[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for atum0:AAK85915.1

[Show Plain Result]


## Summary of Sequence Search
    1::107
    1::107     7e-57 100%  107 aa  Y095_AGRT5 RecName: Full=UPF0133 protein Atu0095;
    1::107     4e-38  70%  107 aa  Y231_RHIME RecName: Full=UPF0133 protein R00231;
    1::107     1e-31  55%  107 aa  Y275_METSB RecName: Full=UPF0133 protein Msil_0275;
    1::107     3e-31  59%  107 aa  Y5504_RHILO RecName: Full=UPF0133 protein mlr5504;
    1::107     6e-29  54%  107 aa  Y260_GRABC RecName: Full=UPF0133 protein GbCGDNIH1_0260;
    1::107     2e-28  55%  107 aa  Y033_BRUMB RecName: Full=UPF0133 protein BMEA_A0033;
    1::107     4e-27  48%  107 aa  Y3472_RHORT RecName: Full=UPF0133 protein Rru_A3472;
    6::108     7e-27  51%  108 aa  Y1439_BORBR RecName: Full=UPF0133 protein BB1439;
    6::108     7e-27  51%  108 aa  Y1222_BORPA RecName: Full=UPF0133 protein BPP1222;
    1::94      2e-26  55%  106 aa  Y7345_BRASB RecName: Full=UPF0133 protein BBta_7345;
    6::108     2e-26  48%  108 aa  Y2329_JANMA RecName: Full=UPF0133 protein mma_2329;
    6::108     2e-26  51%  108 aa  Y915_BORA1 RecName: Full=UPF0133 protein BAV0915;
    6::108     5e-26  50%  108 aa  Y1975_LEPCP RecName: Full=UPF0133 protein Lcho_1975;
    6::108     6e-26  50%  108 aa  Y1550_BORPE RecName: Full=UPF0133 protein BP1550;
    8::107     1e-25  50%  107 aa  Y231_HALHL RecName: Full=UPF0133 protein Hhal_0231;
    1::94      4e-25  55%  106 aa  Y620_RHOPT RecName: Full=UPF0133 protein Rpal_0620;
    1::107     4e-25  46%  107 aa  Y3467_GLUDA RecName: Full=UPF0133 protein GDI3467/Gdia_2910;
    8::108     4e-25  51%  108 aa  Y1984_AZOVD RecName: Full=UPF0133 protein Avin_19840;
    1::107     9e-25  49%  107 aa  Y603_GLUOX RecName: Full=UPF0133 protein GOX0603;
    4::106     1e-24  50%  106 aa  Y858_STRM5 RecName: Full=UPF0133 protein Smal_0858;
    1::100     1e-24  48%  105 aa  Y7544_OLICO RecName: Full=UPF0133 protein OCAR_7544;
    1::94      1e-24  54%  106 aa  Y616_RHOPA RecName: Full=UPF0133 protein RPA0616;
    1::107     1e-24  50%  107 aa  Y290_BRUA1 RecName: Full=UPF0133 protein BAbS19_I00290;
    1::107     1e-24  50%  107 aa  Y1909_BRUME RecName: Full=UPF0133 protein BMEI1909;
    4::106     1e-24  50%  106 aa  Y1015_STRMK RecName: Full=UPF0133 protein Smlt1015;
    1::107     1e-24  50%  107 aa  Y035_BRUSI RecName: Full=UPF0133 protein BSUIS_A0035;
    1::107     1e-24  50%  107 aa  Y034_BRUC2 RecName: Full=UPF0133 protein BCAN_A0034;
    1::107     1e-24  50%  107 aa  Y033_BRUSU RecName: Full=UPF0133 protein BR0033;
    1::107     1e-24  50%  107 aa  Y033_BRUO2 RecName: Full=UPF0133 protein BOV_0033;
    1::107     1e-24  50%  107 aa  Y033_BRUAB RecName: Full=UPF0133 protein BruAb1_0033;
    1::107     1e-24  50%  107 aa  Y030_BRUA2 RecName: Full=UPF0133 protein BAB1_0030;
    1::107     2e-24  47%  107 aa  Y1999_ACICJ RecName: Full=UPF0133 protein Acry_1999;
    1::103     2e-24  47%  104 aa  Y1981_DICT6 RecName: Full=UPF0133 protein DICTH_1981;
    1::94      3e-24  51%  106 aa  Y764_BRASO RecName: Full=UPF0133 protein BRADO0764;
    6::108     3e-24  48%  108 aa  Y3552_BORPD RecName: Full=UPF0133 protein Bpet3552;
    1::103     3e-24  46%  104 aa  Y258_DICTD RecName: Full=UPF0133 protein Dtur_0258;
    4::106     4e-24  48%  106 aa  Y3358_XANCB RecName: Full=UPF0133 protein xcc-b100_3358;
    4::106     4e-24  48%  106 aa  Y3243_XANC8 RecName: Full=UPF0133 protein XC_3243;
    9::108     4e-24  50%  108 aa  Y2533_MARMS RecName: Full=UPF0133 protein Mmwyl1_2533;
   26::107     4e-24  60%  108 aa  Y231_BARHE RecName: Full=UPF0133 protein BH02310;
    4::106     4e-24  48%  106 aa  Y1002_XANCP RecName: Full=UPF0133 protein XCC1002;
   17::107     6e-24  53%  107 aa  Y257_BART1 RecName: Full=UPF0133 protein BT_0257;
    4::106     1e-23  47%  106 aa  Y1128_XANC5 RecName: Full=UPF0133 protein XCV1128;
    4::106     1e-23  47%  106 aa  Y1110_XANAC RecName: Full=UPF0133 protein XAC1110;
    4::106     1e-23  47%  106 aa  Y965_XANOM RecName: Full=UPF0133 protein XOO0965;
   10::109     1e-23  49%  109 aa  Y3086_VIBHB RecName: Full=UPF0133 protein VIBHAR_03086;
    5::107     1e-23  46%  107 aa  Y1808_XYLFA RecName: Full=UPF0133 protein XF_1808;
    4::106     1e-23  47%  106 aa  Y1065_XANOR RecName: Full=UPF0133 protein XOO1065;
    1::94      2e-23  52%  106 aa  Y368_NITWN RecName: Full=UPF0133 protein Nwi_0368;
    6::107     2e-23  48%  107 aa  Y639_AZOSE RecName: Full=UPF0133 protein AZOSEA06390;
   10::109     2e-23  49%  109 aa  Y2178_VIBPA RecName: Full=UPF0133 protein VP2178;
    5::107     2e-23  46%  107 aa  Y1216_XYLFM RecName: Full=UPF0133 protein Xfasm12_1216;
    5::107     2e-23  46%  107 aa  Y1122_XYLF2 RecName: Full=UPF0133 protein XfasM23_1122;
    4::106     2e-23  46%  106 aa  Y1058_XYLFT RecName: Full=UPF0133 protein PD_1058;
   10::109     2e-23  49%  109 aa  Y1055_VIBCH RecName: Full=UPF0133 protein VC_1055;
   10::109     3e-23  49%  109 aa  Y2410_VIBVY RecName: Full=UPF0133 protein VV2410;
   10::109     3e-23  49%  109 aa  Y2004_VIBVU RecName: Full=UPF0133 protein VV1_2004;
    1::107     4e-23  47%  107 aa  Y022_OCHA4 RecName: Full=UPF0133 protein Oant_0022;
    9::108     5e-23  45%  108 aa  Y2614_HAHCH RecName: Full=UPF0133 protein HCH_02614;
    1::107     5e-23  49%  108 aa  Y219_BARQU RecName: Full=UPF0133 protein BQ02190;
   28::107     5e-23  59%  108 aa  Y1239_BARBK RecName: Full=UPF0133 protein BARBAKC583_1239;
    1::94      1e-22  51%  106 aa  Y463_NITHX RecName: Full=UPF0133 protein Nham_0463;
    1::107     1e-22  45%  107 aa  Y436_MARMM RecName: Full=UPF0133 protein Mmar10_0436;
    1::100     2e-22  42%  101 aa  Y255_BEII9 RecName: Full=UPF0133 protein Bind_0255;
    1::90      4e-22  50%  106 aa  YUD3_BRAJA RecName: Full=UPF0133 protein bll8115;
    1::90      4e-22  51%  105 aa  Y4812_RHOP5 RecName: Full=UPF0133 protein RPE_4812;
    8::105     7e-22  45%  106 aa  Y2594_NITOC RecName: Full=UPF0133 protein Noc_2594;
    1::94      9e-22  49%  105 aa  Y4847_RHOPB RecName: Full=UPF0133 protein RPC_4847;
    9::108     1e-21  45%  108 aa  Y1202_PSEHT RecName: Full=UPF0133 protein PSHAa1202;
    8::107     2e-21  45%  107 aa  Y591_NITEC RecName: Full=UPF0133 protein Neut_0591;
    7::112     4e-21  44%  112 aa  Y1611_CHRVO RecName: Full=UPF0133 protein CV_1611;
   20::109     5e-21  51%  109 aa  Y917_VIBSL RecName: Full=UPF0133 protein VS_0917;
    6::108     5e-21  43%  108 aa  Y2533_METPP RecName: Full=UPF0133 protein Mpe_A2533;
   10::109     6e-21  48%  109 aa  Y2014_SHEON RecName: Full=UPF0133 protein SO_2014;
   26::111     8e-21  53%  111 aa  Y1905_PSEF5 RecName: Full=UPF0133 protein PFL_1905;
    9::107     1e-20  42%  109 aa  Y1098_ALTMD RecName: Full=UPF0133 protein MADE_01098;
   17::109     1e-20  49%  111 aa  Y3498_GLOVI RecName: Full=UPF0133 protein glr3498;
   28::109     3e-20  55%  109 aa  Y308_HAES2 RecName: Full=UPF0133 protein HSM_0308;
   10::109     3e-20  46%  109 aa  Y2276_PSYIN RecName: Full=UPF0133 protein Ping_2276;
   26::107     3e-20  54%  107 aa  Y1509_ALHEH RecName: Full=UPF0133 protein Mlg_1509;
   28::109     3e-20  55%  109 aa  Y1309_HAES1 RecName: Full=UPF0133 protein HS_1309;
   31::109     4e-20  56%  109 aa  Y780_HAEIE RecName: Full=UPF0133 protein CGSHiEE_00780;
   31::109     4e-20  56%  109 aa  Y5435_HAEIG RecName: Full=UPF0133 protein CGSHiGG_05435;
   31::109     4e-20  56%  109 aa  Y442_HAEIN RecName: Full=UPF0133 protein HI0442;
   27::110     4e-20  54%  110 aa  Y2380_SHEDO RecName: Full=UPF0133 protein Sden_2380;
   28::109     4e-20  54%  109 aa  Y075_ACTPJ RecName: Full=UPF0133 protein APJL_0075;
   28::109     4e-20  54%  109 aa  Y075_ACTP7 RecName: Full=UPF0133 protein APP7_0075;
   28::109     4e-20  54%  109 aa  Y075_ACTP2 RecName: Full=UPF0133 protein APL_0075;
   26::109     7e-20  52%  109 aa  Y3840_PHOLL RecName: Full=UPF0133 protein plu3840;
    8::107     9e-20  40%  107 aa  Y1920_ACIF2 RecName: Full=UPF0133 protein AFE_1920;
    8::107     9e-20  40%  107 aa  Y1592_ACIF5 RecName: Full=UPF0133 protein Lferr_1592;
   27::111     1e-19  51%  111 aa  Y3586_PSEPW RecName: Full=UPF0133 protein PputW619_3586;
    6::96      1e-19  44%  108 aa  Y1046_HERAR RecName: Full=UPF0133 protein HEAR1046;
   27::111     1e-19  51%  111 aa  Y4268_PSEPK RecName: Full=UPF0133 protein PP_4268;
   27::111     1e-19  51%  111 aa  Y3833_PSEPG RecName: Full=UPF0133 protein PputGB1_3833;
    5::96      1e-19  43%  108 aa  Y1796_BURM1 RecName: Full=UPF0133 protein Bmul_1447/BMULJ_01796;
   27::111     1e-19  51%  111 aa  Y1600_PSEP1 RecName: Full=UPF0133 protein Pput_1600;
   28::109     1e-19  52%  109 aa  Y1040_HAEPS RecName: Full=UPF0133 protein HAPS_1040;
   27::108     2e-19  50%  108 aa  Y2646_PSEMY RecName: Full=UPF0133 protein Pmen_2646;
    6::98      2e-19  46%  115 aa  Y1036_RALPJ RecName: Full=UPF0133 protein Rpic_1036;
   26::107     3e-19  51%  107 aa  Y701_POLSQ RecName: Full=UPF0133 protein Pnuc_0701;
   26::107     3e-19  51%  107 aa  Y645_POLNS RecName: Full=UPF0133 protein Pnec_0645;
   27::112     3e-19  51%  112 aa  Y4577_PSEFS RecName: Full=UPF0133 protein PFLU4577;
   27::108     3e-19  50%  108 aa  Y3645_PSESM RecName: Full=UPF0133 protein PSPTO_3645;
   27::110     3e-19  52%  110 aa  Y2406_SHEFN RecName: Full=UPF0133 protein Sfri_2406;
   27::108     3e-19  50%  108 aa  Y1826_PSEU2 RecName: Full=UPF0133 protein Psyr_1826;
   27::108     3e-19  50%  108 aa  Y1786_PSE14 RecName: Full=UPF0133 protein PSPPH_1786;
   28::110     4e-19  48%  110 aa  Y3092_YERE8 RecName: Full=UPF0133 protein YE3092;
   10::109     4e-19  43%  109 aa  Y205_PASMU RecName: Full=UPF0133 protein PM0205;
   28::110     6e-19  49%  110 aa  Y993_YERPS RecName: Full=UPF0133 protein YPTB0993;
   28::110     6e-19  49%  110 aa  Y967_YERPN RecName: Full=UPF0133 protein YPN_0967;
   28::109     6e-19  52%  109 aa  Y326_HAEDU RecName: Full=UPF0133 protein HD_0326;
   28::110     6e-19  49%  110 aa  Y3197_YERPY RecName: Full=UPF0133 protein YPK_3197;
   28::110     6e-19  49%  110 aa  Y3121_YERPE RecName: Full=UPF0133 protein YPO3121/y1061/YP_0808;
   28::110     6e-19  49%  110 aa  Y3058_YERP3 RecName: Full=UPF0133 protein YpsIP31758_3058;
   28::110     6e-19  49%  110 aa  Y2890_YERPG RecName: Full=UPF0133 protein YpAngola_A2890;
   28::110     6e-19  49%  110 aa  Y2758_YERPP RecName: Full=UPF0133 protein YPDSF_2758;
   28::110     6e-19  49%  110 aa  Y2615_YERPA RecName: Full=UPF0133 protein YPA_2615;
   11::111     6e-19  40%  111 aa  Y1810_VIBFM RecName: Full=UPF0133 protein VFMJ11_1810;
   11::111     6e-19  40%  111 aa  Y1686_VIBF1 RecName: Full=UPF0133 protein VF_1686;
   28::110     6e-19  49%  110 aa  Y1036_YERPB RecName: Full=UPF0133 protein YPTS_1036;
    2::99      7e-19  41%  106 aa  Y1429_DESPS RecName: Full=UPF0133 protein DP1429;
   28::109     1e-18  49%  109 aa  Y1109_EDWI9 RecName: Full=UPF0133 protein NT01EI_1109;
    1::94      1e-18  46%  106 aa  Y086_RHOPS RecName: Full=UPF0133 protein RPD_0086;
   27::111     2e-18  48%  111 aa  Y1789_PSEE4 RecName: Full=UPF0133 protein PSEEN1789;
    6::107     3e-18  42%  107 aa  Y807_DECAR RecName: Full=UPF0133 protein Daro_0807;
   27::108     4e-18  49%  108 aa  Y4462_PSEAB RecName: Full=UPF0133 protein PA14_44620;
   27::108     4e-18  49%  108 aa  Y3795_PSEA8 RecName: Full=UPF0133 protein PLES_37951;
   27::108     4e-18  49%  108 aa  Y1533_PSEAE RecName: Full=UPF0133 protein PA1533;
   11::111     4e-18  39%  111 aa  Y1086_ALISL RecName: Full=UPF0133 protein VSAL_I1086;
   28::109     5e-18  51%  109 aa  Y2301_SHEPC RecName: Full=UPF0133 protein Sputcn32_2301;
   28::109     5e-18  51%  109 aa  Y1770_SHEB2 RecName: Full=UPF0133 protein Sbal223_1770;
   28::109     5e-18  51%  109 aa  Y1707_SHESW RecName: Full=UPF0133 protein Sputw3181_1707;
   32::107     6e-18  51%  107 aa  Y1365_RICFE RecName: Full=UPF0133 protein RF_1365;
    9::106     1e-17  46%  111 aa  Y1657_NEIMA RecName: Full=UPF0133 protein NMA1657;
   27::115     1e-17  51%  115 aa  Y1192_RALSO RecName: Full=UPF0133 protein RSc1192;
    4::102     1e-17  43%  102 aa  YGG0_WIGBR RecName: Full=UPF0133 protein WIGBR5260;
   32::107     2e-17  50%  107 aa  Y7555_RICPU RecName: Full=UPF0133 protein RPR_07555;
