAALTRLSKAGLPYISVLTDPTMGGVS
ACCD_METCA      VGERFVRGVNHSLEHGAPFVVFSASGGARMQESLLSLFQMAKTSAALGRLSKARIPFISVLTDPTMGGVS
ACCD_SHIBS      VGARFVRAVEQALEDNCPLICFSASGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVS
ACCD_YERE8      VGARFVRAVEQALEDNCPLVCFSSSGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVS
ACCD_YERPY      VGARFVRAVEQALEDNCPLVCFSSSGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVS
ACCD_YERPS      VGARFVRAVEQALEDNCPLVCFSSSGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVS
ACCD_YERPG      VGARFVRAVEQALEDNCPLVCFSSSGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVS
ACCD_YERPE      VGARFVRAVEQALEDNCPLVCFSSSGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVS
ACCD_YERPB      VGARFVRAVEQALEDNCPLVCFSSSGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVS
ACCD_YERPA      VGARFVRAVEQALEDNCPLVCFSSSGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVS
ACCD_YERP3      VGARFVRAVEQALEDNCPLVCFSSSGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVS
ACCD_YERPP      VGARFVRAVEQALEDNCPLVCFSSSGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVS
ACCD_YERPN      VGARFVRAVEQALEDNCPLVCFSSSGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVS
ACCD_PSEAE      VGERFVRAANVALEKRCPLICFSASGGARMQEALISLMQMAKTSAVLARLREEGIPFVSVLTDPVYGGVS
ACCD_PSEAB      VGERFVRAANVALEKRCPLICFSASGGARMQEALISLMQMAKTSAVLARLREEGIPFVSVLTDPVYGGVS
ACCD_MICAN      VGEKLCRLTEQATDESLPLVIICASGGARMQEGMLSLMQMAKISGALNRHREAKLLYIPVLTNPTTGGVT
ACCD_ECOL6      VGARFVRAVEQALEDNCPLICFSASGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVS
ACCD_SALTY      VGARFVRAVEQALEDNCPLVCFSASGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVS
ACCD_SALTI      VGARFVRAVEQALEDNCPLVCFSASGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVS
ACCD_SALSV      VGARFVRAVEQALEDNCPLVCFSASGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVS
ACCD_SALPK      VGARFVRAVEQALEDNCPLVCFSASGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVS
ACCD_SALPB      VGARFVRAVEQALEDNCPLVCFSASGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVS
ACCD_SALPA      VGARFVRAVEQALEDNCPLVCFSASGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVS
ACCD_SALNS      VGARFVRAVEQALEDNCPLVCFSASGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVS
ACCD_SALHS      VGARFVRAVEQALEDNCPLVCFSASGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVS
ACCD_SALG2      VGARFVRAVEQALEDNCPLVCFSASGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVS
ACCD_SALEP      VGARFVRAVEQALEDNCPLVCFSASGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVS
ACCD_SALDC      VGARFVRAVEQALEDNCPLVCFSASGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVS
ACCD_SALCH      VGARFVRAVEQALEDNCPLVCFSASGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVS
ACCD_SALA4      VGARFVRAVEQALEDNCPLVCFSASGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVS
ACCD_PSEA7      VGERFVRAANVALEQRCPLICFSASGGARMQEALISLMQMAKTSAVLARLREEGIPFVSVLTDPVYGGVS
ACCD_SALAR      VGARFVRAVEQALEDNCPLICFSASGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVS
ACCD_BURP8      VGERFARGAQNALEQNVPFICFTASGGARMQESLLSLMQMAKTTAMLTKLSEAKLPFISVLTDPTMGGVS
ACCD_XANAC      VGERFARAAEVALEVGCPFVCFSASGGARMQEGLFSLMQMAKTSAALGRLREAGLPYISVLTHPTTGGVS
ACCD_SHISS      VGARFVRAVEQALEDNCPLICFSASGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVS
ACCD_PHOLL      VGARFVRAVEQALADNCPLICFSSSGGARMQEALMSLMQMAKTSAALAKMQERGLPYISIMTDPTMGGVS
ACCD_HAEIN      VGAKFVKAAEKAMEMNCPFVCFSASGGARMQEALFSLMQMAKTSAVLAQMREKGVPFISVLTDPTLGGVS
ACCD_HAEIG      VGAKFVKAAEKAMEMNCPFVCFSASGGARMQEALFSLMQMAKTSAVLAQMREKGVPFISVLTDPTLGGVS