   25::108     2e-17  45%  108 aa  Y3743_COLP3 RecName: Full=UPF0133 protein CPS_3743;
   32::107     2e-17  50%  107 aa  Y1337_RICCN RecName: Full=UPF0133 protein RC1337;
   32::107     2e-17  50%  107 aa  Y1224_RICAE RecName: Full=UPF0133 protein RAF_ORF1224;
   20::109     3e-17  46%  109 aa  Y997_ACTSZ RecName: Full=UPF0133 protein Asuc_0997;
   32::107     3e-17  49%  107 aa  Y866_RICPR RecName: Full=UPF0133 protein RP866;
    9::106     3e-17  46%  111 aa  Y1444_NEIMB RecName: Full=UPF0133 protein NMB1444;
    9::106     3e-17  46%  111 aa  Y1380_NEIMF RecName: Full=UPF0133 protein NMC1380;
    9::106     4e-17  45%  111 aa  Y1355_NEIM0 RecName: Full=UPF0133 protein NMCC_1355;
   15::105     5e-17  41%  109 aa  Y1967_ACIBY RecName: Full=UPF0133 protein ABAYE1967;
   15::105     5e-17  41%  109 aa  Y1914_ACIBS RecName: Full=UPF0133 protein ABSDF1914;
   15::105     5e-17  41%  109 aa  Y1909_ACIB5 RecName: Full=UPF0133 protein AB57_1909;
   15::105     5e-17  41%  109 aa  Y1813_ACIB3 RecName: Full=UPF0133 protein ABBFA_001813;
   15::105     5e-17  41%  109 aa  Y1718_ACIBC RecName: Full=UPF0133 protein ACICU_01718;
   15::105     5e-17  41%  109 aa  Y1684_ACIBT RecName: Full=UPF0133 protein A1S_1684;
    2::106     7e-17  43%  109 aa  Y799_PSYCK RecName: Full=UPF0133 protein Pcryo_0799;
   32::107     7e-17  49%  107 aa  Y7310_RICRS RecName: Full=UPF0133 protein A1G_07310;
   15::113     7e-17  39%  115 aa  Y5067_ANASP RecName: Full=UPF0133 protein alr5067;
   30::108     7e-17  46%  108 aa  Y1848_IDILO RecName: Full=UPF0133 protein IL1848;
   32::107     7e-17  49%  107 aa  Y1562_RICRO RecName: Full=UPF0133 protein RrIowa_1562;
   19::96      2e-16  46%  100 aa  Y558_CHLSY RecName: Full=UPF0133 protein Chy400_0558;
   19::96      2e-16  46%  100 aa  Y522_CHLAA RecName: Full=UPF0133 protein Caur_0522;
    9::92      2e-16  44%  105 aa  Y1912_CORU7 RecName: Full=UPF0133 protein cu1912;
    9::106     2e-16  45%  111 aa  Y742_NEIG1 RecName: Full=UPF0133 protein NGO0742;
   14::112     2e-16  37%  115 aa  Y723_THEEB RecName: Full=UPF0133 protein tlr0723;
    9::106     2e-16  45%  111 aa  Y1136_NEIG2 RecName: Full=UPF0133 protein NGK_1136;
   15::113     3e-16  39%  115 aa  Y2322_ANAVT RecName: Full=UPF0133 protein Ava_2322;
    5::107     3e-16  40%  107 aa  Y1327_METCA RecName: Full=UPF0133 protein MCA1327;
   11::98      3e-16  40%  100 aa  Y2292_ROSCS RecName: Full=UPF0133 protein Rcas_2292;
   11::98      3e-16  41%  100 aa  Y1534_ROSS1 RecName: Full=UPF0133 protein RoseRS_1534;
   15::113     8e-16  37%  115 aa  Y448_NOSP7 RecName: Full=UPF0133 protein Npun_F0448;
    2::99      8e-16  36%  103 aa  Y3694_ANASK RecName: Full=UPF0133 protein AnaeK_3694;
    2::99      8e-16  37%  103 aa  Y3636_ANADE RecName: Full=UPF0133 protein Adeh_3636;
    2::106     1e-15  41%  109 aa  Y793_PSYA2 RecName: Full=UPF0133 protein Psyc_0793;
    2::99      1e-15  36%  103 aa  Y3777_ANAD2 RecName: Full=UPF0133 protein A2cp1_3777;
   24::107     1e-15  43%  107 aa  Y2305_RHOCS RecName: Full=UPF0133 protein RC1_2305;
   32::107     2e-15  45%  107 aa  Y5550_RICCK RecName: Full=UPF0133 protein A1E_05550;
    1::94      2e-15  40%  106 aa  Y667_RHOP2 RecName: Full=UPF0133 protein RPB_0667;
   30::107     5e-15  46%  107 aa  Y4104_MAGSA RecName: Full=UPF0133 protein amb4104;
   18::111     5e-15  36%  114 aa  Y3826_CLOK5 RecName: Full=UPF0133 protein CKL_3826;
   19::96      5e-15  42%  100 aa  Y3200_CHLAD RecName: Full=UPF0133 protein Cagg_3200;
   13::111     7e-15  39%  113 aa  Y464_SYNE7 RecName: Full=UPF0133 protein Synpcc7942_0464;
   18::108     7e-15  36%  113 aa  Y329_EUBR3 RecName: Full=UPF0133 protein EUBREC_0329;
   28::109     7e-15  44%  109 aa  Y2087_AERS4 RecName: Full=UPF0133 protein ASA_2087;
   14::110     7e-15  38%  113 aa  Y1143_ANATD RecName: Full=UPF0133 protein Athe_1143;
   13::111     7e-15  39%  113 aa  Y1054_SYNP6 RecName: Full=UPF0133 protein syc1054_d;
   25::108     7e-15  39%  109 aa  Y019_BACCN RecName: Full=UPF0133 protein Bcer98_0019;
   25::108     1e-14  39%  109 aa  Y5293_BACC2 RecName: Full=UPF0133 protein BCG9842_B5293;
    2::104     1e-14  35%  104 aa  Y1113_GEMAT RecName: Full=UPF0133 protein GAU_1113;
   25::108     1e-14  39%  109 aa  Y025_BACCR RecName: Full=UPF0133 protein BC_0025;
   25::108     1e-14  39%  109 aa  Y025_BACC4 RecName: Full=UPF0133 protein BCB4264_A0025;
   14::112     1e-14  38%  114 aa  Y899_CYAP4 RecName: Full=UPF0133 protein Cyan7425_0899;
   26::109     1e-14  44%  109 aa  Y2234_SHELP RecName: Full=UPF0133 protein Shew_2234;
   25::99      1e-14  41%  104 aa  Y2011_CORJK RecName: Full=UPF0133 protein jk2011;
   20::113     2e-14  34%  116 aa  Y017_CLOD6 RecName: Full=UPF0133 protein CD0017;
   27::96      2e-14  49%  108 aa  Y952_BURP8 RecName: Full=UPF0133 protein Bphy_0952;
   27::96      2e-14  49%  108 aa  Y2072_BURXL RecName: Full=UPF0133 protein Bxeno_A2072;
   27::96      2e-14  49%  108 aa  Y1827_BURPP RecName: Full=UPF0133 protein Bphyt_1827;
    3::100     2e-14  35%  111 aa  Y1171_CHLPD RecName: Full=UPF0133 protein Cpha266_1171;
   28::109     3e-14  43%  109 aa  Y1177_ERWCT RecName: Full=UPF0133 protein ECA1177;
   27::96      4e-14  47%  108 aa  Y6253_BURCA RecName: Full=UPF0133 protein Bcen_6253;
   27::96      4e-14  47%  108 aa  Y5127_BURS3 RecName: Full=UPF0133 protein Bcep18194_A5127;
   20::94      4e-14  55%   96 aa  Y199_DEIRA RecName: Full=UPF0133 protein DR_0199;
   27::96      4e-14  47%  108 aa  Y1861_BURCJ RecName: Full=UPF0133 protein BceJ2315_18610;
   27::96      4e-14  47%  108 aa  Y1850_BURCC RecName: Full=UPF0133 protein Bcenmc03_1850;
   27::96      4e-14  47%  108 aa  Y1826_BURCH RecName: Full=UPF0133 protein Bcen2424_1826;
   28::109     4e-14  43%  109 aa  Y1077_PECCP RecName: Full=UPF0133 protein PC1_1077;
   27::96      6e-14  47%  108 aa  Y3650_BURMS RecName: Full=UPF0133 protein BMASAVP1_A1850;
   27::96      6e-14  47%  108 aa  Y3622_BURM7 RecName: Full=UPF0133 protein BMA10247_1122;
   26::109     6e-14  43%  109 aa  Y2851_SHESH RecName: Full=UPF0133 protein Ssed_2851;
   27::96      6e-14  47%  108 aa  Y2372_BURP1 RecName: Full=UPF0133 protein BURPS1710b_2372;
   27::96      6e-14  47%  108 aa  Y2346_BURM9 RecName: Full=UPF0133 protein BMA10229_A0046;
   27::96      6e-14  47%  108 aa  Y2243_BURP0 RecName: Full=UPF0133 protein BURPS1106A_2243;
   27::96      6e-14  47%  108 aa  Y2220_BURTA RecName: Full=UPF0133 protein BTH_I2220;
   27::96      6e-14  47%  108 aa  Y2205_BURP6 RecName: Full=UPF0133 protein BURPS668_2205;
   26::109     6e-14  43%  109 aa  Y1794_SHEWM RecName: Full=UPF0133 protein Swoo_1794;
   27::96      6e-14  47%  108 aa  Y1764_BURCM RecName: Full=UPF0133 protein Bamb_1764;
   27::96      6e-14  47%  108 aa  Y1753_BURVG RecName: Full=UPF0133 protein Bcep1808_1753;
   27::96      6e-14  47%  108 aa  Y1737_BURA4 RecName: Full=UPF0133 protein BamMC406_1737;
   27::96      6e-14  47%  108 aa  Y1499_BURPS RecName: Full=UPF0133 protein BPSL1499;
   27::96      6e-14  47%  108 aa  Y1360_BURMA RecName: Full=UPF0133 protein BMA1360;
    8::107     7e-14  35%  107 aa  Y434_NITEU RecName: Full=UPF0133 protein NE0434;
   27::110     7e-14  43%  110 aa  Y4227_KLEP3 RecName: Full=UPF0133 protein KPK_4227;
   24::107     7e-14  48%  107 aa  Y371_HYPNA RecName: Full=UPF0133 protein HNE_0371;
   25::103     7e-14  43%  107 aa  Y369_PHEZH RecName: Full=UPF0133 protein PHZ_c0369;
   35::102     7e-14  50%  112 aa  Y3038_LEGPC RecName: Full=UPF0133 protein LPC_3038;
   35::102     7e-14  50%  112 aa  Y2803_LEGPA RecName: Full=UPF0133 protein lpp2803;
   35::102     7e-14  50%  112 aa  Y2755_LEGPH RecName: Full=UPF0133 protein lpg2755;
   35::102     7e-14  50%  112 aa  Y2672_LEGPL RecName: Full=UPF0133 protein lpl2672;
   27::98      7e-14  45%  110 aa  Y1934_CUPTR RecName: Full=UPF0133 protein RALTA_A1934;
   28::108     9e-14  41%  109 aa  Y482_BUCAI RecName: Full=UPF0133 protein BU482;
   28::108     9e-14  41%  109 aa  Y476_BUCAT RecName: Full=UPF0133 protein BUAPTUC7_476;
   28::108     9e-14  41%  109 aa  Y475_BUCA5 RecName: Full=UPF0133 protein BUAP5A_475;
   28::110     9e-14  37%  110 aa  Y2216_TOLAT RecName: Full=UPF0133 protein Tola_2216;
   20::99      1e-13  42%  100 aa  Y143_CORK4 RecName: Full=UPF0133 protein ckrop_0143;
   25::108     1e-13  38%  109 aa  Y019_BACWK RecName: Full=UPF0133 protein BcerKBAB4_0019;
   26::109     2e-13  42%  109 aa  YBAB_SALPK RecName: Full=UPF0133 protein ybaB;
   26::109     2e-13  42%  109 aa  YBAB_SALPA RecName: Full=UPF0133 protein ybaB;
    9::100     2e-13  37%  109 aa  Y1285_PELLD RecName: Full=UPF0133 protein Plut_1285;
   18::102     2e-13  35%  104 aa  Y028_MOOTA RecName: Full=UPF0133 protein Moth_0028;
   10::101     2e-13  37%  115 aa  Y4332_LEPIN RecName: Full=UPF0133 protein LA_4332;
   10::101     2e-13  37%  115 aa  Y3475_LEPIC RecName: Full=UPF0133 protein LIC_13475;
   21::103     2e-13  37%  105 aa  Y1710_EXISA RecName: Full=UPF0133 protein EAT1b_1710;
   26::109     2e-13  43%  109 aa  Y1591_SHEHH RecName: Full=UPF0133 protein Shal_1591;
   26::109     2e-13  43%  109 aa  Y1509_SHEPA RecName: Full=UPF0133 protein Spea_1509;
    3::100     4e-13  34%  111 aa  Y1190_CHLCH RecName: Full=UPF0133 protein Cag_1190;
   26::109     5e-13  42%  109 aa  Y1717_SHEPW RecName: Full=UPF0133 protein swp_1717;
    8::96      8e-13  41%  115 aa  Y3002_LEPBJ RecName: Full=UPF0133 protein LBJ_3002;
    8::96      8e-13  41%  115 aa  Y065_LEPBL RecName: Full=UPF0133 protein LBL_0065;
   30::111     1e-12  37%  114 aa  Y4780_ALKMQ RecName: Full=UPF0133 protein Amet_4780;
   28::109     1e-12  41%  109 aa  Y2678_CITK8 RecName: Full=UPF0133 protein CKO_02678;
    3::100     1e-12  34%  109 aa  Y1034_PROVI RecName: Full=UPF0133 protein Cvib_1034;
   32::107     1e-12  41%  107 aa  Y048_RICBR RecName: Full=UPF0133 protein RBE_0048;
   35::105     1e-12  42%  108 aa  Y020_GEOSW RecName: Full=UPF0133 protein GWCH70_0020;
    4::87      1e-12  46%   98 aa  Y477_PARUW RecName: Full=UPF0133 protein pc0477;
    5::102     1e-12  32%  105 aa  Y1931_MYXXD RecName: Full=UPF0133 protein MXAN_1931;
   28::109     2e-12  40%  109 aa  Y1311_SHEAM RecName: Full=UPF0133 protein Sama_1311;
   27::111     2e-12  43%  112 aa  Y116_BAUCH RecName: Full=UPF0133 protein BCI_0116;
   32::107     2e-12  39%  107 aa  Y660_RICB8 RecName: Full=UPF0133 protein A1I_00660;
   30::111     2e-12  33%  113 aa  Y513_FINM2 RecName: Full=UPF0133 protein FMG_0513;
   10::107     2e-12  33%  110 aa  Y2790_SYNFM RecName: Full=UPF0133 protein Sfum_2790;
   32::110     3e-12  42%  110 aa  Y444_KLEP7 RecName: Full=UPF0133 protein KPN78578_04440;
   14::112     3e-12  33%  114 aa  Y2224_CYAP7 RecName: Full=UPF0133 protein PCC7424_2224;
   38::108     3e-12  39%  111 aa  Y2199_THEP3 RecName: Full=UPF0133 protein Teth39_2199;
   28::109     3e-12  41%  109 aa  Y140_PROMH RecName: Full=UPF0133 protein PMI0140;
   39::110     3e-12  42%  113 aa  Y074_CLOTE RecName: Full=UPF0133 protein CTC_00074;
   25::108     3e-12  37%  109 aa  Y027_BACCQ RecName: Full=UPF0133 protein BCQ_0027;
   25::108     3e-12  37%  109 aa  Y027_BACC7 RecName: Full=UPF0133 protein BCAH187_A0027;
   25::108     3e-12  37%  109 aa  Y027_BACC3 RecName: Full=UPF0133 protein BCA_0027;
   25::108     3e-12  37%  109 aa  Y027_BACAC RecName: Full=UPF0133 protein BAMEG_0027;
   25::108     3e-12  37%  109 aa  Y027_BACAA RecName: Full=UPF0133 protein BAA_0027;
   25::108     3e-12  37%  109 aa  Y024_BACC0 RecName: Full=UPF0133 protein BCAH820_0024;
   25::108     3e-12  37%  109 aa  Y021_BACC1 RecName: Full=UPF0133 protein BCE_0021;
   25::108     3e-12  37%  109 aa  Y020_BACHK RecName: Full=UPF0133 protein BT9727_0020;
   25::108     3e-12  37%  109 aa  Y020_BACCZ RecName: Full=UPF0133 protein BCE33L0020;
   25::108     3e-12  37%  109 aa  Y020_BACAN RecName: Full=UPF0133 protein BA_0020/GBAA_0020/BAS0022;
   25::108     3e-12  37%  109 aa  Y020_BACAH RecName: Full=UPF0133 protein BALH_0020;
   11::106     4e-12  32%  111 aa  Y2894_SYNJB RecName: Full=UPF0133 protein CYB_2894;
   18::114     4e-12  33%  115 aa  Y243_CLOCE RecName: Full=UPF0133 protein Ccel_0243;
   34::105     5e-12  39%  110 aa  Y294_NOCFA RecName: Full=UPF0133 protein NFA_2940;
   11::106     5e-12  32%  111 aa  Y1369_SYNJA RecName: Full=UPF0133 protein CYA_1369;
   30::102     5e-12  40%  114 aa  Y1069_THEYD RecName: Full=UPF0133 protein THEYE_A1069;
   38::108     5e-12  38%  111 aa  Y040_THETN RecName: Full=UPF0133 protein TTE0040;
   31::109     7e-12  41%  109 aa  YBAB_SHISS RecName: Full=UPF0133 protein ybaB;
   31::109     7e-12  41%  109 aa  YBAB_SHIFL RecName: Full=UPF0133 protein ybaB;
   31::109     7e-12  41%  109 aa  YBAB_SHIF8 RecName: Full=UPF0133 protein ybaB;
   31::109     7e-12  41%  109 aa  YBAB_SHIDS RecName: Full=UPF0133 protein ybaB;
   31::109     7e-12  41%  109 aa  YBAB_SHIBS RecName: Full=UPF0133 protein ybaB;
   31::109     7e-12  41%  109 aa  YBAB_SHIB3 RecName: Full=UPF0133 protein ybaB;
   31::109     7e-12  41%  109 aa  YBAB_SALTY RecName: Full=UPF0133 protein ybaB;
   31::109     7e-12  41%  109 aa  YBAB_SALTI RecName: Full=UPF0133 protein ybaB;
   31::109     7e-12  41%  109 aa  YBAB_SALSV RecName: Full=UPF0133 protein ybaB;
   31::109     7e-12  41%  109 aa  YBAB_SALPC RecName: Full=UPF0133 protein ybaB;
   31::109     7e-12  41%  109 aa  YBAB_SALPB RecName: Full=UPF0133 protein ybaB;
   31::109     7e-12  41%  109 aa  YBAB_SALNS RecName: Full=UPF0133 protein ybaB;
   31::109     7e-12  41%  109 aa  YBAB_SALHS RecName: Full=UPF0133 protein ybaB;
   31::109     7e-12  41%  109 aa  YBAB_SALG2 RecName: Full=UPF0133 protein ybaB;
   31::109     7e-12  41%  109 aa  YBAB_SALEP RecName: Full=UPF0133 protein ybaB;
   31::109     7e-12  41%  109 aa  YBAB_SALDC RecName: Full=UPF0133 protein ybaB;
   31::109     7e-12  41%  109 aa  YBAB_SALCH RecName: Full=UPF0133 protein ybaB;
   31::109     7e-12  41%  109 aa  YBAB_SALAR RecName: Full=UPF0133 protein ybaB;
   31::109     7e-12  41%  109 aa  YBAB_SALA4 RecName: Full=UPF0133 protein ybaB;
   31::109     7e-12  41%  109 aa  YBAB_ESCF3 RecName: Full=UPF0133 protein ybaB;
   31::109     7e-12  41%  109 aa  YBAB_ECOSM RecName: Full=UPF0133 protein ybaB;
   31::109     7e-12  41%  109 aa  YBAB_ECOSE RecName: Full=UPF0133 protein ybaB;
   31::109     7e-12  41%  109 aa  YBAB_ECOLU RecName: Full=UPF0133 protein ybaB;
   31::109     7e-12  41%  109 aa  YBAB_ECOLI RecName: Full=UPF0133 protein ybaB;
   31::109     7e-12  41%  109 aa  YBAB_ECOLC RecName: Full=UPF0133 protein ybaB;
   31::109     7e-12  41%  109 aa  YBAB_ECOL6 RecName: Full=UPF0133 protein ybaB;
   31::109     7e-12  41%  109 aa  YBAB_ECOL5 RecName: Full=UPF0133 protein ybaB;
   31::109     7e-12  41%  109 aa  YBAB_ECOK1 RecName: Full=UPF0133 protein ybaB;
   31::109     7e-12  41%  109 aa  YBAB_ECOHS RecName: Full=UPF0133 protein ybaB;
   31::109     7e-12  41%  109 aa  YBAB_ECODH RecName: Full=UPF0133 protein ybaB;
   31::109     7e-12  41%  109 aa  YBAB_ECOBW RecName: Full=UPF0133 protein ybaB;
   31::109     7e-12  41%  109 aa  YBAB_ECO81 RecName: Full=UPF0133 protein ybaB;
   31::109     7e-12  41%  109 aa  YBAB_ECO7I RecName: Full=UPF0133 protein ybaB;
   31::109     7e-12  41%  109 aa  YBAB_ECO5E RecName: Full=UPF0133 protein ybaB;
   31::109     7e-12  41%  109 aa  YBAB_ECO57 RecName: Full=UPF0133 protein ybaB;
   31::109     7e-12  41%  109 aa  YBAB_ECO55 RecName: Full=UPF0133 protein ybaB;
   31::109     7e-12  41%  109 aa  YBAB_ECO45 RecName: Full=UPF0133 protein ybaB;
   31::109     7e-12  41%  109 aa  YBAB_ECO27 RecName: Full=UPF0133 protein ybaB;
   32::110     7e-12  41%  110 aa  Y2800_ENTS8 RecName: Full=UPF0133 protein ESA_02800;
   25::105     7e-12  40%  106 aa  Y260_CORDI RecName: Full=UPF0133 protein DIP0260;
   28::109     7e-12  40%  109 aa  Y1507_MANSM RecName: Full=UPF0133 protein MS1507;
   29::111     7e-12  49%  112 aa  Y1196_FRATN RecName: Full=UPF0133 protein FTN_1196;
   38::108     7e-12  38%  111 aa  Y034_THEPX RecName: Full=UPF0133 protein Teth514_0034;
   31::109     9e-12  39%  109 aa  YBAB_ECO8A RecName: Full=UPF0133 protein ybaB;
   29::111     9e-12  49%  112 aa  Y810_FRATT RecName: Full=UPF0133 protein FTT0810c;
   29::111     9e-12  49%  112 aa  Y810_FRAT1 RecName: Full=UPF0133 protein FTF0810c;
   18::99      9e-12  35%  101 aa  Y1974_ACIBL RecName: Full=UPF0133 protein Acid345_1974;
   29::111     9e-12  49%  112 aa  Y1499_FRATF RecName: Full=UPF0133 protein FTA_1499;
   29::111     9e-12  49%  112 aa  Y1411_FRATH RecName: Full=UPF0133 protein FTL_1411;
   29::111     9e-12  49%  112 aa  Y1374_FRATO RecName: Full=UPF0133 protein FTH_1374;
   29::111     9e-12  49%  112 aa  Y1023_FRATM RecName: Full=UPF0133 protein FTM_1023;
   31::109     1e-11  41%  109 aa  YBAB_ECO24 RecName: Full=UPF0133 protein ybaB;
   11::93      1e-11  37%  110 aa  Y772_COXBR RecName: Full=UPF0133 protein COXBURSA331_A0772;
   11::93      1e-11  37%  110 aa  Y666_COXBN RecName: Full=UPF0133 protein CBUD_0666;
   11::93      1e-11  37%  110 aa  Y656_COXBU RecName: Full=UPF0133 protein CBU_0656;
   11::93      1e-11  37%  110 aa  Y1603_COXB1 RecName: Full=UPF0133 protein CbuK_1603;
   11::93      1e-11  37%  110 aa  Y1351_COXB2 RecName: Full=UPF0133 protein CbuG_1351;
   32::110     2e-11  39%  110 aa  Y951_ENT38 RecName: Full=UPF0133 protein Ent638_0951;
   35::94      2e-11  45%  112 aa  Y390_RHOE4 RecName: Full=UPF0133 protein RER_03900;
   11::95      2e-11  34%   96 aa  Y330_CHLCV RecName: Full=UPF0133 protein CCA_00330;
   28::109     2e-11  38%  109 aa  Y2212_AERHH RecName: Full=UPF0133 protein AHA_2212;
   40::101     2e-11  45%  113 aa  Y1593_CALS8 RecName: Full=UPF0133 protein Csac_1593;
   28::109     2e-11  38%  109 aa  Y2473_ERWT9 RecName: Full=UPF0133 protein ETA_24730;
   36::112     2e-11  42%  114 aa  Y2391_MICAN RecName: Full=UPF0133 protein MAE_23910;
   11::95      3e-11  34%   96 aa  Y672_CHLFF RecName: Full=UPF0133 protein CF0672;
   22::100     3e-11  35%  103 aa  Y035_BACHD RecName: Full=UPF0133 protein BH0035;
   10::84      6e-11  36%  102 aa  Y701_BUCCC RecName: Full=UPF0133 protein BCc_301;
   10::100     6e-11  37%  110 aa  Y533_PERMH RecName: Full=UPF0133 protein PERMA_0533;
   32::98      6e-11  43%  107 aa  Y210_COREF RecName: Full=UPF0133 protein CE0210;
   30::103     6e-11  39%  104 aa  Y039_LYSSC RecName: Full=UPF0133 protein Bsph_0039;
   32::107     7e-11  37%  107 aa  Y6705_RICAH RecName: Full=UPF0133 protein A1C_06705;
   30::111     7e-11  34%  114 aa  Y2855_ALKOO RecName: Full=UPF0133 protein Clos_2855;
   14::112     7e-11  32%  114 aa  Y1847_SYNY3 RecName: Full=UPF0133 protein slr1847;
   27::104     1e-10  35%  107 aa  YAAK_BACSU RecName: Full=UPF0133 protein yaaK;
   29::110     1e-10  46%  111 aa  Y120_FRAP2 RecName: Full=UPF0133 protein Fphi_0115;
    2::101     2e-10  34%  106 aa  Y2555_FLAJ1 RecName: Full=UPF0133 protein Fjoh_2555;
   27::112     2e-10  37%  112 aa  Y1806_PSEPF RecName: Full=UPF0133 protein Pfl01_1806;
   34::94      2e-10  43%  110 aa  Y5272_MYCSJ RecName: Full=UPF0133 protein Mjls_5272;
   34::94      2e-10  43%  110 aa  Y4993_MYCSK RecName: Full=UPF0133 protein Mkms_4993;
   34::94      2e-10  43%  110 aa  Y4904_MYCSS RecName: Full=UPF0133 protein Mmcs_4904;
   11::95      2e-10  33%   96 aa  Y039_CHLPN RecName: Full=UPF0133 protein
   35::94      4e-10  45%  110 aa  Y1287_MYCGI RecName: Full=UPF0133 protein Mflv_1287;
   31::88      5e-10  48%  107 aa  Y1612_MARAV RecName: Full=UPF0133 protein Maqu_1612;
   28::109     8e-10  37%  109 aa  Y690_SODGM RecName: Full=UPF0133 protein SG0690;
   28::110     1e-09  33%  110 aa  Y426_BUCBP RecName: Full=UPF0133 protein bbp_426;
    2::69      1e-09  37%  103 aa  Y3761_ANADF RecName: Full=UPF0133 protein Anae109_3761;
   21::81      1e-09  41%   96 aa  Y326_CHLAB RecName: Full=UPF0133 protein CAB326;
   23::99      1e-09  34%   99 aa  Y2444_LACCB RecName: Full=UPF0133 protein LCABL_24440;
   28::76      1e-09  49%  113 aa  Y4556_STRAW RecName: Full=UPF0133 protein SAV_4556;
    4::103     2e-09  28%  108 aa  Y1796_GRAFK RecName: Full=UPF0133 protein GFO_1796;
   32::102     2e-09  35%  105 aa  Y038_BACSK RecName: Full=UPF0133 protein ABC0038;
   35::94      2e-09  42%  110 aa  Y5528_MYCVP RecName: Full=UPF0133 protein Mvan_5528;
   29::76      2e-09  48%  115 aa  Y3619_STRCO RecName: Full=UPF0133 protein SCO3619;
   27::103     2e-09  34%  105 aa  Y2831_LISMH RecName: Full=UPF0133 protein LMHCC_2831;
   27::103     2e-09  34%  105 aa  Y2703_LISMO RecName: Full=UPF0133 protein lmo2703;
   27::103     2e-09  34%  105 aa  Y2683_LISMF RecName: Full=UPF0133 protein LMOf2365_2683;
   27::103     2e-09  34%  105 aa  Y2677_LISMC RecName: Full=UPF0133 protein Lm4b_02677;
   27::103     3e-09  35%  105 aa  Y2851_LISIN RecName: Full=UPF0133 protein lin2851;
   26::102     3e-09  32%  104 aa  Y1483_PEDPA RecName: Full=UPF0133 protein PEPE_1483;
   34::94      4e-09  38%  114 aa  Y319_MYCA9 RecName: Full=UPF0133 protein MAB_0319;
   27::103     4e-09  34%  105 aa  Y2654_LISW6 RecName: Full=UPF0133 protein lwe2654;
    6::98      4e-09  32%  101 aa  Y113_CAMLR RecName: Full=UPF0133 protein Cla_0113;
   28::109     5e-09  35%  109 aa  Y1136_SERP5 RecName: Full=UPF0133 protein Spro_1136;
   35::111     7e-09  36%  114 aa  Y824_CLONN RecName: Full=UPF0133 protein NT01CX_0824;
   35::94      9e-09  42%  113 aa  Y4210_RHOSR RecName: Full=UPF0133 protein RHA1_ro04210;
   35::94      9e-09  42%  113 aa  Y4137_RHOOB RecName: Full=UPF0133 protein ROP_41370;
   30::109     9e-09  31%  113 aa  Y3446_CLOBB RecName: Full=UPF0133 protein CLL_A3446;
   30::109     9e-09  31%  113 aa  Y3225_CLOBA RecName: Full=UPF0133 protein CLH_3225;
   26::104     9e-09  34%  107 aa  Y2358_BACLD RecName: Full=UPF0133 protein BLi00029/BL02358;
    6::98      9e-09  31%  103 aa  Y066_CAMFF RecName: Full=UPF0133 protein CFF8240_0066;
    1::72      1e-08  36%  109 aa  Y4574_CAUSK RecName: Full=UPF0133 protein Caul_4574;
   29::111     2e-08  42%  112 aa  Y607_FRATW RecName: Full=UPF0133 protein FTW_0607;
   12::112     3e-08  26%  113 aa  Y2143_CLOTH RecName: Full=UPF0133 protein Cthe_2143;
   31::106     3e-08  38%  115 aa  Y020_PROM4 RecName: Full=UPF0133 protein P9211_00201;
    3::100     5e-08  27%  111 aa  Y1174_PELPB RecName: Full=UPF0133 protein Ppha_1174;
   36::101     6e-08  38%  102 aa  Y699_LACPL RecName: Full=UPF0133 protein lp_0699;
   24::94      6e-08  42%  108 aa  Y492_ACIC5 RecName: Full=UPF0133 protein ACP_0492;
    2::99      6e-08  37%   99 aa  Y1642_CAMJE RecName: Full=UPF0133 protein Cj1642;
   23::98      6e-08  32%   99 aa  Y128_LACLM RecName: Full=UPF0133 protein llmg_0128;
   23::98      6e-08  32%   99 aa  Y106_LACLS RecName: Full=UPF0133 protein LACR_0106;
   31::111     6e-08  38%  113 aa  Y025_PROMM RecName: Full=UPF0133 protein PMT_0025;
   31::111     6e-08  36%  115 aa  Y019_PROM1 RecName: Full=UPF0133 protein NATL1_00191;
   12::98      8e-08  26%   99 aa  Y987_STRP2 RecName: Full=UPF0133 protein SPD_0987;
   31::108     8e-08  29%  108 aa  Y1459_CHRSD RecName: Full=UPF0133 protein Csal_1459;
   31::111     8e-08  36%  115 aa  Y1347_PROMT RecName: Full=UPF0133 protein PMN2A_1347;
   12::98      8e-08  26%   99 aa  Y1195_STRPI RecName: Full=UPF0133 protein SPH_1195;
   12::98      8e-08  26%   99 aa  Y1178_STRPS RecName: Full=UPF0133 protein SPCG_1178;
   12::98      8e-08  26%   99 aa  Y1174_STRP7 RecName: Full=UPF0133 protein SP70585_1174;
   12::98      8e-08  26%   99 aa  Y1149_STRZT RecName: Full=UPF0133 protein SPT_1149;
   12::98      8e-08  26%   99 aa  Y1108_STRZP RecName: Full=UPF0133 protein SPP_1108;
   12::98      8e-08  26%   99 aa  Y1102_STRPN RecName: Full=UPF0133 protein SP_1102;
   12::98      8e-08  26%   99 aa  Y1041_STRZJ RecName: Full=UPF0133 protein SPJ_1041;
   12::98      8e-08  26%   99 aa  Y1024_STRPJ RecName: Full=UPF0133 protein SPN23F10240;
   12::98      8e-08  26%   99 aa  Y1021_STRP4 RecName: Full=UPF0133 protein SPG_1021;
   12::98      8e-08  26%   99 aa  Y1010_STRR6 RecName: Full=UPF0133 protein spr1010;
   22::102     8e-08  27%  105 aa  Y052_PELTS RecName: Full=UPF0133 protein PTH_0052;
   11::112     1e-07  37%  114 aa  Y2554_CYAP8 RecName: Full=UPF0133 protein PCC8801_2554;
   57::105     1e-07  49%  116 aa  Y2017_EUBE2 RecName: Full=UPF0133 protein EUBELI_02017;
   61::109     1e-07  45%  112 aa  Y056_CLOPS RecName: Full=UPF0133 protein CPR_0056;