ACCD_HAEIE      VGAKFVKAAEKAMEMNCPFVCFSASGGARMQEALFSLMQMAKTSAVLAQMREKGVPFISVLADPTLGGVS
ACCD_HAEI8      VGAKFVKAAEKAMEMNCPFVCFSASGGARMQEALFSLMQMAKTSAVLAQMREKGVPFISVLTDPTLGGVS
ACCD_ECOL5      VGARFVRAVEQALEDNCPLICFSASGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVS
ACCD_CHRSD      VGEKFVRAATQAREEGVPLVCFAASGGARMQEALFSLMQMAKTSAALEKLKQEGVPYISVLTDPVFGGVS
ACCD_PROMH      VGARFVRAVEQALEDNCPLICFSASGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVMTDPTMGGVS
ACCD_ENTS8      VGARFVRAVEQALEDNCPLICFSASGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVS
ACCD_ECOUT      VGARFVRAVEQALEDNCPLICFSASGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVS
ACCD_ECOSM      VGARFVRAVEQALEDNCPLICFSASGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVS
ACCD_ECOLI      VGARFVRAVEQALEDNCPLICFSASGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVS
ACCD_ECOLC      VGARFVRAVEQALEDNCPLICFSASGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVS
ACCD_ECOK1      VGARFVRAVEQALEDNCPLICFSASGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVS
ACCD_ECOHS      VGARFVRAVEQALEDNCPLICFSASGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVS
ACCD_ECODH      VGARFVRAVEQALEDNCPLICFSASGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVS
ACCD_ECO57      VGARFVRAVEQALEDNCPLICFSASGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVS
ACCD_ECO24      VGARFVRAVEQALEDNCPLICFSASGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVS
ACCD_XANOR      VGERFARAAEVALEVGCPFVCFSASGGARMQEGLFSLMQMAKTSAALGRLREAGLPYISVLTHPTTGGVS
ACCD_XANOP      VGERFARAAEVALEVGCPFVCFSASGGARMQEGLFSLMQMAKTSAALGRLREAGLPYISVLTHPTTGGVS
ACCD_XANOM      VGERFARAAEVALEVGCPFVCFSASGGARMQEGLFSLMQMAKTSAALGRLREAGLPYISVLTHPTTGGVS
ACCD_SHIDS      VGARFVRAVEQALEDNCPLICFSASGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVS
ACCD_SHIB3      VGARFVRAVEQALEDNCPLICFSASGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVS
ACCD_XANC5      VGERFARAAEVALEVGCPFVCFSASGGARMQEGLFSLMQMAKTSAALGRLREAGLPYISVLTHPTTGGVS
ACCD_ACTSZ      VGAKFVQAAEEAIEKNCPFVCFSASGGARMQEALLSLMQMAKTSAVLAKMKEKGVPFISVLTDPTLGGVS
ACCD_STRM5      VGERFSLAAETAVEIGAPYVCFSQSGGARMQEGLFSLMQMAKTSAALGKLREAGLPFISVLTHPTTGGVS
ACCD_SERP5      VGARFVRAVEQALEDNCPLVCFSASGGARMQEALMSLMQMAKTSAALAKLQERGLPYISVLTDPTMGGVS
ACCD_PSEMY      VGERFVQAANVALEQRCPLVCFSASGGARMQEALISLMQMAKTSAALARLREEGLPFISVLTDPVYGGVS
ACCD_STRMK      VGERFALAAETAVEIGAPYVCFSQSGGARMQEGLFSLMQMAKTSAALGKLRETGLPYISVLTHPTTGGVS
ACCD_PSESM      VGERFVRAANYALENRCPMICFAASGGARMQEALISLMQMAKTSAVLARLREEGLPFISVLTDPVYGGVS
ACCD_MARAV      VGEKFVQAANVALEHRIPLVCFSASGGARMQEAILSLMQMAKTAAVLEKLKQEGIPYISVMTDPVFGGVS
ACCD_COXBN      VGERFAAGVEAAISERLPFVCFSTSGGARMQEGLFSLFQMAKTSAVLARLAEYKLPYISVLTDPTMGGVS
ACCD_THICR      MGEKFVRAVNEAIERRCPLIVFSASGGARMQEALFSLMQMAKTSAALGHLRANKLPFISVLTDPTMGGVS
ACCD_PSEU2      VGERFVRAANYALENRCPFVCFAASGGARMQEALISLMQMAKTSAVLARLREEGLPFISVLTDPVYGGVS
ACCD_PSEPF      VGERFVRAANYALENRCPMVCFSASGGARMQEALISLMQMAKTSAVLARLREEGIPFISVLTDPVYGGVS
ACCD_PSE14      VGERFVRAANYALENRCPMICFAASGGARMQEALISLMQMAKTSAVLARLREEGLPFISVLTDPVYGGVS
ACCD_COXBU      VGERFAAGVEAAISERLPFVCFSTSGGARMQEGLFSLFQMAKTSAVLARLAEYKLPYISVLTDPTMGGVS
ACCD_COXBR      VGERFAAGVEAAISERLPFVCFSTSGGARMQEGLFSLFQMAKTSAVLARLAEYKLPYISVLTDPTMGGVS
ACCD_SHIFL      VGARFVRAVEQAQEDNCPLICFSASGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVS
ACCD_PSEE4      VGERFVRAANYALENRCPMICFSASGGARMQEALISLMQMAKTSAVLARLREEGIPFISVLTDPVYGGVS
ACCD_ACAM1      VGEKLTRLIEHATQNRLPLVIVCASGGARMQEGMLSLMQMAKTSAALDQHRTNRLLYIPVLTHPTTGGVT