   61::109     1e-07  45%  112 aa  Y053_CLOP1 RecName: Full=UPF0133 protein CPF_0053;
   61::109     1e-07  45%  112 aa  Y046_CLOPE RecName: Full=UPF0133 protein CPE0046;
   31::111     1e-07  36%  113 aa  Y024_PROM3 RecName: Full=UPF0133 protein P9303_00241;
   10::101     1e-07  27%  110 aa  Y1366_SULSY RecName: Full=UPF0133 protein SYO3AOP1_1366;
   23::98      1e-07  32%   99 aa  Y120_LACLA RecName: Full=UPF0133 protein ybcG;
    9::60      2e-07  40%  111 aa  Y834_CHLP8 RecName: Full=UPF0133 protein Cpar_0834;
    3::69      2e-07  31%  111 aa  Y1179_CHLPB RecName: Full=UPF0133 protein Cphamn1_1179;
   21::103     2e-07  29%  106 aa  Y019_EXIS2 RecName: Full=UPF0133 protein Exig_0019;
   28::108     2e-07  31%  109 aa  Y467_BUCAP RecName: Full=UPF0133 protein BUsg_467;
   35::76      2e-07  48%  114 aa  Y3378_STRGG RecName: Full=UPF0133 protein SGR_3378;
   32::99      2e-07  37%  103 aa  Y315_CORGB RecName: Full=UPF0133 protein cgR_0315;
   32::99      2e-07  37%  103 aa  Y243_CORGL RecName: Full=UPF0133 protein Cgl0243/cg0297;
   24::71      2e-07  42%  102 aa  Y1672_METI4 RecName: Full=UPF0133 protein Minf_1672;
    5::97      2e-07  28%  111 aa  Y1157_CHLT3 RecName: Full=UPF0133 protein Ctha_1157;
   49::105     3e-07  39%  108 aa  Y018_GEOKA RecName: Full=UPF0133 protein GK0018;
    9::60      5e-07  38%  111 aa  Y805_CHLTE RecName: Full=UPF0133 protein CT0805;
   12::98      7e-07  24%   99 aa  Y270_STRPG RecName: Full=UPF0133 protein SpyM50270;
   27::96      7e-07  34%  108 aa  Y2128_RALME RecName: Full=UPF0133 protein Rmet_2128;
   27::96      7e-07  34%  108 aa  Y2111_RALEJ RecName: Full=UPF0133 protein Reut_A2111;
   12::98      7e-07  24%   99 aa  Y1606_STRP3 RecName: Full=UPF0133 protein SpyM3_1606/SPs0261;
   12::98      7e-07  24%   99 aa  Y1591_STRP6 RecName: Full=UPF0133 protein M6_Spy1591;
   31::111     7e-07  35%  113 aa  Y026_SYNPW RecName: Full=UPF0133 protein SynWH7803_0026;
   21::102     9e-07  29%  104 aa  Y1227_AKKM8 RecName: Full=UPF0133 protein Amuc_1227;
    6::79      1e-06  31%  108 aa  Y200_CAMHC RecName: Full=UPF0133 protein CHAB381_0200;
   12::98      1e-06  26%   99 aa  Y195_STRS2 RecName: Full=UPF0133 protein SSU98_0195;
   12::98      1e-06  26%   99 aa  Y194_STRSY RecName: Full=UPF0133 protein SSU05_0194;
   18::100     1e-06  29%  106 aa  Y429_ARCB4 RecName: Full=UPF0133 protein Abu_0429;
   49::105     1e-06  37%  108 aa  Y017_GEOTN RecName: Full=UPF0133 protein GTNG_0017;
   27::64      2e-06  47%  105 aa  Y1774_ALCBS RecName: Full=UPF0133 protein ABO_1774;
   26::102     2e-06  30%  104 aa  Y2780_ENTFA RecName: Full=UPF0133 protein EF_2780;
   35::97      3e-06  38%  105 aa  Y1599_THET8 RecName: Full=UPF0133 protein TTHA1599;
   35::97      3e-06  38%  105 aa  Y1235_THET2 RecName: Full=UPF0133 protein TT_C1235;
    2::71      4e-06  30%   95 aa  Y159_MYCA5 RecName: Full=UPF0133 protein MARTH_orf159;
   26::112     6e-06  28%  114 aa  Y999_THELT RecName: Full=UPF0133 protein Tlet_0999;
    6::99      6e-06  24%   99 aa  Y462_BORBU RecName: Full=UPF0133 protein BB_0462;
   31::98      6e-06  32%  103 aa  Y2278_SULNB RecName: Full=UPF0133 protein SUN_2278;
   32::98      6e-06  36%  105 aa  Y1819_CAMC5 RecName: Full=UPF0133 protein Ccur92_18190;
    6::99      7e-06  23%   99 aa  Y491_BORAP RecName: Full=UPF0133 protein BAPKO_0491;
   12::98      7e-06  23%   99 aa  Y1791_STRA3 RecName: Full=UPF0133 protein gbs1791;
   12::98      7e-06  23%   99 aa  Y1770_STRA1 RecName: Full=UPF0133 protein SAK_1770;
   12::98      7e-06  23%   99 aa  Y1747_STRA5 RecName: Full=UPF0133 protein SAG1747;
   18::71      7e-06  31%  113 aa  Y027_SYNSC RecName: Full=UPF0133 protein Syncc9605_0027;
   18::97      7e-06  29%  116 aa  Y020_PROMP RecName: Full=UPF0133 protein PMM0020;
   18::97      7e-06  29%  116 aa  Y019_PROM5 RecName: Full=UPF0133 protein P9515_00191;
   17::110     1e-05  26%  112 aa  Y126_CLOAB RecName: Full=UPF0133 protein CA_C0126;
   50::102     1e-05  34%  105 aa  Y043_DESRM RecName: Full=UPF0133 protein Dred_0043;
    6::90      2e-05  22%   99 aa  Y462_BORHD RecName: Full=UPF0133 protein BH0462;
   36::97      3e-05  32%  111 aa  Y401_LACH4 RecName: Full=UPF0133 protein lhv_0401;
   51::103     3e-05  32%  105 aa  Y2277_STAS1 RecName: Full=UPF0133 protein SSP2277;
   19::98      3e-05  29%   99 aa  Y1598_STRT2 RecName: Full=UPF0133 protein stu1598;
   19::98      3e-05  29%   99 aa  Y1598_STRT1 RecName: Full=UPF0133 protein str1598;
   19::98      3e-05  29%   99 aa  Y1560_STRTD RecName: Full=UPF0133 protein STER_1560;
   18::91      3e-05  30%  113 aa  Y027_SYNPX RecName: Full=UPF0133 protein SYNW0027;
    6::62      4e-05  35%   97 aa  Y048_HELAH RecName: Full=UPF0133 protein Hac_0048;
   36::108     5e-05  26%  109 aa  Y369_LACGA RecName: Full=UPF0133 protein LGAS_0369;
   32::106     5e-05  31%  116 aa  Y019_PROMS RecName: Full=UPF0133 protein A9601_00191;
   56::103     6e-05  38%  105 aa  Y521_STAAC RecName: Full=UPF0133 protein SACOL0521;
   56::103     6e-05  38%  105 aa  Y513_STAA2 RecName: Full=UPF0133 protein SaurJH1_0513;
   56::103     6e-05  38%  105 aa  Y500_STAA9 RecName: Full=UPF0133 protein SaurJH9_0500;
   56::103     6e-05  38%  105 aa  Y479_STAAM RecName: Full=UPF0133 protein SAV0479;
   56::103     6e-05  38%  105 aa  Y478_STAAT RecName: Full=UPF0133 protein USA300HOU_0478;
   56::103     6e-05  38%  105 aa  Y478_STAAR RecName: Full=UPF0133 protein SAR0478;
   56::103     6e-05  38%  105 aa  Y476_STAA1 RecName: Full=UPF0133 protein SAHV_0476;
   56::103     6e-05  38%  105 aa  Y453_STAA3 RecName: Full=UPF0133 protein SAUSA300_0453;
   56::103     6e-05  38%  105 aa  Y444_STAA8 RecName: Full=UPF0133 protein SAOUHSC_00444;
   56::103     6e-05  38%  105 aa  Y443_STAAE RecName: Full=UPF0133 protein NWMN_0443;
   56::103     6e-05  38%  105 aa  Y437_STAAN RecName: Full=UPF0133 protein SA0437;
   56::103     6e-05  38%  105 aa  Y436_STAAS RecName: Full=UPF0133 protein SAS0436;
   56::103     6e-05  38%  105 aa  Y434_STAAW RecName: Full=UPF0133 protein MW0434;
   56::103     6e-05  38%  105 aa  Y428_STAAB RecName: Full=UPF0133 protein SAB0428;
   56::103     6e-05  38%  105 aa  Y2533_STAHJ RecName: Full=UPF0133 protein SH2533;
   17::106     6e-05  24%  110 aa  Y1729_PSYWF RecName: Full=UPF0133 protein PsycPRwf_1729;
   25::101     6e-05  27%  104 aa  Y030_OCEIH RecName: Full=UPF0133 protein OB0030;
   57::93      8e-05  43%  133 aa  Y3778_MYCBT RecName: Full=UPF0133 protein JTY_3778;
   57::93      8e-05  43%  133 aa  Y3776_MYCBP RecName: Full=UPF0133 protein BCG_3776c;
   57::93      8e-05  43%  133 aa  Y3753_MYCTA RecName: Full=UPF0133 protein MRA_3753;
   57::93      8e-05  43%  133 aa  Y3743_MYCBO RecName: Full=UPF0133 protein Mb3743c;
   57::93      8e-05  43%  133 aa  Y3716_MYCTU RecName: Full=UPF0133 protein Rv3716c/MT3819;
    1::66      8e-05  30%  109 aa  Y269_CAUCN RecName: Full=UPF0133 protein CCNA_00269;
    1::66      8e-05  30%  109 aa  Y268_CAUCR RecName: Full=UPF0133 protein CC_0268;
   36::108     8e-05  26%  109 aa  Y1634_LACDA RecName: Full=UPF0133 protein Ldb1634;
   36::108     8e-05  26%  109 aa  Y1514_LACDB RecName: Full=UPF0133 protein LBUL_1514;
   32::106     8e-05  28%  116 aa  Y019_PROM2 RecName: Full=UPF0133 protein P9215_00191;
   36::108     1e-04  26%  109 aa  Y424_LACJO RecName: Full=UPF0133 protein LJ_0424;
    1::95      1e-04  26%  108 aa  Y332_HELHP RecName: Full=UPF0133 protein HH_0332;
    8::62      1e-04  35%   97 aa  Y031_HELP2 RecName: Full=UPF0133 protein HPP12_0031;
   32::106     1e-04  29%  116 aa  Y020_PROM9 RecName: Full=UPF0133 protein PMT9312_0020;
   32::106     1e-04  31%  116 aa  Y019_PROM0 RecName: Full=UPF0133 protein P9301_00191;
   22::98      1e-04  26%   99 aa  Y326_STRSV RecName: Full=UPF0133 protein SSA_0326;
   59::98      1e-04  42%  116 aa  Y317_MYCPA RecName: Full=UPF0133 protein MAP_0317c;
    8::62      1e-04  35%  100 aa  Y175_HELPS RecName: Full=UPF0133 protein HPSH_00175;
    8::62      1e-04  35%   97 aa  Y035_HELPY RecName: Full=UPF0133 protein HP_0035;
    8::62      1e-04  35%   97 aa  Y033_HELPH RecName: Full=UPF0133 protein HPAG1_0033;
   11::68      2e-04  28%   96 aa  Y612_CHLMU RecName: Full=UPF0133 protein TC_0612;
   57::100     2e-04  39%  116 aa  Y2330_MYCLE RecName: Full=UPF0133 protein ML2330;
   57::100     2e-04  39%  116 aa  Y2330_MYCLB RecName: Full=UPF0133 protein MLBr02330;
   11::68      2e-04  26%   96 aa  Y589_CHLT2 RecName: Full=UPF0133 protein CTL0589;
   11::68      2e-04  26%   96 aa  Y586_CHLTB RecName: Full=UPF0133 protein CTLon_0586;
   11::68      2e-04  26%   96 aa  Y363_CHLTA RecName: Full=UPF0133 protein CTA_0363;
   11::68      2e-04  26%   96 aa  Y335_CHLTR RecName: Full=UPF0133 protein CT_335;
   24::98      3e-04  23%   99 aa  Y1926_STRP8 RecName: Full=UPF0133 protein spyM18_1926;
   24::98      3e-04  23%   99 aa  Y1862_STRP1 RecName: Full=UPF0133 protein SPy_1862/M5005_Spy1580;
   24::98      3e-04  23%   99 aa  Y1647_STRPD RecName: Full=UPF0133 protein MGAS10270_Spy1647;
   24::98      3e-04  23%   99 aa  Y1638_STRPF RecName: Full=UPF0133 protein MGAS10750_Spy1638;
   24::98      3e-04  23%   99 aa  Y1605_STRPB RecName: Full=UPF0133 protein MGAS2096_Spy1605;
   24::98      3e-04  23%   99 aa  Y1585_STRPC RecName: Full=UPF0133 protein MGAS9429_Spy1585;
   24::98      3e-04  23%   99 aa  Y1568_STRPM RecName: Full=UPF0133 protein M28_Spy1568;
   74::107     4e-04  41%  107 aa  Y857_RICTY RecName: Full=UPF0133 protein RT0857;
   45::99      4e-04  29%  116 aa  Y254_SACEN RecName: Full=UPF0133 protein SACE_0254;
   35::65      4e-04  48%  100 aa  Y032_HELPG RecName: Full=UPF0133 protein HPG27_32;
   35::65      4e-04  48%  100 aa  Y031_HELPJ RecName: Full=UPF0133 protein jhp_0031;
  197::296     5e-04  33%  405 aa  PGK_LEUCK RecName: Full=Phosphoglycerate kinase;       
   40::74      9e-04  43%  107 aa  Y205_PROAC RecName: Full=UPF0133 protein PPA0205;
    1::107

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRDIMGMMGKVKEMQSKMEKVQQEIAALEIEGRAGGGLVTVILNGKGEMRGLKIDPSLFKEDEVEILEDL
Y095_AGRT5      MRDIMGMMGKVKEMQSKMEKVQQEIAALEIEGRAGGGLVTVILNGKGEMRGLKIDPSLFKEDEVEILEDL
Y231_RHIME      MRDIMGMMGKVKEMQAKMEKMQAEIAALEIDGTSGGGLVTVRLDGKGHMKSLKVDPSLFKEDDVEILEDL
Y275_METSB      MRDMLGLMKQAQAMQEKIQQMQAEIERLEVEGQSGGGMVRVTLSAKGQLRNLAIDDQLIKADEKQILEDL
Y5504_RHILO     MKDLLGLMGKAKEMQAKFQAMQDEIATVESVGQAGGGLVSVILSGKFEMKSLKIDPSLFKXXXXXXXXXX
Y260_GRABC      MKNLAGLMKQASQMQAKMGEMQAKLETVEAEGSAGAGMVTVTLNGKGDLRRLHIDPKLADPAETEMLEDL
Y033_BRUMB      MRDMMGMMKQAKELQAKMKAMQDEIATMEASASSGGGLVTVTLSGKGTLSALKIDPSLMKXXXXXXXXXX
Y3472_RHORT     MKNIGQMLKQAQQLQTRMAEVQEELKAMDVSGQSAAGMCVVTLDGKGGVRSIKIDPSLVDPKETEVMEDL
Y1439_BORBR     ---LAGLMRQAQQMQENMKKAQDALAEIQVEGAAGGGLVKVTMTCRHDVKRVAIDPSLLGEDK-DMLEDL
Y1222_BORPA     ---LAGLMRQAQQMQENMKKAQDALAEIQVEGAAGGGLVKVTMTCRHDVKRVAIDPSLLGEDK-DMLEDL
Y7345_BRASB     MADFLGMMKQAAQLQSKMQAMQEELGSLEVEGISGGGLVAVRMTAKMEVKGIKIDPSLLKPDEAEILEDL
Y2329_JANMA     ---LAGLMKQAQAMQDNMKKMQDQLASIEVEGQSGAGLVKVVMSCKNDVKRVSIDPSLLADDK-DMLEDL
Y915_BORA1      ---LAGLMRQAQQMQENMKKAQDALADILVEGAAGGGLVKVTMSCRNDVKRIAIDPSLLADDK-DMLEDL
Y1975_LEPCP     ---LAGLMKQAQAMQDNLKKAQDELANVEVEGQSGAGLVKVVMTCKHDVKRLSIDPSLLADDK-DMLEDL
Y1550_BORPE     ---LAGLMRQAQQMQENMKKAQDALAEIQVEGAAGGGLVKVTMTCRHDVKRVAIDASLLGEDK-DMLEDL
Y231_HALHL      ------IMKQAQKMQEDMQKAQEEIAAMEVSGEAGAGMVKVTMTGRNEVRKVEIDPSLF-EDDREMVEDL
Y620_RHOPT      MADFLGMMKQAAQLQSKMKAMQAELDQIEVEGLSGGGLVKVRMSAKMEVRGISIDPSLIKADEREVLEDL
Y3467_GLUDA     MKNLAGLMKQATQMQARMEEMQSKLEGMTIEGSAGAGMVHVTLNGKGDMKAVKIDPKLADPAEMEMLQDL
Y1984_AZOVD     -----GLMKQAQLMQEKMQKLQEEIANAEVTGQSGAGLVSVVMTGRHDVRRVTLDDSLMQEDK-EVLEDL
Y603_GLUOX      MKNLAGLMKQASQMQAKMEAAQSNLASLIVDGSAGAGLVTVKLTGKGEMRDLKIDPQLADPSDIETLQDL
Y858_STRM5      --NIAQLMQQAQKMQENLQKAQEEIAKIEVTGSAGGGMVSVTLTGAKECRKVRIDPSL--ASDPEMLEDL
Y7544_OLICO     MADFLGMMKQAAQLQSKMKEMQEQLDQVEVEGSAGGSMVTVRMTAKMELKAVSIDPSLMKPEEREVLEDL
Y616_RHOPA      MADFLGMMKQAAQLQSKMKAMQAELDQIEVEGLSGGGLVKVRMSAKMEVRGISIDPSLIKADEREVLEDL
Y290_BRUA1      MRDMMGMMKQAKELQAKMKAMQDEIATMEASASSGGGLVTVTLSGKGTLSALKIDPSLMKXXXXXXXXXX
Y1909_BRUME     MRDMMGMMKQAKELQAKMKAMQDEIATMEASASSGGGLVTVTLSGKGTLSALKIDPSLMKXXXXXXXXXX
Y1015_STRMK     --NIAQLMQQAQKMQENLQKAQEEIAKIEVTGSAGGGMVSVTLTGAKECRKVRIDPSL--TSDPEMLEDL