ACCD_PSEPG      VGERFVRAANYALEHRCPMVCFSASGGARMQEALISLMQMAKTSAVLARLREEGIPFISVLTDPVYGGVS
ACCD_ERWCT      VGARFVRAVEQALEDGCPLVCFSASGGARMQEALMSLMQMAKTSAALAKMRERGLPYISVLTDPTMGGVS
ACCD_ACTPJ      VGAKFVRAAERALADNIPFICFSASGGARMQEALFSLMQMAKTSAILAKMREKGIPFISVLTDPTLGGVS
ACCD_ACTP7      VGAKFVRAAERALADNIPFICFSASGGARMQEALFSLMQMAKTSAILAKMREKGVPFISVLTDPTLGGVS
ACCD_PSEPK      VGERFVRAANYALENRCPMVCFSASGGARMQEALISLMQMAKTSAVLARLREEGIPFISVLTDPVYGGVS
ACCD_PSEP1      VGERFVRAANYALENRCPMVCFSASGGARMQEALISLMQMAKTSAVLARLREEGIPFISVLTDPVYGGVS
ACCD_PSEF5      VGERFVRAANYALEKRCPMICFSASGGARMQEALISLMQMAKTSAVLARLREEGIPFISVLTDPVYGGVS
ACCD_HAEDU      VGAKFVRAAEKALAENIPFICFSASGGARMQEALFSLMQMAKTSAILAKMREKGGPFISVLTDPTLGGVS
ACCD_ACTP2      VGAKFVRAAERALADNIPFICFSASGGARMQEALFSLMQMAKTSAILAKMREKGIPFISILTDPTLGGVS
ACCD_PSEHT      VGARFVDAVDQCLEHNMPLICFSASGGARMQEALISLMQMAKTSAALAKMTEKGLPFISVMTDPTMGGVS
ACCD_SYNJA      VGEKITRLTERATRDHLPLVIFSASGGARMQEGILSLMQMAKTAAALQRHREAGQLFISVLTHPTYGGVT
ACCD_SHIF8      VGARFVRAVEQAQEDNCPLICFSASGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVS
ACCD_PSEA6      VGARFVKAVEACLEHNMPLICFSTSGGARMQEALLSLMQMAKTSAALAKMSEKGLPYISVMTDPTMGGVS
ACCD_MARMS      VGERFIQAVNVCLEKRIPLVCFSASGGARMQEALISLMQMAKTSAGLERLKQEGIPYISVMTDPVFGGVS
ACCD_DECAR      LGERFVRGVQAAVEQKMPFICITASGGARMQEGLFSLMQMXXXXXXXXXXXXXGLPFISILTDPTMGGVS
ACCD_AERHH      VGARFVRAVEESIKEGRGLVCFSTSGGARMQEALFSLMQMAKTSAALDRLSKAGLPYISVLTDPTMGGVS
ACCD_PSEPW      VGERFVRAANHALENRCPMICFSASGGARMQEALISLMQMAKTSAVLARLREEGIPFISVLTDPVYGGVS
ACCD_XANCP      VGERFARAAEVALEVGCPFVCFSASGGARMQEGLFSLMQMAKTSAALGRLREAGLPYISVLTHPTTGGVS
ACCD_XANC8      VGERFARAAEVALEVGCPFVCFSASGGARMQEGLFSLMQMAKTSAALGRLREAGLPYISVLTHPTTGGVS
ACCD_AERS4      VGARFVRAVEECIKEGRGLVCFSASGGARMQEALFSLMQMAKTSAALDRLTKAGLPYISVLTDPTMGGVS
ACCD_XANCB      VGERFARAAEVALEVGCPFVCFSASGGARMQEGLFSLMQMAKTSAALGRLREAGLPYISVLTHPTTGGVS
ACCD_PROMM      VGEKITRLVERATAQGLPLLIVCASGGARMQEGMLSLMQMAKISGALERHREAELLYMPLLTHPTTGGVT
ACCD_PROM3      VGEKITRLVERATAQGLPLLIVCASGGARMQEGMLSLMQMAKISGALERHREAELLYMPLLTHPTTGGVT
ACCD_CYAA5      VGEKLCRLIEYATQERLPVVIVCASGGARMQEGMLSLMQMAKISGALERHRNAKLLYIPVLTHPTTGGVT
ACCD_BLOPB      VGARFVHAVNQALKIKCPLVCFTASGGARMQEALMSLMQMARTSAALANLHERCLPYISVLTNPTMGGVS
ACCD_SYNS3      VGEKITRLVEVATAKKLPLLIVCASGGARMQEGMLSLMQMAKISGALERHREAGVLYMPLLTHPTTGGVT
ACCD_SYNPW      VGEKLTRLVEQATAKRLPLLIVCASGGARMQEGMLSLMQMAKISGALERHRQAGVLYMPLLTHPTTGGVT
ACCD_CELJU      VGERFTRAATVALNENIPLVCFSATGGARMQEALISLMQMAKTSAVIERLKMQGTPYVSVMTDPVYGGVS
ACCD_SYNY3      VGEKLCRLIEYATLERLPVVIICASGGARMQEGMLSLMQMAKISGALQNHREQKLLYIPVLTHPTTGGVT
ACCD_PSEU5      VGERFVRAANVALEKRCPLVCFSASGGARMQEALISLMQMAKTSAVLARMREEGLPFISVLTDPVYGGVS
ACCD_NOSP7      VGEKLTRMIEQATQRRYPVVIICTSGGARMQEGMLSLMQMAKISAALQRHKDARLLYIPVLTNPTTGGVT
ACCD_SYNP6      VGEKLTRLIEKGTEQRSPVIIVCASGGARMQEGMLSLMQMAKISGALERHREAGLLYLPILTHPTTGGVT
ACCD_SYNE7      VGEKLTRLIEKGTEQRSPVIIVCASGGARMQEGMLSLMQMAKISGALERHREAGLLYLPILTHPTTGGVT
ACCDA_NATTJ     VGEKVTRAIETGIDENLPVIMFTASGGARMQEGIYSLMQMAKTSAAISKLKDKGLPYIVVLTDPTTGGVT
ACCD_PROMA      VGEKITRLIEKATSKKLPLLIVCASGGARMQEGMLSLMQMAKISGALERHREANLLYMPLLTHPTTGGVT
ACCD_PORPU      VGEKLTRLLEKATQERLPAIILCASGGARMQEGMLSLMQMAKISSALEMHKKENLLYLSVLTSPTTGGVT
ACCD_SYNR3      VGEKITRLIETATEQQLPVLVVCASGGARMQEGMLSLMQMAKISGALERHRSRKLLYIPLLTHPTTGGVT
ACCDA_CLOTE     VGEKITRSIEKSIENRLPLVIFTASGGARMQEGMFSLMQMAKISAALSKLSQAGLLYITVLTDPTTGGVT
ACCD_SYNJB      VGEKIARLTERATCDHLPLILFSASGGARMQEGILSLMQMAKTSAALQRHRDARQLFISVLTHPTYGGVT
ACCD_GEOBB      XXEKITRGIERALSDRTPCIIVSASGGARMQESILSLMQMAKTSAALAKLREAGLPFVSILTDPTTGGVT