Y035_BRUSI      MRDMMGMMKQAKELQAKMKAMQDEIATMEASASSGGGLVTVTLSGKGTLSALKIDPSLMKXXXXXXXXXX
Y034_BRUC2      MRDMMGMMKQAKELQAKMKAMQDEIATMEASASSGGGLVTVTLSGKGTLSALKIDPSLMKXXXXXXXXXX
Y033_BRUSU      MRDMMGMMKQAKELQAKMKAMQDEIATMEASASSGGGLVTVTLSGKGTLSALKIDPSLMKXXXXXXXXXX
Y033_BRUO2      MRDMMGMMKQAKELQAKMKAMQDEIATMEASASSGGGLVTVTLSGKGTLSALKIDPSLMKXXXXXXXXXX
Y033_BRUAB      MRDMMGMMKQAKELQAKMKAMQDEIATMEASASSGGGLVTVTLSGKGTLSALKIDPSLMKXXXXXXXXXX
Y030_BRUA2      MRDMMGMMKQAKELQAKMKAMQDEIATMEASASSGGGLVTVTLSGKGTLSALKIDPSLMKXXXXXXXXXX
Y1999_ACICJ     MKNLAGLXXXXXXXXXXXXXXXTRLEAMEIRGEAGAGLVKVTLSGKGEMKGIEIDPKLIDPNDAEMLQDL
Y1981_DICT6     MKNPFEAMKQLKKLQEKMAKIEEELEQTLVEGTAGGGVVKIIMNAKEEIKEVKIDPEVVNKDEVDILEDL
Y764_BRASO      MADFLGMMKQAAQLQSKMQEMQAELGNVEVEGISGGGLVAVRMTAKMDVKSIKIDPSLLKPEEAEILEDL
Y3552_BORPD     ---LAGLMRQAQQMQENMKKAQDALAEIIVEGESGGGLVKVSMSCRHDVKRVAIDPSLLADDK-DMLEDL
Y258_DICTD      MKNPFEAMKQLKKLQEKMAKIEEELEQTLVEGTAGGGVVKIVMTAKEEVKEVKIDPEVVNKDEVDILEDL
Y3358_XANCB     --NIAQLMQQAQKMQENLQRAQEELAKLEVTGSAGGGMVSVTLTGAKECRKVRIDPSILSDQ--EMAEDL
Y3243_XANC8     --NIAQLMQQAQKMQENLQRAQEELAKLEVTGSAGGGMVSVTLTGAKECRKVRIDPSILSDQ--EMAEDL
Y2533_MARMS     ------MMRQAQQMQENMQKAQEEIANMEVEGQAGAGLVKILMTGRHDVKRVSIDDSLFGDDK-EMLEDL
Y231_BARHE      -------------------------ANLQVTGTAGGGLVSITLNGKNTITAIKIDPSLLKPEEIEILEDL
Y1002_XANCP     --NIAQLMQQAQKMQENLQRAQEELAKLEVTGSAGGGMVSVTLTGAKECRKVRIDPSILSDQ--EMAEDL
Y257_BART1      ----------------RMQKIQEEMANLQATGTAGGDLVSITLNGKNIITAIQIDPSLLKPEEAEILEDL
Y1128_XANC5     --NIAQLMQQAQKMQENLQRAQEELAKLEVTGSAGGGMVSVTLTGAKECRKVRIDPSILSDQ--EMAEDL
Y1110_XANAC     --NIAQLMQQAQKMQENLQRAQEELAKLEVTGTAGGGMVSVTLTGAKECRKVRIDPSILSDQ--EMAEDL
Y965_XANOM      --NIAQLMQQAQKMQENLQRAQEELAKLEVTGTAGGGMVNVTLTGAKECRKVRIDPSILSDQ--EMAEDL
Y3086_VIBHB     ------LMKQAQQMQDRMQKLQEEIANMEVTGESGAGLVKVTITGSHSVRRVEIDESLM-EDDKEMLEDL
Y1808_XYLFA     --NIAQLMQQAQKMQENLQRAQEELAKLEVTGSAGGGMVSVILSGTKECRKVRIDPSILNDQ--EMIEDL
Y1065_XANOR     --NIAQLMQQAQKMQENLQRAQEELAKLEVTGTAGGGMVNVTLTGAKECRKVRIDPSILSDQ--EMAEDL
Y368_NITWN      MADFLGMMKQAAQFQSKMKAMQDELDQIEVDGASGGGLVTVRMTAKMEVKGISIDPSLIKPDEREILEDL
Y639_AZOSE      ---IAGLMKQAQQMQENMKKMQDQLASVEVEGQSGAGMVKVLMTCKYDVRRVTIDDSVM--DDKEMLEDL
Y2178_VIBPA     ------LMKQAQQMQERMQKLQEEIANMEVTGESGAGLVKVTITGSHSVRRVDIDESLM-EDDKEMLEDL
Y1216_XYLFM     --NIAQLMQQAQKMQENLQRAQEELAKLEVTGSAGGSMVSVILSGTKECRKVRIDPSILNDQ--EMIEDL
Y1122_XYLF2     --NIAQLMQQAQKMQENLQRAQEELAKLEVTGSAGGSMVSVILSGTKECRKVRIDPSILNDQ--EMIEDL
Y1058_XYLFT     --NIAQLMQQAQKMQENLQRAQEELAKLEVTGSAGGSMVSVILSGTKECRKVRIDPSILNDQ--EMIEDL
Y1055_VIBCH     ------LMKQAQQMQERMQKLQEEIANMEVTGESGAGLVKVTVTGSHSVRRVNIDESLM-EDDKEMLEDL
Y2410_VIBVY     ------LMKQAQQMQERMQKLQEEIANMEVVGESGAGLVKVTITGSHSVRRVNIDESLM-EDDKEMLEDL
Y2004_VIBVU     ------LMKQAQQMQERMQKLQEEIANMEVVGESGAGLVKVTITGSHSVRRVNIDESLM-EDDKEMLEDL
Y022_OCHA4      MRDMMGMMKQAKELQAKMKAMQDEIATMEASASSGGGLVTITLSGKGTLSALKIDPSXXXXXXXXXXXXX
Y2614_HAHCH     ------LMKQAQKIQEQMQKAQEELANAEVSGESGGGLIKIVMNGRHDVKKVEIDASLMQE-EKEILEDL
Y219_BARQU      MRDMMSXXXXXXXXXXXXXXXXXXXTNLQMIGTAGGGLINVTLNGKNTITAIKIDPSLLKPEESEILEDL
Y1239_BARBK     ---------------------------LKVTGTAGGGLVSITLNGQNIISEVKIDPSLIKPEESEILEDL
Y463_NITHX      MADFLGMMKQAAQLQSKMKAMQDELDHVEVEGASGGGLVSVRMTAKMEVKAISIDPSLMKPDEREILEDL
Y436_MARMM      MKDLMGLXXXXXXXXXXXXXXXXRLAETEVTGEAGAGLVRVVLTAKGDMVSIHVDKSLMDPDEPEILEDL
Y255_BEII9      MKDMMGLLKQAQAMQAKVQDMQAALEQITVEGHAGGGLVKITLTVKGQIRSVSIDPSLLKPEEKEIVEDL
YUD3_BRAJA      MADFLGMMKQAAQLQSKMQEMQDALGNVEVEGISGGGLVVVRMTAKMDVKGVKIDPSLMKAEEREVLEDL
Y4812_RHOP5     MADFLGMMKQAAQLQSKMKEMQSELDRIEVEGISGGGLVNVRMSAKMEVRAVKIDPSLLNPDEVGVLEDL
Y2594_NITOC     ------LMKQAQQLQSNMEKAQEELANMEVTGQAGGGMVSIVMTGRYDCRRISIHSELWQEDK-EMVEDL
Y4847_RHOPB     MADFLGMMKQAAQLQSKMKAMQEELEHIEVEGISGGGLVSVRMTAKMEVKTIKIDPSLINADEAGVLEDL
Y1202_PSEHT     ------MMKQAQQMQDRMQKAQDEIATLEVVGEAGAGLVKVTMLGNHNVRRVELDESLMQDDK-DMIEDL
Y591_NITEC      ------LMKQAQQMQENMKAMQEKLATIEVEGQAGAGMVKVIMTCRHDVKRINIDSSLIGDDK-EMLEDL
Y1611_CHRVO     ---IAGLMKQAQQMQENMKKAQEELAKVEVEGQSGAGMVKVTMTCSHDVKRVAIDDSVLEDEDKEMLEDL
Y917_VIBSL      ----------------RMQKLQEEIANMEVTGESGAGLVKVTITGSHSVRRVDIDESLM-EDDKEMLEDL
Y2533_METPP     ---LAGLMKQAQAMQDNLKKAQDELALIEVEGQSGAGLVKVLMTCKHDVKRITIDPSLLADDK-DMLEDL
Y2014_SHEON     ------LMKQAQMMQERMAKMQEEIARMEMVGESGAGLVKVTMTGAHTVRKVEIYPSLM-EDDKEMLEDL
Y1905_PSEF5     ------------------------LANAEVTGKAGGDMVTVVMTGRHDIKRVSIDPSLLEEDDREVLEDL
Y1098_ALTMD     ------IMKQAQQMQERMQKVQDDLANLEVTGEAGAGMVKVTMTCNHNVRRVNIDESLMDDDK-DMVEDL
Y3498_GLOVI     ---------RVKQIQEGSAKLQDELAALSIEGVAGGGLVKVTLSGNQEPTGVTIDPQLLSESK-EVVEDL
Y308_HAES2      ------------------------IAQLEVTGEAGAGLIKVTINGAHNCRRIDIDPSLM-EDDKEMLEDL
Y2276_PSYIN     ------LMKKAQEMQENMKKAQAEIANTEVTGESGAGLVKITILGNHNVRKVEIDPSLM-EDDKEMLEDL
Y1509_ALHEH     ------------------------IAKMEVTGESGGGMVAVTINGKHEARRVSIDPSLF-EDDREMVEDL
Y1309_HAES1     ------------------------IAQLEVTGEAGAGLIKVTINGAHNCRRIDIDPSLM-EDDKEMLEDL
Y780_HAEIE      ---------------------------LEVTGESGAGLVKIAINGAHNCRRIDIDPSLM-EDDKEMLEDL
Y5435_HAEIG     ---------------------------LEVTGESGAGLVKIAINGAHNCRRIDIDPSLM-EDDKEMLEDL
Y442_HAEIN      ---------------------------LEVTGESGAGLVKITINGAHNCRRIDIDPSLM-EDDKEMLEDL
Y2380_SHEDO     ----------------------EEIARMEITGEAGAGLVKVTMTGSHSVRKVEIDPSLM-EDDKEMLEDL
Y075_ACTPJ      ------------------------IAQLEVTGESGAGLVKVTINGAHNCRRIEIDPSLM-EDDKEMVEDL
Y075_ACTP7      ------------------------IAQLEVTGESGAGLVKVTINGAHNCRRIEIDPSLM-EDDKEMVEDL
Y075_ACTP2      ------------------------IAQLEVTGESGAGLVKVTINGAHNCRRIEIDPSLM-EDDKEMVEDL
Y3840_PHOLL     ----------------------EEIASLEVTGESGAGLVKVTINGAHNCRRVEIDPSLM-EDDKEMLEDL
Y1920_ACIF2     ------IMKQAQQLQERLQKTQEELAQVEVQGHAGGNLVEVTMTCRHDVRRVRIDPSLLTDGDQEMLEDL
Y1592_ACIF5     ------IMKQAQQLQERLQKTQEELAQVEVQGHAGGNLVEVTMTCRHDVRRVRIDPSLLTDGDQEMLEDL
Y3586_PSEPW     ------------------------LANAEVTGQSGGGLVSVVMTGRHDVKRVSIDQSLMEEDDKEVLEDL
Y1046_HERAR     ---LAGLMKQAQAMQDNMKKMQEQLALIEVEGQSGAGLVKIVMSCKNDVKRVSIDPSLLADDK-DMLEDL
Y4268_PSEPK     ------------------------LANAEVTGQSGGGLVSVVMTGRHDVKRVSIDQSLMSEDDKEVLEDL
Y3833_PSEPG     ------------------------LANAEVTGQSGGGLVSVVMTGRHDVKRVSIDQSLMSEDDKEVLEDL
Y1796_BURM1     --NLAGLMKQAQQMQENMRKMQEQLAQIEVEGQSGAGLVKVTMTCRNEVRRVSIDPSLLADDK-DMLEDL
Y1600_PSEP1     ------------------------LANAEVTGQSGGGLVSVVMTGRHDVKRVSIDQSLMSEDDKEVLEDL
Y1040_HAEPS     ------------------------IAQLEVTGESGAGLVKVTINGAHNCRRIEIDPSLM-EDDKEMAEDL
Y2646_PSEMY     ------------------------LANAEVTGQSGAGLVSVVMTGRHDVKRITLDDSLMQEDK-EVLEDL
Y1036_RALPJ     ---IAGLMKQAQQMQENMKKAQEQLALIEVEGVSGAGLVKVVMTCKNDVKRVSIDPSLLAEEDKDLLEDL
Y701_POLSQ      -----------------------ELAALEVNGQAAGGLVKVAISGKYELKRVQIDPGAM--DDREMLEDL
Y645_POLNS      -----------------------ELAALEVTGQAAGGLVKVTISGKYELKRVQIDPGAM--DDREMLEDL
Y4577_PSEFS     ------------------------LANAEVTGKAGGDMVSVVMTGRHDIKRVSIDPSVLPEDDLEMLEAL
Y3645_PSESM     ------------------------LANAEVTGQSGAGLVSVVMTGRHDVKRINLDDSLMQEDK-EVLEDL
Y2406_SHEFN     ----------------------EEIARTEMTGEAGAGLVKVTMTGNHNVRKVEIDPSLM-EDDKEMLEDL
Y1826_PSEU2     ------------------------LANAEVTGQSGAGLVSVVMTGRHDVKRINLDDSLMQEDK-EVLEDL
Y1786_PSE14     ------------------------LANAEVTGQSGAGLVSVVMTGRHDVKRINLDDSLMQEDK-EVLEDL
Y3092_YERE8     ------------------------VAKLEVTGESGAGLVKVTINGAHNCRRVEIDPSLLVEEDKEMLEDL
Y205_PASMU      ------LMKQAQQMQDRMQKMQEEIAQLEVTGESGAGLVKITINGAHNCRRVEIDPS-XXXXXXXXXXXX
Y993_YERPS      ------------------------VAKLEVTGESGAGLVKVTINGAHNCRRVEIDPSLLVEDDKEMLEDL
Y967_YERPN      ------------------------VAKLEVTGESGAGLVKVTINGAHNCRRVEIDPSLLVEDDKEMLEDL
Y326_HAEDU      ------------------------IAQLEVTGESGAGLVKVTINGAHNCRRIEIDASLM-EDDKEMVEDL
Y3197_YERPY     ------------------------VAKLEVTGESGAGLVKVTINGAHNCRRVEIDPSLLVEDDKEMLEDL
Y3121_YERPE     ------------------------VAKLEVTGESGAGLVKVTINGAHNCRRVEIDPSLLVEDDKEMLEDL
Y3058_YERP3     ------------------------VAKLEVTGESGAGLVKVTINGAHNCRRVEIDPSLLVEDDKEMLEDL
Y2890_YERPG     ------------------------VAKLEVTGESGAGLVKVTINGAHNCRRVEIDPSLLVEDDKEMLEDL
Y2758_YERPP     ------------------------VAKLEVTGESGAGLVKVTINGAHNCRRVEIDPSLLVEDDKEMLEDL
Y2615_YERPA     ------------------------VAKLEVTGESGAGLVKVTINGAHNCRRVEIDPSLLVEDDKEMLEDL
Y1810_VIBFM     ------LMKQAQQMQDRMQKMQEEIANMEVTGESGAGLVKVTITGSHSVRRVEIDPSXXXXXXXXXXXXX
Y1686_VIBF1     ------LMKQAQQMQDRMQKMQEEIANMEVTGESGAGLVKVTITGSHSVRRVEIDPSXXXXXXXXXXXXX
Y1036_YERPB     ------------------------VAKLEVTGESGAGLVKVTINGAHNCRRVEIDPSLLVEDDKEMLEDL
Y1429_DESPS     --DISKLMQQAKDMQGKMAAIQEDLAKKIITGSAGGGMVEVQVNGQGEILAIKIEDALINTDEKEMLQDL
Y1109_EDWI9     ------------------------IALVEVTGESGAGLVKVTINGAHNCRRVEIDPSLM-EDDKEMLEDL
Y086_RHOPS      MADFLGMMKQAAQLQSKMKAMQAELDQIEVEGSSGGGLVQVRMSAKMEVRGVSIDPSLLKPDEGGVLEDL
Y1789_PSEE4     ------------------------LANAEVTGQSGGGLVSVVMTGRHDVKRVSIDQSLMSTDDKEVLEDL
Y807_DECAR      ---LAGLMKQAQAMQENMKKAQEQLAQXXXXXXXXXXMVKVLMTCAHEVRRVNIDPSVM--DDREMLEDL
Y4462_PSEAB     ------------------------LANAEVTGQSGAGLVSVVMTGRHDVKRVSLDDSLMQEDK-EILEDL
Y3795_PSEA8     ------------------------LANAEVTGQSGAGLVSVVMTGRHDVKRVSLDDSLMQEDK-EILEDL
Y1533_PSEAE     ------------------------LANAEVTGQSGAGLVSVVMTGRHDVKRVSLDDSLMQEDK-EILEDL
Y1086_ALISL     ------LMKQAQQMQDRMQKMQEEIGNMEITGESGAGLVKVTITGSHSVRRVEIDPSXXXXXXXXXXXXX
Y2301_SHEPC     ------------------------IARMEMVGESGAGLVKVTMTGAHTVRKVEIDPSLM-EDDKEMLEDL
Y1770_SHEB2     ------------------------IARMEMVGESGAGLVKVTMTGAHTVRKVEIDPSLM-EDDKEMLEDL
Y1707_SHESW     ------------------------IARMEMVGESGAGLVKVTMTGAHTVRKVEIDPSLM-EDDKEMLEDL
Y1365_RICFE     -------------------------------GKAGGGLVEVIATGKGEVEKITIDESLLKPEEKEMLEDL
Y1657_NEIMA     -----GLMKQAQQMQENMKKAQAKLAETEIEGEAGNGLVKITMTCAHEVRKIDISPDLIQEDDKEMLEDL
Y1192_RALSO     ------------------------LSQIEVEGVSGAGLVKVVMTCKNDVKRVSIDPSLLAEEDKELLEDL
YGG0_WIGBR      ------LMKQAQKIQEKMKLIQEEISKLEAIGESGAGLVKIKLNGSRYCNYVKIDNSLLKDK--EMLEDL
Y7555_RICPU     -------------------------------GKAGGGLVEVIATGKGEVEKISIDESLLKAEEKEMLEDL
Y3743_COLP3     ----------------------EELAQMEVVGEAGAGMVKVTMTGSHSVRKVELDDSLM-EDDKDMIEDL
Y1337_RICCN     -------------------------------GKAGGGLVEVIATGKGEVEKISIDESLLKAEEKEMLEDL
Y1224_RICAE     -------------------------------GKAGGGLVEVIATGKGEVEKISIDESLLKAEEKEMLEDL
Y997_ACTSZ      ----------------RMQKMQDEIAQLEVTGESGAGLVKITLNGAHNCRRIEIDPS-XXXXXXXXXXXX
Y866_RICPR      -------------------------------GKAGGMLVEIIITGKGEVEKISIDESLLKTEEKEMLEDL
Y1444_NEIMB     -----GLMKQAQQMQENMKKAQAKLAETEIEGEAGNGLVKITMTCAHEVRKIDISPDLIQEDDKEMLEDL
Y1380_NEIMF     -----GLMKQAQQMQENMKKAQAKLAETEIEGEAGNGLVKITMTCAHEVRKIDISPDLIQEDDKEMLEDL
Y1355_NEIM0     -----GLMKQAQQMQENMKKAQAKLAETEIEGEAGNGLVKITMTCAHEVRKIDISPDLIQEDDKEMLEDL
Y1967_ACIBY     -----------KDMESNIKKAKEELAQTEVHAEAGGGLVKVTMTGRYIVKRIEINPELL-QDEPDMIEDL
Y1914_ACIBS     -----------KDMESNIKKAKEELAQTEVHAEAGGGLVKVTMTGRYIVKRIEINPELL-QDEPDMIEDL
Y1909_ACIB5     -----------KDMESNIKKAKEELAQTEVHAEAGGGLVKVTMTGRYIVKRIEINPELL-QDEPDMIEDL
Y1813_ACIB3     -----------KDMESNIKKAKEELAQTEVHAEAGGGLVKVTMTGRYIVKRIEINPELL-QDEPDMIEDL
Y1718_ACIBC     -----------KDMESNIKKAKEELAQTEVHAEAGGGLVKVTMTGRYIVKRIEINPELL-QDEPDMIEDL
Y1684_ACIBT     -----------KDMESNIKKAKEELAQTEVHAEAGGGLVKVTMTGRYIVKRIEINPELL-QDEPDMIEDL
Y799_PSYCK      --NIQALMQQAQTMQKKVENAKKELGNKEVHAEAGSGLVKVTMTGRHVVKRLTIDPSLL-EDEPDMIEDL
Y7310_RICRS     -------------------------------GKAGGGLVEVIATGKGEVEKISIDESLLKAEEKEMLEDL
Y5067_ANASP     MKELAEAFKKAQQVQEGAKRLQEELEQMEIQGEAGGGLVKVIVSGNQEPKRVEISPDALAQG-ADLLSDL
Y1848_IDILO     ---------------------------MEVTGEAGAGLVKITMLGNHNVKRVSIDPSLMEDDQ-EMLEDL
Y1562_RICRO     -------------------------------GKAGGGLVEVIATGKGEVEKISIDESLLKAEEKEMLEDL
Y558_CHLSY      -------------------KVQEELAATIVEGTAGGGAITVKMNGHREVQSITISPEVVDPDDVEMLQDL
Y522_CHLAA      -------------------KVQEELAATIVEGTAGGGAITVKMNGHREVQSITISPEVVDPDDVEMLQDL
Y1912_CORU7     ------IMAQAQRMQKQLQEAQAEIVASSIVGEAGNGKVTLVLSGGGEVQDLKIDQEVVDPEDVETLQDL
Y742_NEIG1      -----GLMKQAQQMQENMKKAQAKLAETEIEGEAGNGLVKITMTCAHEVRKIDISPDLIQEDDKEMLEDL
Y723_THEEB      MKELAAAIQKAQQVQEGAKKLQEDLERMDIEGQAAGGAVKVIMSGTQEPRRVEISPDLLSEG-AEVLSDL
Y1136_NEIG2     -----GLMKQAQQMQENMKKAQAKLAETEIEGEAGNGLVKITMTCAHEVRKIDISPDLIQEDDKEMLEDL
Y2322_ANAVT     MKELAEAFKKAQQVQEGAKRLQEELEQMEILGEAGGGLVKVIVSGNQEPKRVEISPDALAQG-ADLLSDL
Y1327_METCA     ---LANLMQQAQRFQETFQKXXXXXXXXXXXXXSGGGLVKIRMNGKREVLKVEIDPSL-RQEEHEVLEDL
Y2292_ROSCS     -----------RQMQKEMMRIQEELANATVEGTAGS-YITVTMNGHREIKSIKIAPEVVDPDDIETLQDL
Y1534_ROSS1     -----------RQMQKEMMRIQEELANTTVEGTAGS-YVTVTMNGHREIKSIKLAPEVVDPDDVETLQDL
Y448_NOSP7      MKELADAFKKAQQVQEGAKRLQEELEQMEILGESGGGLVKVIVSGNQEPKRVEISPDALAEG-AEVLSDL
Y3694_ANASK     --DIQYLMRQAKKLEKAMADAKEKLAEIAVEAESGGGLVKVAMNGKCEITRLTVDPKAIDPNDKALLEDL
Y3636_ANADE     --DIQYLMRQAKKLEKAMADAKEKLAEIAVEAESGGGLVKVAMNGKCEVTRLTVDPKAIDPNDKAMLEDL
Y793_PSYA2      --NIQALMQQAQTMQKKVENAKKDLANKEVHAEAGSGLVKVTMTGRHVVKRLTIDPSLL-EDEPDMIEDL
Y3777_ANAD2     --DIQYLMRQAKKLEKAMADAKEKLAEIAVEAESGGGLVKVAMNGKCEITRLTVDPKAVDPNDKALLEDL
Y2305_RHOCS     -----------------------KLAEVEVNGVSAGGMVSILLNGKGELKQIKLDKSXXXXXXXXXXXXX
Y5550_RICCK     -------------------------------GKAGGRLVEITITGRSEVEKVSIDESLLKAEEKEMLEDL
Y667_RHOP2      MADFLGMMKQAAQLQSKMKAMQAELDQIEVEGLSGGGLVKIRMSAKMEVRGVSIDPSLLKXXXXXXXXXX
Y4104_MAGSA     -----------------------------VTGSSGAGMLQVTLNGKYELKKVKIDPSLVDPSDVEVLEDL
Y3826_CLOK5     ------LMKQAQKFQKQMEDMQSELENKEFSATAGGEAITVVVNGKKQIVSIKIKPEVVDPEDVEMLEDL
Y3200_CHLAD     -------------------KVQEELAATIVEGTAGGGAIVVKMNGHREVQSITISPEVVDPNDVDMLQDL
Y464_SYNE7      MKELADAFKKAQQVQEGAKQVQEDLNNMEIEGQAQGGLVKVWVSGNQEPLRAEIAPEALNEG-AEVLSEL
Y329_EUBR3      ------LMKQAQKMQRQMEEAQKQLEDAEVTAKAGGGAVEVTVSGKKEITKVKLSEEVVDPDDIEMLEDL
Y2087_AERS4     ------------------------LAEMEVVGEAGAGMVKVTMAGSHSVRRIEIDQSLM-EDDKEMIEDL
Y1143_ANATD     --NINQLQKQARKMQEEIEKLQEELNQREIEVSSGGGAVKVVINGKKEIKSIQILPEVVDPEDVETLQDL
Y1054_SYNP6     MKELADAFKKAQQVQEGAKQVQEDLNNMEIEGQAQGGLVKVWVSGNQEPLRAEIAPEALNEG-AEVLSEL
Y019_BACCN      -------------------KAQEELGEKQVEGTAGGGMVTVIANGHKQILDVKMKEEVVDPEDIEMLQDL
Y5293_BACC2     -------------------KAQEELGEKTVEGTAGGGMITVIANGHKQILEVKIKEEVVDPEDIEMLQDL
Y1113_GEMAT     --DLFKMLGQFKDMQGRMQTMQEEMSQRTFSALAGGGLVTADVDGKMQLKRIKLDASVVNPGDIEMLEDL
Y025_BACCR      -------------------KAQEELGEKTVEGTAGGGMITVIANGHKQILEVKIKEEVVDPEDIEMLQDL
Y025_BACC4      -------------------KAQEELGEKTVEGTAGGGMITVIANGHKQILEVKIKEEVVDPEDIEMLQDL
Y899_CYAP4      MKELAAAIQKAQQVQEGAKKLQEDLEKMEIEGVAAGGLVKVIMSGNQEPRRVEISPDLMSEG-AEVVADL
Y2234_SHELP     ----------------------EEIARMEVTGEAGAGLVKVTMTGSHSVRKVEIDPSXXXXXXXXXXXX-
Y2011_CORJK     ----------------------REIAASTVKGEAGNGLVTISVAGSGEVTDMEIDPKIVDPEDIDTLKDL
Y017_CLOD6      ------LLKQAQKMQENMQKAQQELESKEVEASVGGGAVTVKVNGKKEVIDITIKPEVVDPDDIEMLQDL
Y952_BURP8      ------------------------LAQIEVEGQSGAGLVKVTMTCKNDVRRVSIDPSLLADDK-DMLEDL
Y2072_BURXL     ------------------------LALIEVEGQSGAGLVKVTMTCKNDVRRVSIDPSLLADDK-DMLEDL
Y1827_BURPP     ------------------------LALIEVEGQSGAGLVKVTMTCKNDVRRVSIDPSLLADDK-DMLEDL
Y1171_CHLPD     MPNLGDMMKQIQQAGEKMQDVQKQLEKIVAYGEAGGGMVKVSVNGKQKLLTLQIDPDIM--DDAEMVQDL
Y1177_ERWCT     ------------------------VANLEVTGESGAGLVKITINGAHNCRRVEIDPSLM-EDDKEMLEDL
Y6253_BURCA     ------------------------LALIEVEGQSGAGLVKVTMTCRNEVRRVSIDPSLLADDK-DMLEDL
Y5127_BURS3     ------------------------LALIEVEGQSGAGLVKVTMTCRNEVRRVSIDPSLLADDK-DMLEDL
Y199_DEIRA      --------------------IQDELAAQSVEGTASG-LVTVQMNGHGKVTSLKIKPEAVDGDDVEALEDL
Y1861_BURCJ     ------------------------LALIEVEGQSGAGLVKVTMTCRNEVRRVSIDPSLLADDK-DMLEDL
Y1850_BURCC     ------------------------LALIEVEGQSGAGLVKVTMTCRNEVRRVSIDPSLLADDK-DMLEDL
Y1826_BURCH     ------------------------LALIEVEGQSGAGLVKVTMTCRNEVRRVSIDPSLLADDK-DMLEDL
Y1077_PECCP     ------------------------VANLEVTGESGAGLVKITINGAHNCRRVEIDPSLM-EDDKEMLEDL
Y3650_BURMS     ------------------------LALIEVEGQSGAGLVKVTMTCRNEVRRVAIDPSLLADDK-DMLEDL
Y3622_BURM7     ------------------------LALIEVEGQSGAGLVKVTMTCRNEVRRVAIDPSLLADDK-DMLEDL
Y2851_SHESH     ----------------------EEIARMEVTGEAGAGLVKVTMTGSHSVRKVDIDPSXXXXXXXXXXXX-
Y2372_BURP1     ------------------------LALIEVEGQSGAGLVKVTMTCRNEVRRVAIDPSLLADDK-DMLEDL
Y2346_BURM9     ------------------------LALIEVEGQSGAGLVKVTMTCRNEVRRVAIDPSLLADDK-DMLEDL
Y2243_BURP0     ------------------------LALIEVEGQSGAGLVKVTMTCRNEVRRVAIDPSLLADDK-DMLEDL
Y2220_BURTA     ------------------------LALIEVEGQSGAGLVKVTMTCRNEVRRVSIDPSLLADDK-DMLEDL
Y2205_BURP6     ------------------------LALIEVEGQSGAGLVKVTMTCRNEVRRVAIDPSLLADDK-DMLEDL
Y1794_SHEWM     ----------------------EEIARMEVTGEAGAGLVKVTMTGSHSVRKVDIDPSXXXXXXXXXXXX-
Y1764_BURCM     ------------------------LAQIEVEGQSGAGLVKVTMTCRNEVRRVAIDPSLLADDK-DMLEDL
Y1753_BURVG     ------------------------LAQIEVEGQSGAGLVKVTMTCRNEVRRVAIDPSLLADDK-DMLEDL
Y1737_BURA4     ------------------------LAQIEVEGQSGAGLVKVTMTCRNEVRRVAIDPSLLADDK-DMLEDL
Y1499_BURPS     ------------------------LALIEVEGQSGAGLVKVTMTCRNEVRRVAIDPSLLADDK-DMLEDL
Y1360_BURMA     ------------------------LALIEVEGQSGAGLVKVTMTCRNEVRRVAIDPSLLADDK-DMLEDL
Y434_NITEU      ------LMKQAQQMQENMKAMQEKLAAIEVEGQAGAGMVKVTMTCRYDVKRVNIDSSLIGDDK-EMXXXX
Y4227_KLEP3     ----------------------EEIAQLEVTGESGAGLVKVTINGAHNCRRVEIDPSXXXXXXXXXXXX-
Y371_HYPNA      -----------------------KIENTEADGVAGAGLVRVKLRGKGELISVTIDKSLMGDDP-EIVEDL
Y369_PHEZH      ------------------------IAEMEVEGTSGGGMVKLVLKGTGELARVDLDESLMAPGEGEVVADL
Y3038_LEGPC     -------------------------------GESGGGMVTIKMNGRHDVTEVKIKPTLMDED-IEMLEDL
Y2803_LEGPA     -------------------------------GESGGGMVTIKMNGRHDVTEVKIKPTLMDED-IEMLEDL
Y2755_LEGPH     -------------------------------GESGGGMVTIKMNGRHDVTEVKIKPTLMDED-IEMLEDL
Y2672_LEGPL     -------------------------------GESGGGMVTIKMNGRHDVTEVKIKPTLMDED-IEMLEDL
Y1934_CUPTR     ------------------------LAQIEVEGQSGAGLVKVVMTCKNDVKRVTIDPSLLAEEDKDLLEDL
Y482_BUCAI      ------------------------IAQMEVTGEAGAGLVKVTINGAHNCRRVEVDPSLLQDDK-DMLEDL
Y476_BUCAT      ------------------------IAQMEVTGEAGAGLVKVTINGAHNCRRVEVDPSLLQDDK-DMLEDL
Y475_BUCA5      ------------------------IAQMEVTGEAGAGLVKVTINGAHNCRRVEVDPSLLQDDK-DMLEDL
Y2216_TOLAT     ------------------------VAKMEVTGESGAGMVKITITGSHNVRRVTIDPSXXXXXXXXXXXXX
Y143_CORK4      -----------------LQRVQGEIAQSEISGSAGNGLVKVTMKGTGEVTNVTIDKSVVDPDDVDTLQDL
Y019_BACWK      -------------------KAQEELGEKTVEGTAGGGMVTVIASGHKQVLEVKIKEEVVDPEDIEMLQDL
YBAB_SALPK      ----------------------EEIAQLEVTGESGAGLVKVTINGAHNCRRVEIDPSXXXXXXXXXXXX-
YBAB_SALPA      ----------------------EEIAQLEVTGESGAGLVKVTINGAHNCRRVEIDPSXXXXXXXXXXXX-
Y1285_PELLD     ------MMKQIQQAGEKMQDVQKQLEKLVTSGEAGGGMVKVTVNGKQRVLSLWIDPEIM--DDAEMVQDL
Y028_MOOTA      ---------------AQVARLQEELGERTVEASAGGGVVKVTANGRQELVNIKIDPAAVDPEDVEMLQDL
Y4332_LEPIN     --EILSNMGSFRE---KMEEVKKRIASIRVVGDAGAGMVTVTASGEGQITNVFINKQLFDADDNKMLEDL
Y3475_LEPIC     --EILSNMGSFRE---KMEEVKKRIASIRVVGDAGAGMVTVTASGEGQITNVFINKQLFDADDNKMLEDL
Y1710_EXISA     -----------------MAKAQEELKELSVEGTAGGGMVKVVVSGHKEVLDVIIAEDVVDPDDVDMLQDL
Y1591_SHEHH     ----------------------EEIARMEVTGEAGAGLVKVTMTGSHSVRKVDIDASXXXXXXXXXXXX-
Y1509_SHEPA     ----------------------EEIARMEVTGEAGAGLVKVTMTGSHSVRKVDIDASXXXXXXXXXXXX-
Y1190_CHLCH     MPNLGDMMKQIQQAGEKMQEVQKQLERLVAHGEAGGGMVKATVSGKQKLLSLAIDPEIM--DDYEMVQDL
Y1717_SHEPW     ----------------------EEIARMEVTGEAGAGLVKVTMTGSHSVRKVDIDASXXXXXXXXXXXX-
Y3002_LEPBJ     LSELLSNMGALRE---KMEDVKKRIASIRVVGDAGAGMVTVTATGEGQIINVFINKQLFDSDDNKMLEDL
Y065_LEPBL      LSELLSNMGALRE---KMEDVKKRIASIRVVGDAGAGMVTVTATGEGQIINVFINKQLFDSDDNKMLEDL
Y4780_ALKMQ     ------------------EKTQAALEEKEVEASAGGGAITVKVSGKKEVISIEIKPEVVDPEDVEMLQDL
Y2678_CITK8     ------------------------IAKLEVTGESGAGLVKVTINGAHNCRRVEIDPSXXXXXXXXXXXX-
Y1034_PROVI     MPNLGDMMKQIQQAGAKMQDVQKQLEKTVTHGEAGGGMVKVSVNGRQRLLSLAIDPDIM--DDREMVQDL
Y048_RICBR      -------------------------------GKAGGGLVEIIATGKGEVEKVSIDASXXXXXXXXXXXXX
Y020_GEOSW      -----------------------------VEGTAGGGMVTVIANGHKQILEVKIKEEVVDPEDIEMLQDL
Y477_PARUW      -----GFSKKKKEIQQQMSLVQNELQNLEVVGVAGSGLVTITLTGDGEMKQVKIKPECVDVEDLEGLEML
Y1931_MYXXD     --DLNYFIRQANKLTEKIEERKQQLAEESVEAKAGDGRVTVVANGIQEIRSIKIDKEAIDPNDTSMLEDL
Y1311_SHEAM     ------------------------IARMEVTGESGAGLVKVTMTGTHNVRKVEIDPSXXXXXXXXXXXX-
Y116_BAUCH      -----------------------EIAKLEVNGESGAGLVKVTINGVYHCRRVEIDSSLLQDDK-DMLEDL
Y660_RICB8      -------------------------------GKAGGGLVEIIATGKGEVEKVSIDASXXXXXXXXXXXXX
Y513_FINM2      ------------------EETQKRLEETEVTATSGGGAIEVVANGKKEIVSIKIDEDLVKDGDVEMLQDM
Y2790_SYNFM     -------MQQVKALQDKMARMQEELALKTXXXXXXXXXXXXXXNGRQEVLSVKVDRQVVDPEDIEMLQDL
Y444_KLEP7      ---------------------------LEVTGESGAGLVKVTINGAHNCRRVEIDPSXXXXXXXXXXXX-
Y2224_CYAP7     IKELQEAFQKAQQVQEGAKQLQDELEQMSIEGHSSDGSVTVVMSGNQEPRSVTIQPTAL-EKGAEELSTL
Y2199_THEP3     -----------------------------VEATAGGGMVKAVANGRKELVSIEINPDVVDKDDVETLEDL
Y140_PROMH      ------------------------IANLEVTGESGAGLVKITINGAHNCRRVEIDPSXXXXXXXXXXXX-
Y074_CLOTE      ----------------------------KFQASVGGGAVTAIANGKKEIVDIRIKPEVVDPDDVEMLEDL
Y027_BACCQ      -------------------KAQEELGEKTVEGTAGGGMITVIANGHKQILXXXXXXXXXXXXXIEMLQDL
Y027_BACC7      -------------------KAQEELGEKTVEGTAGGGMITVIANGHKQILXXXXXXXXXXXXXIEMLQDL
Y027_BACC3      -------------------KAQEELGEKTVEGTAGGGMITVIANGHKQILXXXXXXXXXXXXXIEMLQDL
Y027_BACAC      -------------------KAQEELGEKTVEGTAGGGMITVIANGHKQILXXXXXXXXXXXXXIEMLQDL
Y027_BACAA      -------------------KAQEELGEKTVEGTAGGGMITVIANGHKQILXXXXXXXXXXXXXIEMLQDL
Y024_BACC0      -------------------KAQEELGEKTVEGTAGGGMITVIANGHKQILXXXXXXXXXXXXXIEMLQDL
Y021_BACC1      -------------------KAQEELGEKTVEGTAGGGMITVIANGHKQILXXXXXXXXXXXXXIEMLQDL
Y020_BACHK      -------------------KAQEELGEKTVEGTAGGGMITVIANGHKQILXXXXXXXXXXXXXIEMLQDL
Y020_BACCZ      -------------------KAQEELGEKTVEGTAGGGMITVIANGHKQILXXXXXXXXXXXXXIEMLQDL
Y020_BACAN      -------------------KAQEELGEKTVEGTAGGGMITVIANGHKQILXXXXXXXXXXXXXIEMLQDL
Y020_BACAH      -------------------KAQEELGEKTVEGTAGGGMITVIANGHKQILXXXXXXXXXXXXXIEMLQDL
Y2894_SYNJB     ---IQEALKKAQEVRDGAQRLQKELEEMEIVGEAGNGLVKVTVNGNQEPLKVSLDPQVLQE-SVDVVEDL
Y243_CLOCE      ------LMKQAQKMQKDMEKAQQDLENKTIEVSVGGGAINIVATGXXXXXXXXXXXXVVDPDDVEMLQDL
Y294_NOCFA      ----------------------------EVEGQAGGGLVKATIKATGEVQALTIDPKVVDPEDVEGLQDL
Y1369_SYNJA     ---IQEALKKAQEVRDGAQRLQKELEEMEIVGEAGNGLVKVTVNGNQEPLKVSLDPQVLQE-PVDVVEDL
Y1069_THEYD     ---------------------------MTVEATSGGGMVTVQANGAGEIVSIKIDREVVNPDDIEMLEDL
Y040_THETN      -----------------------------VEGTSGGGMVKAVANGRKELVSININPEVVDKDDVETLEDL
YBAB_SHISS      ---------------------------LEVTGESGAGLVKVTINGAHNCRRVEIDPSXXXXXXXXXXXX-
YBAB_SHIFL      ---------------------------LEVTGESGAGLVKVTINGAHNCRRVEIDPSXXXXXXXXXXXX-
YBAB_SHIF8      ---------------------------LEVTGESGAGLVKVTINGAHNCRRVEIDPSXXXXXXXXXXXX-
YBAB_SHIDS      ---------------------------LEVTGESGAGLVKVTINGAHNCRRVEIDPSXXXXXXXXXXXX-
YBAB_SHIBS      ---------------------------LEVTGESGAGLVKVTINGAHNCRRVEIDPSXXXXXXXXXXXX-
YBAB_SHIB3      ---------------------------LEVTGESGAGLVKVTINGAHNCRRVEIDPSXXXXXXXXXXXX-
YBAB_SALTY      ---------------------------LEVTGESGAGLVKVTINGAHNCRRVEIDPSXXXXXXXXXXXX-
YBAB_SALTI      ---------------------------LEVTGESGAGLVKVTINGAHNCRRVEIDPSXXXXXXXXXXXX-
YBAB_SALSV      ---------------------------LEVTGESGAGLVKVTINGAHNCRRVEIDPSXXXXXXXXXXXX-
YBAB_SALPC      ---------------------------LEVTGESGAGLVKVTINGAHNCRRVEIDPSXXXXXXXXXXXX-
YBAB_SALPB      ---------------------------LEVTGESGAGLVKVTINGAHNCRRVEIDPSXXXXXXXXXXXX-
YBAB_SALNS      ---------------------------LEVTGESGAGLVKVTINGAHNCRRVEIDPSXXXXXXXXXXXX-
YBAB_SALHS      ---------------------------LEVTGESGAGLVKVTINGAHNCRRVEIDPSXXXXXXXXXXXX-
YBAB_SALG2      ---------------------------LEVTGESGAGLVKVTINGAHNCRRVEIDPSXXXXXXXXXXXX-
YBAB_SALEP      ---------------------------LEVTGESGAGLVKVTINGAHNCRRVEIDPSXXXXXXXXXXXX-
YBAB_SALDC      ---------------------------LEVTGESGAGLVKVTINGAHNCRRVEIDPSXXXXXXXXXXXX-
YBAB_SALCH      ---------------------------LEVTGESGAGLVKVTINGAHNCRRVEIDPSXXXXXXXXXXXX-
YBAB_SALAR      ---------------------------LEVTGESGAGLVKVTINGAHNCRRVEIDPSXXXXXXXXXXXX-
YBAB_SALA4      ---------------------------LEVTGESGAGLVKVTINGAHNCRRVEIDPSXXXXXXXXXXXX-
YBAB_ESCF3      ---------------------------LEVTGESGAGLVKVTINGAHNCRRVEIDPSXXXXXXXXXXXX-
YBAB_ECOSM      ---------------------------LEVTGESGAGLVKVTINGAHNCRRVEIDPSXXXXXXXXXXXX-
YBAB_ECOSE      ---------------------------LEVTGESGAGLVKVTINGAHNCRRVEIDPSXXXXXXXXXXXX-
YBAB_ECOLU      ---------------------------LEVTGESGAGLVKVTINGAHNCRRVEIDPSXXXXXXXXXXXX-
YBAB_ECOLI      ---------------------------LEVTGESGAGLVKVTINGAHNCRRVEIDPSXXXXXXXXXXXX-
YBAB_ECOLC      ---------------------------LEVTGESGAGLVKVTINGAHNCRRVEIDPSXXXXXXXXXXXX-
YBAB_ECOL6      ---------------------------LEVTGESGAGLVKVTINGAHNCRRVEIDPSXXXXXXXXXXXX-