ACCD_SODGM      VGARFVRAVEQALADDCPLVCFSASGGARMQEALMSLMQMAKTSXXXXXXXXXXXPYISVLTDPTMGGVS
ACCD_PROM1      VGEKITRLIEHSTKEKLPLLIVCASGGARMQEGMLSLMQMAKISGALERHRDAQLLYMPLLTHPTTGGVT
ACCD2_VIBPA     VGARFVDAVDTAIEENCGLVCFSACGGARMQESLMALMQMAKTSAALERLSNARLPYISVLTDQTFGGVS
ACCD_SYNPX      VGEKITRLVEEATARRLPLLIVCASGGARMQEGMLSLMQMAKISGALERHREAELLYMPLLTHPTTGGVT
ACCD_ENT38      XXARFIRAVEQALEDNCPLICFSASGGARMQEALMSLMQMAKTSAALGKMQERGLPYISVLTDPTMGGVS
ACCD_PROMT      VGEKITRLIEHSTKEKLPLLIVCASGGARMQEGMLSLMQMAKISGALERHRDAQLLYMPLLTHPTTGGVT
ACCD_PORYE      VGEKLTRLLEKATQEKLPAIILCASGGARMQEGMLSLMQMAKISSALEMHKKENLLYISVLTSPTTGGVT
ACCD_COLP3      VGARFVKGVEYCLEHNLPFICFSASGGARMQEALFSLMQMAKTSAALAKMSEKGLPYVSVLTDPTMGGVS
ACCD1_VIBPA     XXARFVKAVEAAIENNCALVCFSASGGARMQEALMSLMQMAKTSAALERLSEKGLPFISVLTDPTMGGVS
ACCD_PASMU      XXAKFVQAAEKAIAENCPFVCFSASGGARMQEALFSLMQMAKTSAVLAKMREQGVPFISVLTDPTLGGVS
ACCD_GLOVI      VGERITRLVERATAERRAAILVCASGGARMQEGVLSLVQMARTSAALQNHRSDRQLFVSVLTNPTTGGVT
ACCD_MANSM      XXAKFVAAAEEAMEKNCPFVCFSASGGARMQEALFSLMQMAKTSAVLAKMKEKGVPFISVLTDPTLGGVS
ACCD_VIBCH      XXARFVRAVEAAIEHNCGLICFSASGGARMQEALMSLMQMAKTSAALERLSDKGLPFISVMTDPTMGGVS
ACCD_SYNSC      VGEKITRLIEDSTARKLPLLIVCASGGARMQEGMLSLMQMAKISGALERHREAELLYMPLLTHPTTGGVT
ACCD_ALHEH      XXXRFVRAADTAREQRVPLVCFSASGGARMQEGLFSLMQMAKTSAALARLSEEGVPFVSVLTDPTMGGVS
ACCD_CITK8      XXARFVRAVEQALEDNCPLICFSASGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVS
ACCD_CHLVU      VGEKITRLIEYATQEGLPVILVCASGGARMQEGILSLMQMAKISAALHIHQNAKLLYISVLTSPTTGGVT
ACCD1_VIBHB     XXARFVKAVEAAIENNCALVCFSASGGARMQEALMSLMQMAKTSAALERLSDKGLPFISVLTDPTMGGVS
ACCD_CLOBK      VGEKITRAIERAIKLRLPVIIFTASGGARMQEGILSLMQMAKVSSALAKLDEEGLLYICVLTDPTTGGVT
ACCD_CLOAB      VGEKITRAIEEATERKLPVIIFTTSGGARMQEGMFSLMQMAKTSAALAKHNEAGLLYVSVLTDPTTGGVT
ACCD_VIBC3      XXARFVRAVEAAMEHNCGLICFSASGGARMQEALMSLMQMAKTSAALERLSDKGLPFISVMTDPTMGGVS
ACCD_IDILO      VGAKFVLAAEVCLKHRIPLVCFSASGGARMQEALMSLMQMAKTSAALARMSEEGLPFISILTDPTMGGVS
ACCD_BAUCH      VGTRFVYAVEQALLDKCPFVCFSASGGARMQEALMSLMQMAKTSAALAKLRAQCLPYISVLTDPTMGGVS
ACCD_ANAVT      VGEKITRLIEQATQRRYPVVIICTSGGARMQEGMLSLMQMAKISAALERHRDARLLYIPVLTNPTTGGVT
ACCD_ANASP      VGEKITRLIEQATQRRYPVVIICTSGGARMQEGMLSLMQMAKISAALERHRDARLLYIPVLTNPTTGGVT
ACCD_ERWT9      XXARFVRAVEQALADNCPMMCFSASGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVS
ACCD_VIBVY      XXARFVRAVEAAMENNCALVCFSASGGARMQEALMSLMQMAKTSAALERLSAKGLPFISVMTDPTMGGVS
ACCD_VIBVU      XXARFVRAVEAAMENNCALVCFSASGGARMQEALMSLMQMAKTSAALERLSAKGLPFISVMTDPTMGGVS
ACCD_PELPD      XXEKITRAIERGVQKRQPVIIVSASGGARMQESILSLMQMAKTSAALAKLKDAGLPFISILTDPTTGGVT
ACCD_KLEP7      XXARFVRAVEQALEDNCPLICFSASGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVS
ACCD_HAHCH      VGEKFVRAVNVCLEENRALICFSASGGARMQEALISLMQMAKTAAALEVMKQRGLPYISVMTDPVFGGVS
ACCD2_VIBHB     VGAKFVEAVDIAIEENRGLVCFSACGGARMQESLMALMQMAKTSAALDHLSRVGLPYISVLTDQTFGGVS
ACCD_PROM5      VGEKITRIIEKATIENYPIVIVCASGGARMQEGMLSLMQMAKISGALKKHRAKNLLYMPLLTHPTTGGVT
ACCD_PHOPR      XXAKFVRAVNEALESNCALVCFSASGGARMQEALMSLMQMAKTSAALQRLSAKGLPFISVLTDPTMGGVS
ACCD_SYNP2      XXEKICRLVEHGTAEGLPVVVVCASGGARMQEGMLSLMQMAKISGALERHRTKKLLYIPVLTNPTTGGVT
ACCD_PROM0      VGEKITRIIERATLENFPILIVCASGGARMQEGMLSLMQMAKISGALKKHKEKNLLYMPLLTHPTTGGVT
ACCD_CUPTR      VGERFVRGAQAALEQKVPFICFTATGGARMQESLLSLLQMAKTTAMLNQLSASKLPFISVLTDPTMGGVS
ACCD_PROM4      VGEKITRLIEKATNQKLPLLIVCASGGARMQEGMLSLMQMAKISGALERHREAELLYMPLLTHPTTGGVT
ACCD_HAES2      XXXKFVQAAEKAIELHCPLVCFSASGGARMQEALFSLMQMAKTSAVLAKMKEKGVPFISVLTDPTLGGVS
ACCD_HAES1      XXXKFVQAAEKAIELHCPLVCFSASGGARMQEALFSLMQMAKTSAVLAKMKEKGVPFISVLTDPTLGGVS