YBAB_ECOL5      ---------------------------LEVTGESGAGLVKVTINGAHNCRRVEIDPSXXXXXXXXXXXX-
YBAB_ECOK1      ---------------------------LEVTGESGAGLVKVTINGAHNCRRVEIDPSXXXXXXXXXXXX-
YBAB_ECOHS      ---------------------------LEVTGESGAGLVKVTINGAHNCRRVEIDPSXXXXXXXXXXXX-
YBAB_ECODH      ---------------------------LEVTGESGAGLVKVTINGAHNCRRVEIDPSXXXXXXXXXXXX-
YBAB_ECOBW      ---------------------------LEVTGESGAGLVKVTINGAHNCRRVEIDPSXXXXXXXXXXXX-
YBAB_ECO81      ---------------------------LEVTGESGAGLVKVTINGAHNCRRVEIDPSXXXXXXXXXXXX-
YBAB_ECO7I      ---------------------------LEVTGESGAGLVKVTINGAHNCRRVEIDPSXXXXXXXXXXXX-
YBAB_ECO5E      ---------------------------LEVTGESGAGLVKVTINGAHNCRRVEIDPSXXXXXXXXXXXX-
YBAB_ECO57      ---------------------------LEVTGESGAGLVKVTINGAHNCRRVEIDPSXXXXXXXXXXXX-
YBAB_ECO55      ---------------------------LEVTGESGAGLVKVTINGAHNCRRVEIDPSXXXXXXXXXXXX-
YBAB_ECO45      ---------------------------LEVTGESGAGLVKVTINGAHNCRRVEIDPSXXXXXXXXXXXX-
YBAB_ECO27      ---------------------------LEVTGESGAGLVKVTINGAHNCRRVEIDPSXXXXXXXXXXXX-
Y2800_ENTS8     ---------------------------LEVTGESGAGLVKVTINGAHNCRRVEIDPSXXXXXXXXXXXX-
Y260_CORDI      ----------------------REILATTVTGTAGNGLVSIDMQGNGMVSSVTIDPKVVDADDVETLQDL
Y1507_MANSM     ------------------------IAQLEVTGESGAGLVKVTINGAHNCRRVEIDPSXXXXXXXXXXXXI
Y1196_FRATN     ---------------------------MEVIGESGAGLVTVTMTGKYDVKSVSIDNSLMSEDK-EILEDL
Y034_THEPX      -----------------------------VEATVGGGMVKAVANGRKELVSIEINPAVVDKDDVETLEDL
YBAB_ECO8A      ---------------------------LEVTGESGAGLIKVTINGAHNCRRVEIDPSXXXXXXXXXXXX-
Y810_FRATT      ---------------------------MEVIGESGAGLVTVTMTGKYDVKSVSIDNSLMSEDK-EILEDL
Y810_FRAT1      ---------------------------MEVIGESGAGLVTVTMTGKYDVKSVSIDNSLMSEDK-EILEDL
Y1974_ACIBL     ------------------EELQKKMAQTVIEATAGGGSVTVKMNGQKQLLSIKIDPEVVKSGDVEMLQDL
Y1499_FRATF     ---------------------------MEVIGESGAGLVTVTMTGKYDVKSVSIDNSLMSEDK-EILEDL
Y1411_FRATH     ---------------------------MEVIGESGAGLVTVTMTGKYDVKSVSIDNSLMSEDK-EILEDL
Y1374_FRATO     ---------------------------MEVIGESGAGLVTVTMTGKYDVKSVSIDNSLMSEDK-EILEDL
Y1023_FRATM     ---------------------------MEVIGESGAGLVTVTMTGKYDVKSVSIDNSLMSEDK-EILEDL
YBAB_ECO24      ---------------------------LEVIGESGAGLVKVTINGAHNCRRVEIDPSXXXXXXXXXXXX-
Y772_COXBR      ------LMKNAKKIQEMMQKAQDELAKIRVTGESGAGMVKLTMTAQHEVVEMNLDDELLKESK-EVIEDL
Y666_COXBN      ------LMKNAKKIQEMMQKAQDELAKIRVTGESGAGMVKLTMTAQHEVVEMNLDDELLKESK-EVIEDL
Y656_COXBU      ------LMKNAKKIQEMMQKAQDELAKIRVTGESGAGMVKLTMTAQHEVVEMNLDDELLKESK-EVIEDL
Y1603_COXB1     ------LMKNAKKIQEMMQKAQDELAKIRVTGESGAGMVKLTMTAQHEVVEMNLDDELLKESK-EVIEDL
Y1351_COXB2     ------LMKNAKKIQEMMQKAQDELAKIRVTGESGAGMVKLTMTAQHEVVEMNLDDELLKESK-EVIEDL
Y951_ENT38      ---------------------------LEVTGESGAGLVKVTINGAHNCRRVEIDPSXXXXXXXXXXXX-
Y390_RHOE4      -----------------------------VTGQAGGGLVVATVKGTGEVVGLQIDPKVVDPEDVETLQDL
Y330_CHLCV      ---------EAKIMEQQFLEMEASLEQKRYEGQAGNGLVSVVINGKCDIVSIKVQPTCLDPEEPEVVEDL
Y2212_AERHH     ------------------------LAQMEVVGEAGAGMVKVTMAGSHSVRRIEIDPSLM-EDDKEMXXXX
Y1593_CALS8     ----------------------------EIEATAGGGAVKVVINGKKEIKSIEISPEVVDPDDIETLQDL
Y2473_ERWT9     ------------------------IAEMEVTGESGAGLVKVTINGAHSCRRVEVDPSXXXXXXXXXXXXV
Y2391_MICAN     ----------------------EELENMEIPGQSENGLVTVYLSGNQEPRGIEIDPALLSQD-LEIVAGS
Y672_CHLFF      ---------EAKIMEQQFLEMEASLEKKRYEGQAGNGLVSVVINGKCDIVSVKVQPTCLDPEEPEVIEDL
Y035_BACHD      ---------------------QEELKEKTVEATAGGGMVTVVASGDKRILDVRISEDVVDPDDVEMLQDL
Y701_BUCCC      ------LMEKAQVMKKEMEKIQKDIKMTKIKGESGAGLVTIFMNGNYNCRKTKINDEIWNEKNKILIQDL
Y533_PERMH      ------MMKMMKSMQENIEKAKEELRXXXXXXXXXXXXXXXXLNGLGEIKDVLIDKTLLTEDNHEILQDL
Y210_COREF      -----------------------------VVGDAANGLVTVTMSGSGEVTAVNIDPKVVDPEDVETLQDL
Y039_LYSSC      --------------------------AEQFEGVAGGGMVKVTVSGQREVVSVNLDESVVDPEDIEMLQDL
Y6705_RICAH     -------------------------------GKAGGGLVEIIITGKGEVAKISIXXXXXXXXXXXXXXXX
Y2855_ALKOO     ------------------EETQAQLEQKVLETSAGGGAVSIKITGKKEIVGISIKPEVVDPDDVEMLEDL
Y1847_SYNY3     IKELQEAFQKAQQVQEGAKVLQEELERMEIPGKSADGLVTVLMSGNQEPLSIEIDPSAL-EKGAEGLSAS
YAAK_BACSU      ----------------------EELAEKVVEGTAGGGMVTVKANGQKEILDVIIKEEVVDPEDIDMLQDL
Y120_FRAP2      ---------------------------MEVIGESGAGLVSVTMTGKYDVKKVTIDDSLMSEDK-EMLEDL
Y2555_FLAJ1     --DLMGMMGKLKETQQKIEDTKKRLDTVLIDEQSADGLLKITVTANRKVKSISIDDSLLEDKEQ--LEDY
Y1806_PSEPF     ------------------------LANAEVTGKAGGDLVTVVMTGRHDVKKVSIDPSVLXXXXXXXXXXX
Y5272_MYCSJ     ----------------------------EVHGQAGGGLVQVTMKGSGEVTSVAIDPKVVDPDDVETLQDL
Y4993_MYCSK     ----------------------------EVHGQAGGGLVQVTMKGSGEVTSVAIDPKVVDPDDVETLQDL
Y4904_MYCSS     ----------------------------EVHGQAGGGLVQVTMKGSGEVTSVAIDPKVVDPDDVETLQDL
Y039_CHLPN      ---------EAKIMEQQFLEMEASLLEKRYEGQAGNGLVSVVINGKCDLISVKVQPTCLDPEDPEVIEDL
Y1287_MYCGI     -----------------------------VHGQAGGGLVQVTMKGSGEVVGVSIDPKVVDPSDVETLQDL
Y1612_MARAV     -----------------------------VTGESGAGLVKVTMNGRHDVRKVDIDPSLLSEDK-EILEDL
Y690_SODGM      ------------------------IAQLEVTGESGAGLVKVTINGAHNCRRVEVDPSXXXXXXXXXXXXX
Y426_BUCBP      ------------------------VSEIEVTGESGAGAVKVTLIGSHYCKKIELDKNTILEHDKEILEDL
Y3761_ANADF     --DIQYLMRQAKKLEKAMADAKEQLAELSVEAESGGGLVKVTMNGKCEVTRLLVDPKAVDPADKAMLEDL
Y326_CHLAB      ------------EMEASLEKKHYE-------GQAGNGLVSIVINGKCDIVSVKVQPTCLDPEDPEVIEDL
Y2444_LACCB     ----------------------RELYATEFEGKSASDMVTVKFTGEKIMKDIQIKPEAIDPDDPDMLQDL
Y4556_STRAW     ---------------------QEELARTEVEGQAGGGLVKATVTGSGELRALVIDPKAVDPEDTETLADL
Y1796_GRAFK     --DMMGMMNKLKEAQEKVEATKKRLDTVLVDEQSSDGLLKITITANREVKNISIDDKLL-EDKEQLEDYL
Y038_BACSK      -----------------------------VEATVGGGMVTVIASGDKRILEVNISEDVVDPDDVEMLQDL
Y5528_MYCVP     -----------------------------VNGQAGGGLVQVTMRGSGEVVAVRIDPKVVDPSDVETLQDL
Y3619_STRCO     ----------------------EELARTEVDGQAGGGLVKATVTGSGELRGLVIDPKAVDPEDTETLADL
Y2831_LISMH     -----------------------DLEAQEFTGTAGGGMVTVKATGKRVITDVVINEEVVDPEDIEMLQDL
Y2703_LISMO     -----------------------DLEAQEFTGTAGGGMVTVKATGKRVITDVVINEEVVDPEDIEMLQDL
Y2683_LISMF     -----------------------DLEAQEFTGTAGGGMVTVKATGKRVITDVVINEEVVDPEDIEMLQDL
Y2677_LISMC     -----------------------DLEAQEFTGTAGGGMVTVKATGKRVITDVVINEEVVDPEDIEMLQDL
Y2851_LISIN     -----------------------DLEAQEFTGTAGGGMVTVKAIGKRVITDVVINEEVVDPEDIEMLQDL
Y1483_PEDPA     ---------------------QEKLNQTEFTGVAPDDMVKVVFTGDHRMKDIVINPEAIDEDDPDMLQDL
Y319_MYCA9      ----------------------------EVTGESGGGLVRITGKGSGEVTSVQIDPKIVDPEDVETLQDL
Y2654_LISW6     -----------------------DLEVQEFTGTAGGGMVTVKATGKRVITDVVINEEVVDPEDIEMLQDL
Y113_CAMLR      --DFSKMGELLTKAQEKANELEQEALKKEFSAKSGGGLVKVSANGKGEIIDINIDDSLL--EDKESMQIL
Y1136_SERP5     ------------------------VAKLEVTGESGAGLVKVTINGAHNCRRVEIDPSXXXXXXXXXXXXX
Y824_CLONN      -----------------------ELEEKEFVASAGGGAVTVKANGKKEILSINIEXXXXXXXXXEMLQDL
Y4210_RHOSR     -----------------------------VTGQAGGGLVTATVKGTGEVVGLKIXXXXXXXXXXETLQDL
Y4137_RHOOB     -----------------------------VTGQAGGGLVTATVKGTGEVVGLKIXXXXXXXXXXETLQDL
Y3446_CLOBB     ------------------EDMQKDLETKEFEXXXXXXXXXXXXXXKKEVKSINIKPEVVDPDDVEMLEDL
Y3225_CLOBA     ------------------EDMQKDLETKEFEXXXXXXXXXXXXXXKKEVKSINIKPEVVDPDDVEMLEDL
Y2358_BACLD     ---------------------QEELAEKVLEGTAGGGMVTVKVNGQXXXXXXXXXXXXXXXXXXXMLQDL
Y066_CAMFF      --DFSKMGEMLSEAQKKAAEFENEIAAKEFVAKSGGGLISVKANGRSQILDISIDDTLL--EDKESLQIL
Y4574_CAUSK     MKDLGGXXXXXXXXXXXXXXXXXRLAELTVEGTSGGGMVTVTLRGNGELAKVVLDESLIEPGEGEVIADL
Y607_FRATW      ---------------------------MEVIGESGAGLVTVTMTGKYDVKSVSIDNSLMSEDK-EILEDL
Y2143_CLOTH     --NINNLVKQAQKMQRDMERVQEELKEKXXXXXXXXXXXXXXXXXRKDIKEITIKPEVVDPDDVEMLQDL
Y020_PROM4      ----------------------EELDAMELEGKNQDGRVSICLSGNQLPLRIEIDPSILLEGK-EKAEIA
Y1174_PELPB     MPNLGDMMKQIQQAGEKMQDVQKQLEKIVAHGEAXXXXXXXXXXXXQKLLSLTIDPDIM--DDAEMVQDL
Y699_LACPL      -------------------------------GAAPDDMVKVTFTGDKKMKDITINPDAVDPDDVDMLQDL
Y492_ACIC5      ------------------------LAATVVEASSGGGAVSVKMNGKKELLKLTIDPAAVANPDVEMLEDL
Y1642_CAMJE     --DFSKMGELLNQVQEKAKNIELELANREFSAKSGAGLVKVSANGKGEIIDVSIDDSLL--EDKESLQIL
Y128_LACLM      ----------------------EEIANTTFVGKSAQDLVTVEFSGDRTLKSLNINPDVIDPEDPETLQDM
Y106_LACLS      ----------------------EEIANTTFVGKSAQDLVTVEFSGDRTLKSLNINPDVIDPEDPETLQDM
Y025_PROMM      ----------------------EELDAMEIEGSSPDGRASIWLSGNQQPLRVRIEPSLLAEGQ-DASETA
Y019_PROM1      ----------------------EELEVMEIEGTNDDNRAKIWMSGNQKPLRVEIDPSLLSEGKA-IIEEA
Y987_STRP2      -----------QKLQKQMEQSQAELAAMQFVGKSAQDLVQATLTGDKKVVSIDFNPAVVDPEDLETLSDM
Y1459_CHRSD     ----------------------------EVTGEAGAGMIKVTMNGRHDVSRVNVDPSVMXXXXXXXXXXX
Y1347_PROMT     ----------------------EELEVMEIEGTNDDNRAKIWMSGNQKPLRVEIDPSLLSEGKA-IIEEA
Y1195_STRPI     -----------QKLQKQMEQSQAELAAMQFVGKSAQDLVQATLTGDKKVVSIDFNPAVVDPEDLETLSDM
Y1178_STRPS     -----------QKLQKQMEQSQAELAAMQFVGKSAQDLVQATLTGDKKVVSIDFNPAVVDPEDLETLSDM
Y1174_STRP7     -----------QKLQKQMEQSQAELAAMQFVGKSAQDLVQATLTGDKKVVSIDFNPAVVDPEDLETLSDM
Y1149_STRZT     -----------QKLQKQMEQSQAELAAMQFVGKSAQDLVQATLTGDKKVVSIDFNPAVVDPEDLETLSDM
Y1108_STRZP     -----------QKLQKQMEQSQAELAAMQFVGKSAQDLVQATLTGDKKVVSIDFNPAVVDPEDLETLSDM
Y1102_STRPN     -----------QKLQKQMEQSQAELAAMQFVGKSAQDLVQATLTGDKKVVSIDFNPAVVDPEDLETLSDM
Y1041_STRZJ     -----------QKLQKQMEQSQAELAAMQFVGKSAQDLVQATLTGDKKVVSIDFNPAVVDPEDLETLSDM
Y1024_STRPJ     -----------QKLQKQMEQSQAELAAMQFVGKSAQDLVQATLTGDKKVVSIDFNPAVVDPEDLETLSDM
Y1021_STRP4     -----------QKLQKQMEQSQAELAAMQFVGKSAQDLVQATLTGDKKVVSIDFNPAVVDPEDLETLSDM
Y1010_STRR6     -----------QKLQKQMEQSQAELAAMQFVGKSAQDLVQATLTGDKKVVSIDFNPAVVDPEDLETLSDM
Y052_PELTS      -------------------RLQEELGNRTVESTXXXXXXXXXXNGRNEIVSIEIKPEALDPEDVEMLQDM
Y2554_CYAP8     -------LGKIKELQEXXXXXXXXXXXMEIEGFSEGKLVKVIMSGNQEPRSVTILPEALEKGADE-LSQL
Y2017_EUBE2     ---------------------------------------------KREVSKVKIDPEAVDPDDVEMLEDL
Y056_CLOPS      ---------------------------------------------------LNIKPEVVDPDDVEMLEDL
Y053_CLOP1      ---------------------------------------------------LNIKPEVVDPDDVEMLEDL
Y046_CLOPE      ---------------------------------------------------LNIKPEVVDPDDVEMLEDL
Y024_PROM3      ----------------------EELDAMEIEGSSPDGRASIWLSGNQQPLRVRLEPSLLAEGQ-DASETA
Y1366_SULSY     ------LMKQAQSIKENVEKAKEELKNEKIXXXXXXXXXXXXSDGLGTVLDLEIDKSLLNENEYPVLKDL
Y120_LACLA      ----------------------EEIANTTFVGKSAQDLVTVEFSGDRTLKSLDIKPDVIDPEDPETLQDM
Y834_CHLP8      ------MMKQLQEAGAKMQDVQKQLEKLVSEGEAGGGMVKAKVNGRQKLLELSIDPEI------------
Y1179_CHLPB     MPNFNDMMKQLQQAGAKMQDVQKQLEKITAVGDAGGGMVKATVSGKQKVLSIAIDPEIL--DDIEMVQD-
Y019_EXIS2      -----------------MAKAQEELKDLTVTGTAGGEMVSVVADGHKNXXXXXXXXXXXXXXXXXMIQDL
Y467_BUCAP      ------------------------IAKMEVTGEAGAGLVKVTINGAHNCRRVEVDPSXXXXXXXXXXXXX
Y3378_STRGG     ----------------------------EVDGQAGGGLVKATVTGSGELRALVIDPKAVDPEDTETLADL
Y315_CORGB      -----------------------------VVGNAGNGLVTVTMAGNGEVSAXXXXXXXXXXXXXXXLQDL
Y243_CORGL      -----------------------------VVGNAGNGLVTVTMAGNGEVSAXXXXXXXXXXXXXXXLQDL
Y1672_METI4     ------------------------MASLSFEGESGGGKVKATVNGEGFLLKMHVDPTLLEAKDNEMIEDL
Y1157_CHLT3     --DMSAMLKQVQQMSEKMQEAQKQLESMTAIGESGGGLVKAMANGKHEI--ISXXXXXXXXXXXXXXXXX
Y018_GEOKA      -------------------------------------------NGHKQILEVKIKEEVVDPDDIEMLQDL
Y805_CHLTE      ------MMKQLQEAGAKMQDLQKQLEKLVSEGEAGGGMVRAKVNGRQKLLELTIDPEI------------
Y270_STRPG      -----------QKLQKQMEQKQADLAAMQFTGKSAQDLVTATFTGDKKLVGIDFKEAVVDPEDVETLQDM
Y2128_RALME     ------------------------LAQIEVEGQSGAGLVKVVMTCKNDVKRVTIDPS-XXXXXXXXXXXX
Y2111_RALEJ     ------------------------LAQIEVEGQSGAGLVKVVMTCKNDVKRVTIDPS-XXXXXXXXXXXX
Y1606_STRP3     -----------QKLQKQMEQKQADLAAMQFTGKSAQDLVTATFTGDKKLVGIDFKEAVVDPEDVETLQDM
Y1591_STRP6     -----------QKLQKQMEQKQADLAAMQFTGKSAQDLVTATFTGDKKLVGIDFKEAVVDPEDVETLQDM
Y026_SYNPW      ----------------------EELDAMEIEGSSEDGRASIWLSGNQQPLRVKLDPSLLNEGQ-DTXXXX
Y1227_AKKM8     ---------------------QEKLASQTVTTEGAGGKLKVTATCDGNLTELVIDPSIIDPSDSEFLQEL
Y200_CAMHC      --DLSKMNEMLGDLQKKAQQMENENANREFSVKSGAGMVEIKISGKGEVLDVSIDDSLMSDK--DSLQIL
Y195_STRS2      -----------QKLQKQMEKSQAELAATQFTGSSVQDLVTATFTGDKKLVSIDFKADVVDADDLETLQEM
Y194_STRSY      -----------QKLQKQMEKSQAELAATQFTGSSVQDLVTATFTGDKKLVSIDFKADVVDADDLETLQEM
Y429_ARCB4      ------------QFQDMAKNAQNENASRIFTSKAGGGMVEISINGNSEVVDLKIDDSLL--EDKDSLQIL