ACCD_VIBF1      XXARFVKAVDAAIENNCPLVCFSASGGARMQEALMSLMQMAKTSAALARLSRKGLPFFSVLTDPTMGGVS
ACCD_VIBFM      XXARFVKAVDAAIENNCPLVCFSASGGARMQEALMSLMQMAKTSAALARLSRKGLPFFSVLTDPTMGGVS
ACCD_PROM2      VGEKITRIIERATKKNYPILIVCASGGARMQEGMLSLMQMAKISGALKKHKEKNLLYMPLLTHPTTGGVT
ACCD_ALCBS      XXXRFVRAVNVCLEQKLPLVCFAASGGARMQEALFSLMQMAKTSAALEKMRQAGLPFISVLTDPVYGGVS
ACCD_WIGBR      VGERFVFGVNESIKCNCPMVCFSASGGARVQEALISLMQMAKTSAALSKLRKKKIPYISVMTDPSMGGVS
ACCD_CLOD6      VGEKITYSIEYAAENNLPIIICSASGGARMQEGMVSLMQMAKTSQALSKLEEKSLPYISVLTDPTTGGVT
ACCD_BURM1      XXXRFARGAQNALEQHVPFICFTASGGARMQESLLSLMQMAKTTAMLTKLSEAKLPFISVLTDPTMGGVS
ACCD_BURCJ      XXXRFARGAQNALEQHVPFICFTASGGARMQESLLSLMQMAKTTAMLTKLAEAKLPFISVLTDPTMGGVS
ACCD_BURCA      XXXRFARGAQNALEQHVPFICFTASGGARMQESLLSLMQMAKTTAMLTKLAEAKLPFISVLTDPTMGGVS
ACCD_SYNS9      VGEKITRLVEECTKRKLPLLIVCASGGARMQEGMLSLMQMAKISGALERHREAEXXXXXXXXXXXXGGVT
ACCD_TRIEI      XXEKLTRLIEKATQESLPVIIICASGGARMQEGLLSLMQMAKISGALEQHREAKQLYIPILTHPTTGGVT
ACCD_PROM9      VGEKITRIIERATIENYPILIVCASGGARMQEGMLSLMQMAKISGALKKHKEKNLLYMPLLTHPTTGGVT
ACCD_PROMP      VGEKITRIVETATIKNYPILIVCASGGARMQEGMLSLMQMAKISGALKKHRAKNLLYMPLLTHPTTGGVT
ACCD_ALTMD      VGARFVAAVNACLENDMPLICFSASGGARMQEALMSLMQMAKTSAALAKMSKKGLPYISVLTDPTMGGVS
ACCD_BLOFL      VGSRFVQAVNQSLKLKCPFVCFSSSGGARMQEAFVSLMQMAKTSAALAVLYDRCLPYISVLTNPTMGGVS
ACCD_PROMS      VGEKITRIIERATLENFPILIVCASGGARMQEGMLSLMQMAKISGALKKHKEKNLLYMPLLTHPTTGGVT
ACCD_CLOB8      VGEKITRLIEHATENKLPLMIFTASGGARMQEGIFSLMQMAKISAALAKHSEAGLLYISILTDPTTGGVT
ACCD_ANTFO      VGEKITRLIEYGTRESMPVIIVCSSGGARMQEGTLSLMQMAKISAVLQIHQQKKLLYIAILTYPTTGGVT
ACCDA_SALTO     VGELITQAAERALADRVPLVVVTASGGARMQEGVLSLMQMATVSQAVAALRESGVPSVSVLTDPTYGGVA
ACCD_CLOBB      VGEKITRIVEYATENNLPILIFTASGGARMQEGIFSLMQMAKISAALARHDEKGLLYITILTDPTTGGVT
ACCD_CLOBA      VGEKITRIVEYATENNLPILIFTASGGARMQEGIFSLMQMAKISAALARHDEKGLLYITILTDPTTGGVT
ACCD_MARPO      VGEKITRLIEYATRASMPLIIVCSSGGARMQEGTLSLMQMAKISSVLQIHQQKRLLYIAILTYPTTGGVT
ACCD_HALHL      VGERFCXXXXXXXXNDIPLVCFSASGGARMQEALFSLMQMAKTSAAISRLNEARVPYISVLTDPTMGGVS
ACCD_CLOP1      VGEKITRAIEYATKNRLPLIIFTCSGGARMQEGIYSLMQMAKVSGAIYRHGRENLLYITVLTNPTTGGVT
ACCD_CLOPS      VGEKITRAIEYATKNRLPLIIFTCSGGARMQEGIYSLMQMAKVSGAIYRHGRENLLYITVLTNPTTGGVT
ACCD_CLONN      VGEKITRAVEKATEERLPIIIFTTSGGARMQESMFSLMQMAKTSAAIARHNEAGLLYIPVLTDPTTGGVI
ACCD_ADICA      VGEKITRLIEYATQRLLPLVLICASGGARMQEGTLSLMQMAKISSVLQLYQQNKLLYISVLTYPTTGGVT
ACCD_HELSJ      VGEKLTRLIEYATKQGLFLLIVSASGGARMQEGIYSLMQMAKISAALNVYQEANLLYISLCTSPTTGGVT
ACCD_PHYPA      VGEKITRLIEYAFKESLPLIIVCSSGGARMQEGTLSLMQMAKITSLLQFYQRKKLFYIAILTYPTTGGVT
ACCD_SOLTU      VGEKITRLIEHAANQNLPLIIVCASGGARMQEGSLSLMQMAKISSALDYQLNKKLFYVSILTSPTTGGVT
ACCD_SOLBU      VGEKITRLIEHAANQNLPLIIVCASGGARMQEGSLSLMQMAKISSALDYQLNKKLFYVSILTSPTTGGVT
ACCD_PARUW      XXERLTRLIEHALKEKLPLIIVSTSGGARMQESILSLMQMAKTSGALAKLHEARIPYISVLTNPTTGGVT
ACCD_SOLLC      VGEKITRLIEHAANQNLPLMIVCASGGARMQEGSLSLMQMAKISSALDYQLNKKLFYVSILTSPTTGGVT
ACCD_NICTO      VGEKITRLIERAANQILPLIIVCASGGARMQEGSLSLMQMAKISSALDYQLNKKLFYVSILTSPTTGGVT
ACCD_FAGEA      VGEKITRLAEYATNQNLPLIIVCASGGARMQEGSLSLMQMAKISSALDYQSNKKLFYVSILTSPTTGGVT
ACCD_ATRBE      VGEKITRLIEHAANQILPLIIVCASGGARMQEGSLSLMQMAKISSALDYQLNKKLFYVSILTSPTTGGVT
ACCD_TOBAC      VGEKITRLIEYAANQILPLIIVCASGGARMQEGSLSLMQMAKISSALDYQLNKKLFYVSILTSPTTGGVT
ACCD_NICSY      VGEKITRLIEYAANQILPLIIVCASGGARMQEGSLSLMQMAKISSALDYQLNKKLFYVSILTSPTTGGVT
ACCDA_FRAAA     VGEVFTRGAELALRERTPLLTVTASGGARMQEGAIALMQMAKTSQALGQLDEAGILTVSLITDPTFGGVA
ACCD_COFAR      VGEKITRLIEYATKELLPLIIVCASGGARMQEGSLSLMQMAKISSALDYQSNKKLFYVSILTSPTTGGVT
ACCD_PIPCE      VGEKITRLIEYATNRSLPVIMVCASGGARMQEGSLSLMQMAKSSVSYDYQSNQKLFYVSILTSPTTGGVT
ACCD_HELAN      VGEKITRLIEYATKEFLPLIIVCASGGARMQEGSLSLMQMAKISSALDYQSNKKLFYVPILTSPTTGGVT
ACCD_GUIAB      VGEKITRLIEYATKEFLPLIIVCASGGARMQEGSLSLMQMAKISSALDYQSNKKLFYVPILTSPTTGGVT
ACCD_EUCGG      VGEKITRLIEYATNQFLPLILVCASGGARMQEGSLSLMQMAKISAALDYQSHKKLFYVSILTSPTTGGVT
ACCD_DAUCA      VGEKITRLIEYATNQLLPLIIVCASGGARMQEGSLSLMQMAKISSALDYQSNKKLFYVPILTSPTTGGVT
ACCD_BUXMI      VGEKITRLIEYATNRSLPVIIVCASGGARMQEGSLSLMQMAKSSASYNYQSNKKLFYVSILTSPTTGGVT
ACCD_RANMC      VGEKITRLIEYATNGFLPLIIVCASGGARMQEGSLSLMQMAKSSASYDYQSNKKLFYVSILTSPTTGGVT
ACCD_PANGI      VGEKITRLIEYATKKFLPLIIVCASGGARMQEGSLSLMQMAKISSALDYQSNKKLFYVPILTSPTTGGVT
ACCD_LEMMI      VGEKITRLIEYATNKSLPVIIVCASGGARMQEGSLSLMQMAKISSALNYQLNKKLFYVAILTSPTTGGVT
ACCD_ANGLY      XXEKITRLIEYATQESLPLIIVCASGGARMQEGTLSSMQMAKSSVSQIHQVQKKLLYIAVLTYPTTGGVT
ACCD_LACSA      VGEKITRLIEYATKEFLPLIIVCASGGARMQEGSVSLMQMAKISSALDYQSNKKLFYVPILTSPTTGGVT
ACCD_MORIN      VGEKITRLIEYATNQSLPLILVCASGGARMQEGSLSLMQMAKISSALDYQSNKKLFYIAILTSPTTGGVT
ACCD_CERDE      VGEKITRLIEYATNRSLPVIIVCASGGARMQEGSLSLMQMAKISSALNYQLNKKLFYVSILTSPTTGGVT
ACCD_CARPA      VGEKITRLIEYATNEFLPLIIVCASGGARMQEGSLSLMQMAKISSALDYQSNKKLFYVSILTSPTTGGVT
ACCD_LOBMA      VGEKITRLIEYATNQRLPLILVCSSGGARMQEGSLSLMQMAKSSVLCDYQSSKKLFYISILTSPTTGGVT
ACCD_NYMAL      VGEKITRLIEYATDRSLPVIMVCASGGARMQEGSLSLMQMAKISSALNYQSNKKLFYVSILTSPTTGGVT
ACCD_DIOEL      VGEKITRLIEYATNESLPVIIVCASGGARMQEGSLSLMQMAKSSASYNYQSNKKLFYVSILTSPTTGGVT
ACCD_CITSI      VGEKITRLIEYAANKFLPLLLVCASGGARMQEGSLSLMQMAKISSALDYQSNKKLFYVSILTSPTTGGVT
ACCD_SOYBN      VGEKITRLVEYATNQLLPLILVCASGGARMQEGSLSLIQMAKISSALDYQKNKKLFYVSILTSPTTGGVT
ACCD_VITVI      VGEKITRLIEYATNEFLPLILVCSSGGARMQEGSLSLMQMAKISSALDYQSNKKLFYVSILTSPTTGGVT
ACCD_SPIOL      VGEKITRLIEYASNKFIPLIIVCASGGARMQEGSLSLMQMAKSSVLYDYQSNKKLFYVSILTSPTTGGVT
ACCD_AETCO      VGEKITRLIEYATTEFLPLILVCSSGGARMQEGSLSLMQMAKSSVLCDYQSSKKLFYISILTSPTTGGVT
ACCD_DRIGR      VGEKITRLIEYATNGSLPIIMVCASGGARMQEGSLSLMQMAKSSASYNYQSNKKLFYVSILTSPTTGGVT
ACCD_NUPAD      VGEKITRLIEYATDRSLPVIMVCASGGARMQEGSLSLMQMAKISSALNYQSNKKLFYVSILTSPTTGGVT
ACCD_ILLOL      VGEKITRLIECATNRSLPVIIVCASGGARMQEGSLSLMQMAKISSALNYQSNKKLFYVSILTSPTTGGVT
ACCD_CHLSC      VGEKITRLIEYATNESIPVIMVCASGGARMQEGSLSLMQMAKSSASYNYQLNKKLFYVSILTSPTTGGVT
ACCD_IPOPU      VGEKITRLIEHATNNFLPLIIVCASGGARMQEGSLSLMQMAKISSALYEYQNKRLFYVSILTSPTTGGVT
ACCD_CALFG      VGEKITRLIEYATNRSLPVIMVCASGGARMQEGSLSLMQMAKSSASYDYQLNKKLFYVSILTSPTTGGVT
ACCD_POPTR      VGEKITRLIEYATNQFLPLILVCASGGARMQEGSLSLMQMAKISSALDYQSNKKLVYVSILTSPTTGGVT
ACCD_POPAL      VGEKITRLIEYATNQFLPLILVCASGGARMQEGSLSLMQMAKISSALDYQSNKKLVYVSILTSPTTGGVT
ACCD_PLAOC      VGEKITRLIEYATNGSLPLIIVCASGGARMQEGSLSLMQMAKSSASYDYQSNKKLFYVSILTSPTTGGVT
ACCD_EPIVI      VGEKITRLIEYATNKILPLIIVCASGGARMQEGSLSLMQMAKISSALDYQSNKKLLYVSILTSPTTGGVT
ACCD_LIRTU      VGEKITRLIEYATNRSLPVIMVCASGGARMQEGSLSLMQMAKISSALDYQSNKKLFYVSILTSPTTGGVT
ACCD_DRANE      VGEKITRLIEYATNQCLPLILVCSSGGARMQEGSLSLMQMAKSSVLCDYQSSKKLFYISILTSPTTGGVT
ACCD_AMBTC      VGEKITRLIEYAIDRSLPVVIVCASGGARMQEGGLSLMQMAKSSASYNYQSNKKLFYVSILTSPTTGGVT
ACCD_LOTJA      VGEKITRLVEYATNQLLPLIVVCASGGARMQEGSLSLMQMAKISSALDYQLNKKLFYVSILTSPTTGGVT
ACCD_GOSHI      VGEKITRLIEYATNNFLPLILVCASGGARMQEGSLSLMQMAKISSALDYQSNKKLFYVSILTSPTTGGVT
ACCD_OLIPU      VGEKITRLIEYATNQRLPLILVCSSGGARMQEGSLSLMQMAKSSVLCDYQSSKKLFYISILTSPTTGGVT
ACCD_LEPVR      VGEKITRLIEYATNQRLPLILVCSSGGARMQEGSLSLMQMAKSSVLCDYQSSKKLFYISILTSPTTGGVT
ACCD_CUSRE      VGEKITRLIEHATNKFLPLIIVSASGGARMQEGSLSLMQMAKISSALDYQSNKRLVYVSILTSPTAGGVT
ACCD_PINTH      VGEKITRLIERATAESLPLIMVCASGGARMQEGSFSLMQMAKIASALYIQKEKKLLYISILTSPTTGGVT
ACCD_NASOF      VGEKITRLIEYATNQCLPLILVCSSGGARMQEGSLSLMQMAKSSVLCDYQSSKKLFYISILTSPTTGGVT
ACCD_ARAHI      VGEKITRLIEYATNQCLPLILVCSSGGARMQEGSLSLMQMAKSSVLCNYQSSKKLFYISILTSPTTGGVT
ACCD_PHAAO      VGEKITRLIEYATNRSLPVIIVCASGGARMQEGALSLMQMAKSSASYDYQSNKKLFFVSILTSPTTGGVT
ACCD_GOSBA      VGEKITRLIEYATNNFLPLILVCASGGARMQEGSLSLMQMAKISSALDYQSNKKLFYVSILTSPTTGGVT
ACCD_BARVE      VGEKITRLIEYATNQCLPLILVCSSGGARMQEGSLSLMQMAKSSVLCDYQSSQKLFYISILTSPTTGGVT
ACCD_AETGR      VGEKITRLIEYATTEFLPLILVCSSGGARMQEGSLSLMQMAKSSVLCDYQSSKKLFYISILTSPTTGGVT
ACCD_BRANA      VGDKITRLIEYATNQCLPLILVCSSGGARMQEGSLSLMQMAKSSVLCDYQSSKKLFYISILTSPTTGGVT
ACCD_PINKO      VGEKITRLIERATAESLPVIMVCASGGARMQEGSFSLMQMAKIASALYIQKDKKLLYISILTSPTTGGVT
ACCD_CUCSA      VGEKITRLIDYASNQFLPLILVCASGGARMQEGSLSLMQMAKISSALYDYKYQSLFYVAILTSPTTGGVT
ACCD_CAPBU      VGEKITRLVEYATNQCLPLILVCSSGGARMQEGSLSLMQMAKSSVLCDYQSSKKLFYISILTSPTTGGVT
ACCD_ARATH      VGEKITRLIEYATNQCLPLILVCSSGGARMQEGSLSLMQMAKSSVLCDYQSSKKLFYISILTSPTTGGVT
ACCD_PICAB      VGEKITRLIERATEESLPVIMVCASGGARMQEGSFSSMQMAKIASALYIQKDNRLLYVSILTSPTTGGVT
ACCD_CRUWA      VGEKITRLIEYATNQCLPLILVCSSGGARMQEGSLSLMQMAKSSVLCDYQSSKKLFYISILTSPTTGGVT
ACCD_OENEH      VGERITRLVEYATNRVLPLILVCASGGARMQEGSLSLMQMAKISSALSDYQNRTVFYVALLTSPTTGGVT
ACCD_NANDO      VGEKITRLIEYATNRSLPVIIVCASGGARMQEGSLSLMQMAKSSASYNYQSNKKLLYVSILTSPTTGGVT
ACCD_CICAR      VGEKITRLIEYATNQLLPLIIVCASGGARMQEGSLSLMQMAKISSALNYQINQKLFYVAILTSPTTGGVT
ACCDA_SACEN     XXXXXXXXXXXXXXXXXPLVLVCASGGARMQEGTISLMQMAKTSQEVARLHEAGVLVVSIGTDPTYGGVT
ACCD_PEA        VGEKITRLIEYATNLLLPLIIVCASGGARMQEGSLSLMQMAKISSALNYQINQKLFYVAILTSPTTGGVT
ACCD_MYCTU      AAERITAAVERATAERLPLLASPSSGGTRMQEGTVAFLQMVKIAAAIQLHNQARLPYLVYLRHPTTGGVF
ACCD_MYCBO      AAERITAAVERATAERLPLLASPSSGGTRMQEGTVAFLQMVKIAAAIQLHNQARLPYLVYLRHPTTGGVF
ACCD_CUSGR      VGEKITRLIEYATNNLLPLIILSASGGARVHEGSLSLMQMAKISAALDYQSNKRLFYISILTSPTTGGVT
PCCB_BACSU      HARKICALMDLAAKNKAPIIGLNDSGGARIQEGVLSLDGYGHIFYR-NVLYSGVIPQISVILGPCAGGAV
PCCB_MOUSE      HAQKICKIMDQAITVGAPVIGLNDSGGARIQEGVESLAGYADIFLR-NVTASGVIPQISLIMGPCAGGAV
PCC5_MYCTU      YGEKIVKVQELAIKTGRPLIGINDGAGARIQEGVVSLGLYSR-IFRNNILASGVIPQISLIMGAAAGGHV
PCCB_RAT        HAQKICKIMDQAITVGAPVIGLNDSGGARIQEGVESLAGYADIFLR-NVTASGVIPQISLIMGPCAGGAV
PCCB_MYCLE      YGEKIVKVQELAIKTGRPLIGINDGAGARIQEGVVSLGLYSR-IFRNNILASGVIPQISLIMGAAAGGHV
PCCB_HUMAN      HAQKICKIMDQAITVGAPVIGLNDSGGARIQEGVESLAGYADIFLR-NVTASGVIPQISLIMGPCAGGAV
PCCB_BOVIN      HAQKICKIMDQALTVGAPVIGLNDSGGARIQEGVESLAGYADIFLR-NVTASGVIPQISLIMGPCAGGAV
PCCB_SACEN      FGEKIVKVMDLAMKTGCPLVGINDSGGARIQEGVAAL-GLYAEIFKRNTHASGVIPQISLIMGPCAGGAV
PCCB_PIG        HAQKICKIMDQAMTVGAPVIGLNDSGGARIQEGVESLAGYADIFLR-NVSASGVIPQISLIMGPCAGGAV
PCCB_RHOER      GCKHLVKAIDTAIEEESPIVGLWHSGGARLAEGVEALHAVGLVFEA--MVRASGLIPQISVVLXXXXXXX
PCC6_MYCTU      GCTHIVNAYDTAIEDQSPIVGIWHSGGARLAEGVRALHAVGQVFEA--MIRASGYIPQISXXXXXXXXXX
PCC6_MYCBO      GCTHIVNAYDTAIEDQSPIVGIWHSGGARLAEGVRALHAVGQVFEA--MIRASGYIPQISXXXXXXXXXX
12S_PROFR       QSTKVVETMEQALLTGTPFLFFYDSGGARIQEGIDSL---------------------------------


                         .         .         .         +         .         .         .:280
query           ASYAMLGDVHIAEPGAEICFAGKRVIEQTIREKLPEGFQTSEYLLEHGMVDMVIDRREIPDTLASMLKIM
ACCD_METFK      ASFAMLGDVIIAEPQALIGFAGPRVIEQTVRETLPEGFQRSEFLLEHGAIDMIVDRREMRDKLATLMTSF
ACCD_METCA      ASFAMLGDINIAEPGALIGFAGPRVIEQTVREKLPEGFQRSEFLLEHGAVDMIVDRRDLRERIAALLALM
ACCD_SHIBS      ASFAMLGDLNIAEPKALIGFAGPRVIEQTVREKLPLGFQRSEFLIEKGAIDMIVRRPEMRLKLASILAKL
ACCD_YERE8      ASLAMLGDINIAEPKALIGFAGPRVIEQTVREKLPPGFQRSEFLIEKGAIDMIVRRPVMRQTLASILSKL
ACCD_YERPY      ASLAMLGDINIAEPKALIGFAGPRVIEQTVREKLPPGFQRSEFLIEKGAIDMIVRRPVMRQTLASILSKL
ACCD_YERPS      ASLAMLGDINIAEPKALIGFAGPRVIEQTVREKLPPGFQRSEFLIEKGAIDMIVRRPVMRQTLASILSKL
ACCD_YERPG      ASLAMLGDINIAEPKALIGFAGPRVIEQTVREKLPPGFQRSEFLIEKGAIDMIVRRPVMRQTLASILSKL
ACCD_YERPE      ASLAMLGDINIAEPKALIGFAGPRVIEQTVREKLPPGFQRSEFLIEKGAIDMIVRRPVMRQTLASILSKL
ACCD_YERPB      ASLAMLGDINIAEPKALIGFAGPRVIEQTVREKLPPGFQRSEFLIEKGAIDMIVRRPVMRQTLASILSKL
ACCD_YERPA      ASLAMLGDINIAEPKALIGFAGPRVIEQTVREKLPPGFQRSEFLIEKGAIDMIVRRPVMRQTLASILSKL
ACCD_YERP3      ASLAMLGDINIAEPKALIGFAGPRVIEQTVREKLPPGFQRSEFLIEKGAIDMIVRRPVMRQTLASILSKL
ACCD_YERPP      ASLAMLGDINIAEPKALIGFAGPRVIEQTVREKLPPGFQRSEFLIEKGAIDMIVRRPVMRQTLASILSKL
ACCD_YERPN      ASLAMLGDINIAEPKALIGFAGPRVIEQTVREKLPPGFQRSEFLIEKGAIDIIVRRPVMRQTLASILSKL
ACCD_PSEAE      ASLAMLGDVIVGEPKALIGFAGPRVIEQTVREKLPEGFQRSEFLLEHGAIDMIVHRAELRPRLANLLSAF
ACCD_PSEAB      ASLAMLGDVIVGEPKALIGFAGPRVIEQTVREKLPEGFQRSEFLLEHGAIDMIVHRAELRPRLANLLSAF
ACCD_MICAN      ASFAMLGDIIIAEPKATIGFAGKRVIEQTLREKLPEGFQTSEYLLKHGFVDAIVPRTHLKKTLAQLISL-
ACCD_ECOL6      ASFAMLGDLNIAEPKALIGFAGPRVIEQTVREKLPPGFQRSEFLIEKGAIDMIVRRPEMRLKLASILAKL
ACCD_SALTY      ASFAMLGDLNIAEPKALIGFAGPRVIEQTVREKLPPGFQRSEFLIEKGAIDMIVRRPEMRLKLASILAKL
ACCD_SALTI      ASFAMLGDLNIAEPKALIGFAGPRVIEQTVREKLPPGFQRSEFLIEKGAIDMIVRRPEMRLKLASILAKL
ACCD_SALSV      ASFAMLGDLNIAEPKALIGFAGPRVIEQTVREKLPPGFQRSEFLIEKGAIDMIVRRPEMRLKLASILAKL
ACCD_SALPK      ASFAMLGDLNIAEPKALIGFAGPRVIEQTVREKLPPGFQRSEFLIEKGAIDMIVRRPEMRLKLASILAKL
ACCD_SALPB      ASFAMLGDLNIAEPKALIGFAGPRVIEQTVREKLPPGFQRSEFLIEKGAIDMIVRRPEMRLKLASILAKL
ACCD_SALPA      ASFAMLGDLNIAEPKALIGFAGPRVIEQTVREKLPPGFQRSEFLIEKGAIDMIVRRPEMRLKLASILAKL
ACCD_SALNS      ASFAMLGDLNIAEPKALIGFAGPRVIEQTVREKLPPGFQRSEFLIEKGAIDMIVRRPEMRLKLASILAKL
ACCD_SALHS      ASFAMLGDLNIAEPKALIGFAGPRVIEQTVREKLPPGFQRSEFLIEKGAIDMIVRRPEMRLKLASILAKL
ACCD_SALG2      ASFAMLGDLNIAEPKALIGFAGPRVIEQTVREKLPPGFQRSEFLIEKGAIDMIVRRPEMRLKLASILAKL
ACCD_SALEP      ASFAMLGDLNIAEPKALIGFAGPRVIEQTVREKLPPGFQRSEFLIEKGAIDMIVRRPEMRLKLASILAKL
ACCD_SALDC      ASFAMLGDLNIAEPKALIGFAGPRVIEQTVREKLPPGFQRSEFLIEKGAIDMIVRRPEMRLKLASILAKL
ACCD_SALCH      ASFAMLGDLNIAEPKALIGFAGPRVIEQTVREKLPPGFQRSEFLIEKGAIDMIVRRPEMRLKLASILAKL
ACCD_SALA4      ASFAMLGDLNIAEPKALIGFAGPRVIEQTVREKLPPGFQRSEFLIEKGAIDMIVRRPEMRLKLASILAKL
ACCD_PSEA7      ASLAMLGDVIVGEPKALIGFAGPRVIEQTVREKLPEGFQRSEFLLEHGAIDMIVHRGELRPRLARLLSAF
ACCD_SALAR      ASFAMLGDLNIAEPKALIGFAGPRVIEQTVREKLPPGFQRSEFLIEKGAIDMIVRRPEMRLKLASILAKL
ACCD_BURP8      ASFAFLGDVVIAEPKALIGFAGPRVIEQTVREKLPEGFQRAEFLLQKGAIDMIVDRRKLREELAQLMALL
ACCD_XANAC      ASFAMLGDINIAEPHALIGFAGPRVIEQTVRETLPEGFQRSEFLLDHGTIDQICDRRQMRDRIAELTAMM
ACCD_SHISS      ASFAMLGDLNIAEPKALIGFAGPRVIEQTVREKLPPGFQRSEFLIEKGAIDMIVHRPEMRLKLASILAKL
ACCD_PHOLL      ASLAMLGDINIAEPKALIGFAGPRVIEQTVREKLPSGFQRSEFLLAKGAIDMIVRRPEMRDTLASLLSKL
ACCD_HAEIN      ASFAMLGDLNIAEPKALIGFAGPRVIEQTVREKLPEGFQRSEFLLEKGAIDMIVKRSEMRQTLASVLSKL
ACCD_HAEIG      ASFAMLGDLNIAEPKALIGFAGPRVIEQTVREKLPEGFQRSEFLLEKGAIDMIVKRSEMRQTLASVLSKL
ACCD_HAEIE      ASFAMLGDLNIAEPKALIGFAGPRVIEQTVREKLPEGFQRSEFLLEKGAIDMIVKRSEMRQTLASVLSKL
ACCD_HAEI8      ASFAMLGDLNIAEPKALIGFAGPRVIEQTVREKLPEGFQRSEFLLEKGAIDMIVKRSEMRQTLASVLSKL
ACCD_ECOL5      ASFAMLGDLNIAEPKALIGFAGPRVIEQTVREKLPPGFQRSEFLIEKGAIDMIIRRPEMRLKLASILAKL
ACCD_CHRSD      ASLAMLGDINVAEPNALIGFAGPRVIEQTVREQLPEGFQRSEFLLEHGTVDMIVHRHDMRERLGSVMRKL
ACCD_PROMH      ASLAMLGDINVAEPKALIGFAGPRVIEQTVREKLPAGFQRSEFLLEKGAIDMIVRRPEMRDELAELLAKL
ACCD_ENTS8      ASFAMLGDLNIAEPKALIGFAGPRVIEQTVREKLPAGFQRSEFLIEKGAIDMIVRRPE