Y017_GEOTN      -------------------------------------------NGHKQILEVKIKEEVVDPDDIEMLQDL
Y1774_ALCBS     -------------------------ANAEVVGESGAGLVKVTMNGRHDVKGVDIDPSLMSEDK-------
Y2780_ENTFA     ---------------------QEALNEKEFIGEATNQLVTATFTGDRTMKDLIIKEDVVDPEDVDMLQDL
Y1599_THET8     ------------------------------------GLVEVEANGHGKILALRLKPEALKQDDPEGLEDL
Y1235_THET2     ------------------------------------GLVEVEANGHGKILALRLKPEALKQDDPEGLEDL
Y159_MYCA5      --NINEMLKKAKRLQAEMEVEEKEIAKKEFVVKKQG--IKVVMLGTRKIKTIEISPALIDPEDPELVQDL
Y999_THELT      -----------QKMRDEIEKLENSFENIEVSSTSGGGAVKVTAKCNYEIVSIEYEDSLL--EDREMFNDL
Y462_BORBU      ----LDFLKNMSSVKNNIDNIKKEISKITVCGKAGSNIVTIEMDGEFNVKKVSINKEFFDDLDNDAFEQM
Y2278_SULNB     ---------------------------VEFTAKAGGGLIEVTANGAGEVIDMNIDDSLL--EDKESLQIL
Y1819_CAMC5     ----------------------------EFGAKSGGGLVSVKANGKGEILDITIDDSLL--EDKESLQIL
Y491_BORAP      ----LDFLKNMSSVKSNIDNIKKEMSKITVCGKAGSNIVTIEMDGEFNVKKVSINKEFFDDLDNDAFEQM
Y1791_STRA3     -----------QKLQKQMEQKQADLAASQFTGKSAQELVTVTFTGDKKLISIDYKEAVVDPEDIETLQDM
Y1770_STRA1     -----------QKLQKQMEQKQADLAASQFTGKSAQELVTVTFTGDKKLISIDYKEAVVDPEDIETLQDM
Y1747_STRA5     -----------QKLQKQMEQKQADLAASQFTGKSAQELVTVTFTGDKKLISIDYKEAVVDPEDIETLQDM
Y027_SYNSC      ---------KAQEIQQNAQALQDELDGMEIEGKSSDGRASVWLSGNQQPLRVRLDPALLQEGQ-------
Y020_PROMP      ---------KAKEIQQNAQKLQDELESMEIEGKSDDEMIKVWISGNQLPLRVEVNENISTANKEEI-EKN
Y019_PROM5      ---------KAKEIQQNAQKLQDELESMEIEGKSDDEMIKVWISGNQLPLRVEVKDTIAESNKEEI-EKN
Y126_CLOAB      ------LIKQAQKFQKQMEDMQKEIENKEFXXXXXXXXXXXXXXXXXXXXXXXXXXXVVDPDDVEMLQDL
Y043_DESRM      -----------------------------------------------EIISITIKPEAVDPDDVEMLQDL
Y462_BORHD      ----LDFLKNMTSFKDNIDNLKKEMSQIVVCGRAGSDVIVVEMNGEFLVKKVSIKEEFFSDLDNEALEHM
Y401_LACH4      ----------------------ENITAQEFTGKSADDLVVATFTGDRKLKDIKIDKEAIDPDDPDMLQDL
Y2277_STAS1     -----------------------------------------------EVLDVEIKEEAVDPDDIEMLQDL
Y1598_STRT2     ------------------EKSQAELAATTFTGKSAQDLVVAELTGDKKVVNITFADAVVDPDDVETLQDM
Y1598_STRT1     ------------------EKSQAELAATTFTGKSAQDLVVAELTGDKKVVNITFADAVVDPDDVETLQDM
Y1560_STRTD     ------------------EKSQAELAATTFTGKSAQDLVVAELTGDKKVVNITFADAVVDPDDVETLQDM
Y027_SYNPX      ---------KAQEIQQNAQALQDELDGMEIEGKSADGRASVWLSGNQQPLRVRLDPELLSAGQ-ETCEAA
Y048_HELAH      ---LSGLLDGVKKEFSQLEEKNKDTI---YTSKSGGGMVSVSFNGVGELVDLQIDDSLLEDKE-------
Y369_LACGA      ------------------------LATQEFVGKSADDMVVATFSGDRQLKDLKIDKEAIDPDDPDMLQDL
Y019_PROMS      -----------------------ELENMEIEGKSDDEMIKVWISGNQLPLKVEVQENIFNSNK-EQIEKN
Y521_STAAC      -----------------------------------------------EIKEEAVDP-----DDIEMLQDL
Y513_STAA2      -----------------------------------------------EIKEEAVDP-----DDIEMLQDL
Y500_STAA9      -----------------------------------------------EIKEEAVDP-----DDIEMLQDL
Y479_STAAM      -----------------------------------------------EIKEEAVDP-----DDIEMLQDL
Y478_STAAT      -----------------------------------------------EIKEEAVDP-----DDIEMLQDL
Y478_STAAR      -----------------------------------------------EIKEEAVDP-----DDIEMLQDL
Y476_STAA1      -----------------------------------------------EIKEEAVDP-----DDIEMLQDL
Y453_STAA3      -----------------------------------------------EIKEEAVDP-----DDIEMLQDL
Y444_STAA8      -----------------------------------------------EIKEEAVDP-----DDIEMLQDL
Y443_STAAE      -----------------------------------------------EIKEEAVDP-----DDIEMLQDL
Y437_STAAN      -----------------------------------------------EIKEEAVDP-----DDIEMLQDL
Y436_STAAS      -----------------------------------------------EIKEEAVDP-----DDIEMLQDL
Y434_STAAW      -----------------------------------------------EIKEEAVDP-----DDIEMLQDL
Y428_STAAB      -----------------------------------------------EIKEEAVDP-----DDIEMLQDL
Y2533_STAHJ     -----------------------------------------------EIKEEAVDP-----DDIEMLQDL
Y1729_PSYWF     -------------VEANVEKAKKELADKEVQAEAGNGLVKVTMTGRHVVKRLSXXXXXXXXXXXXXXXXX
Y030_OCEIH      -----------------------ELHEMTFEATAGGGMVTVKASGXXXXXXXXXXXXXXXXXXXXMLQDL
Y3778_MYCBT     -----------------------------------------------------IDPKVVDPDDIETLQDL
Y3776_MYCBP     -----------------------------------------------------IDPKVVDPDDIETLQDL
Y3753_MYCTA     -----------------------------------------------------IDPKVVDPDDIETLQDL
Y3743_MYCBO     -----------------------------------------------------IDPKVVDPDDIETLQDL
Y3716_MYCTU     -----------------------------------------------------IDPKVVDPDDIETLQDL
Y269_CAUCN      MKDLGGXXXXXXXXXXXXXXXXXRLAETTVDGTSGGGMVTVTLMGNGELVRVLMDESLVQPGEGEV----
Y268_CAUCR      MKDLGGXXXXXXXXXXXXXXXXXRLAETTVDGTSGGGMVTVTLMGNGELVRVLMDESLVQPGEGEV----
Y1634_LACDA     ------------------------ITTQEFTGKAADDMVVATFTGDRTLKSLFIKPEAIDPDDPDMLEDL
Y1514_LACDB     ------------------------ITTQEFTGKAADDMVVATFTGDRTLKSLFIKPEAIDPDDPDMLEDL
Y019_PROM2      -----------------------ELENMEIEGKSDDEMIKVWISGNQLPLKVEVQENILNADKEKIEKNI
Y424_LACJO      ------------------------LATQEFVGKAADDMVVATFSGDRKLKDLKINKEAIDPDDPDMLQDL
Y332_HELHP      MFDAKQLGAMLGSMQDTIKDLQERNEQTILSAKSGGGLVSVSCNGNGEV--XXXXXXXXXXEDKESLQIL
Y031_HELP2      -----GLLDGMKKEFSQLEEKNKDTIHTS---KSGGGMVSVSFNGMGELVDLQIDDSLLEDKE-------
Y020_PROM9      -----------------------ELENMEIEGESDDEMVKVWISGNQLPLRVEVQENILNSDKEKIEQNI
Y019_PROM0      -----------------------ELENMEIEGKSDDEMIKVWISGNQLPLKVEVQENFLNADK-EKIEQN
Y326_STRSV      ---------------------QAELAATEFTGKSAQDLVVAKLTGDKKVVSIDFNPAVVDPEDLETLSEM
Y317_MYCPA      -----------------------------------------------------IDPSVVDPSDVETLQDL
Y175_HELPS      -----GLLDGMKKEFSQLEEKNKDTIHTS---KSGGGMVSVSFNGVGELVDLQIDDSLLEDKE-------
Y035_HELPY      -----GLLDGMKKEFSQLEEKNKDTIHTS---KSGGGMVSVSFNGLGELVDLQIDDSLLEDKE-------
Y033_HELPH      -----GLLDGMKKEFSQLEEKNKDTIHTS---KSGGGMVSVSFNGVGELVDLQIDDSLLEDKE-------
Y612_CHLMU      ---------EAKLMERQFMEMEASLEQKRFSGEAGNGLVSVTINGKCNLVDVKIKPDCLDPEDPEVV---
Y2330_MYCLE     -----------------------------------------------------IDPKVVDPGDIETLQDL
Y2330_MYCLB     -----------------------------------------------------IDPKVVDPGDIETLQDL
Y589_CHLT2      ---------EAKLMERQFMEMEASLEQKRFSGEAGNGLVSVTINGKCDLVDVRIKPDCLDPEDPEVV---
Y586_CHLTB      ---------EAKLMERQFMEMEASLEQKRFSGEAGNGLVSVTINGKCDLVDVRIKPDCLDPEDPEVV---
Y363_CHLTA      ---------EAKLMERQFMEMEASLEQKRFSGEAGNGLVSVTINGKCDLVDVRIKPDCLDPEDPEVV---
Y335_CHLTR      ---------EAKLMERQFMEMEASLEQKRFSGEAGNGLVSVTINGKCDLVDVRIKPDCLDPEDPEVV---
Y1926_STRP8     -----------------------DLAAMQFTGKSAQDLVTATFTGDKKLVGIDFKEAVVDPEDVETLQDM
Y1862_STRP1     -----------------------DLAAMQFTGKSAQDLVTATFTGDKKLVGIDFKEAVVDPEDVETLQDM
Y1647_STRPD     -----------------------DLAAMQFTGKSAQDLVTATFTGDKKLVGIDFKEAVVDPEDVETLQDM
Y1638_STRPF     -----------------------DLAAMQFTGKSAQDLVTATFTGDKKLVGIDFKEAVVDPEDVETLQDM
Y1605_STRPB     -----------------------DLAAMQFTGKSAQDLVTATFTGDKKLVGIDFKEAVVDPEDVETLQDM
Y1585_STRPC     -----------------------DLAAMQFTGKSAQDLVTATFTGDKKLVGIDFKEAVVDPEDVETLQDM
Y1568_STRPM     -----------------------DLAAMQFTGKSAQDLVTATFTGDKKLVGIDFKEAVVDPEDVETLQDM
Y857_RICTY      ----------------------------------------------------------------------
Y254_SACEN      ---------------------------------------TAVVSGSGELKSVAIDPKAVDPDDTDTLSDL
Y032_HELPG      --------------------------------KSGGGMVSVSFNGLGELVDLQIDDSLLEDKE-------
Y031_HELPJ      --------------------------------KSGGGMVSVSFNGLGELVDLQIDDSLLEDKE-------
PGK_LEUCK       VRPFVAIIGGAK-VSDKIEIVKSLLAKAD-KVIVGGGMAYTFDAAKGE----KIGNSLFEADKVELAKEL
Y205_PROAC      ------------------------------EGTAGGGLVRATVTGTGELDALTIAPEALEDTDAE-----


                         .         .         *         .         .         .         .:140
query           IVAAHKDAKEKGEAQAQEKMADLTAGLPLPPGMKLPF
Y095_AGRT5      IVAAHKDAKEKGEAQAQEKMADLTAGLPLPPGMKLPF
Y231_RHIME      IVXXXXXXXXXXXXVQAEKTRELTAGLPIPPGMKLPF
Y275_METSB      IITAHEDARKKAERLMEEKMQGVTAGLALPPGMKLPF
Y5504_RHILO     XXAAHNDAKAKVEQIMQEKTKALTSGLPIPPGMKLPF
Y260_GRABC      IVAAHNDAKKKIETMAAEEMQKVTGGLNLPAGMKLPF
Y033_BRUMB      XXAAHNDGKAKLEAAMAEKTQSLTAGLPIPPGFKLPF
Y3472_RHORT     IVAAFNDAKAKVDEMVKEKMSELTGGLKLPPGMSLPF
Y1439_BORBR     VAAAFNDALRKAEATSQEKMASVTAGMPLPPGMKLPF
Y1222_BORPA     VAAAFNDALRKAEATSQEKMASVTAGMPLPPGMKLPF
Y7345_BRASB     LVTAHGDARRKAEAAMQEKMQAIT-------------
Y2329_JANMA     VAAAFNDAVRKAEATSQEKMSGVTAGMPLPPGFKMPF
Y915_BORA1      VAAAFNDALRKAEATSQEKMSALTAGLPLPPGMKLPF
Y1975_LEPCP     VAAAFNDAVRRAEAVSQEKMGKLTAGMPLPPGMKFPF
Y1550_BORPE     VAAAFNDALRKAEATSQEKMASVTAGMPLPPGMKLPF
Y231_HALHL      VAAAVNDAVQKVQRESQERMSGMAEGMGLPPGMKLPF
Y620_RHOPT      LVAAHGDAHRKAEAAMQEKMQALT-------------
Y3467_GLUDA     IVAACADARKLLDERASEEMKKVTGGMNLPAGLKFPF
Y1984_AZOVD     IAAAVNDAVRKIEQNNQEKMAGMTAGMGLPPGFKMPF
Y603_GLUOX      IVAAYXXXXXXXXXXXXXXMRDVTGGLDLPAGLKLPF
Y858_STRM5      IAAAFNDASNKIDAESKSKMGSATAGMQLPPGMKLPF
Y7544_OLICO     LVAAQNDARRKAEEAMQERMKALTGGLSIP-------
Y616_RHOPA      LAAAHGDAHRKAEAAMQEKMQALT-------------
Y290_BRUA1      XXAAHNDXXXXXXXXXXXXTQSLTAGLPIPPGFKLPF
Y1909_BRUME     XXAAHNDXXXXXXXXXXXXTQSLTAGLPIPPGFKLPF
Y1015_STRMK     IAAAFNDASNKIDAESKSKMGSATAGMQLPPGMKLPF
Y035_BRUSI      XXAAHNDXXXXXXXXXXXXTQSLTAGLPIPPGFKLPF
Y034_BRUC2      XXAAHNDXXXXXXXXXXXXTQSLTAGLPIPPGFKLPF
Y033_BRUSU      XXAAHNDXXXXXXXXXXXXTQSLTAGLPIPPGFKLPF
Y033_BRUO2      XXAAHNDXXXXXXXXXXXXTQSLTAGLPIPPGFKLPF
Y033_BRUAB      XXAAHNDXXXXXXXXXXXXTQSLTAGLPIPPGFKLPF
Y030_BRUA2      XXAAHNDXXXXXXXXXXXXTQSLTAGLPIPPGFKLPF
Y1999_ACICJ     IVAAHRDAKSRLETLAAEEMQKVTGGISLPPGMKLPF
Y1981_DICT6     IAAALRDALTKAKEKSAEKMGSLADGLPLPPGL----
Y764_BRASO      LVTAHGDARRKAEAAMQEKMQAIT-------------
Y3552_BORPD     VAAAFNDALRKVESTSQEKMASVTAGMPLPAGMKLPF
Y258_DICTD      IAAALRDALTKAKEKSAEKMGSLTDGLPLPPGL----
Y3358_XANCB     IAAAFNDASNKIDAESKERMGSATAGMQLPPGMKLPF
Y3243_XANC8     IAAAFNDASNKIDAESKERMGSATAGMQLPPGMKLPF
Y2533_MARMS     IAAAVNDAVRNIEVTQKEKMAAATAGMSLPPGFKMPF
Y231_BARHE      IMAAYNEAKTKIEIAMQEKTKSMTAGLPLPPDFKLPF
Y1002_XANCP     IAAAFNDASNKIDAESKERMGSATAGMQLPPGMKLPF
Y257_BART1      IMAAYNEARAKIDNALEEKTKSMTAGLPLPSGFKLPF
Y1128_XANC5     IAAAFNDASNKIDAESKDRMGSATAGMQLPPGMKLPF
Y1110_XANAC     IAAAFNDASNKIDAESKDRMGSATAGMQLPPGMKLPF
Y965_XANOM      IAAAFNDASNKIDAESKDRMGSATAGMQLPPGMKLPF
Y3086_VIBHB     IAAAFNDAARRVEETQKEKMASVTGGMQLPPGMKMPF
Y1808_XYLFA     IAAAFNDASNKVDTESKERMGSATLGMSLPPGFKLPF
Y1065_XANOR     IAAAFNDASNKIDAESKDRMGSATAGMQLPPGMKLPF
Y368_NITWN      VVTALADARRKAEVAMQEKMQALT-------------
Y639_AZOSE      LAAAVNDAVRRVETTTQEKMAGFTSGLNLPPGMKLPF
Y2178_VIBPA     IAAAFNDAARRVEETQKEKMASVTGGMQLPPGMKMPF
Y1216_XYLFM     IAAAFNDASNKVDAESKERMGSATLGMSLPPGFKLPF
Y1122_XYLF2     IAAAFNDASNKVDAESKERMGSATLGMSLPPGFKLPF
Y1058_XYLFT     IAAAFNDASNKVDAESKERMGSATLGMSLPPGFKLPF
Y1055_VIBCH     IAAAFNDAARRIEETQKEKMASITGGMQLPPGMKMPF
Y2410_VIBVY     IAAAFNDAARRVEETQKEKMAAITGGMQLPPGMKMPF
Y2004_VIBVU     IAAAFNDAARRVEETQKEKMAAITGGMQLPPGMKMPF
Y022_OCHA4      XXAAHNDXXXXXXXXXXXXTQSLTAGLPIPPGFKLPF
Y2614_HAHCH     LAAAVNDAVRKVEKNNQDKMSNMTAGLGIPPNFKMPF
Y219_BARQU      IMAAHNDAKTKIEIAMEEKTKSMTAGLPLPSGFKFPF
Y1239_BARBK     IMAAHNEAKEKISTAMAEKTQNITAGLPIPPGFKLPF
Y463_NITHX      VVSALGDARRKAEVAMQEKMQALT-------------
Y436_MARMM      LKAAHADARRKGEEAQQDIMKDAAGGLQLPPGMQMPF
Y255_BEII9      VALAYENARHQAEQIMEEKMREVTGGMQLP-------
YUD3_BRAJA      LVTALGDARRKAEAAVQEKM-----------------
Y4812_RHOP5     LVSALADAHRKAEAAMQDKM-----------------
Y2594_NITOC     VAAAINDAVRQVETQSKEKMSSMTSGM-LPPGFKLP-
Y4847_RHOPB     LVTALADAHRKAESAMQEKMQALT-------------
Y1202_PSEHT     LAAACNDAVRRVADETQERMGKVTGGMQLPPGMKMPF
Y591_NITEC      VAAAMNDAVRRVEAATQEHMASVTSGLGLPAGMKFPF
Y1611_CHRVO     IAAAFNDAVRKVEATTQERMSGFTNGLNLPAGMKFPF
Y917_VIBSL      IAAAFNDAARRVEETQKEKMAGVTGGMQLPPGMKMPF
Y2533_METPP     XXXXXXXXXXXXXXTSEEKMGKLTAGMPLPPGMKLPF
Y2014_SHEON     IAAACNDAARIIEENQKAKMAEVTGGMQLPPGMKMPF
Y1905_PSEF5     FAAAVNDAVRKIESNSQEKMSGMTAGMQLPPGMKLPF
Y1098_ALTMD     VAAAFNDAVRRVQETSKEKMGDVTGGMPLPPGFKMP-
Y3498_GLOVI     LLTAYKDAYTKSAETMKAKMQELTGGMELPPGL----
Y308_HAES2      IAAAFNDAVRRAEEMQKEKMASVTAGMSLPPGFKMPF
Y2276_PSYIN     IAAAMNDAVHRIGEVNKNKMSGVSGGMELPPGFKMPF
Y1509_ALHEH     VAAAFNDAVHKLEQESQQRMAGLSEGMNLPSGFKLPF
Y1309_HAES1     IAAAFNDAVRRAEEMQKEKMASVTAGMSLPPGFKMPF
Y780_HAEIE      IAAAFNDAVRRAEELQKEKMASVTAGMPLPPGMKFPF
Y5435_HAEIG     IAAAFNDAVRRAEELQKEKMASVTAGMPLPPGMKFPF
Y442_HAEIN      IAAAFNDAVRRAEELQKEKMASVTAGMPLPPGMKFPF
Y2380_SHEDO     IAAACNDASRRIEENQKNKMAEVTGGMQLPPGMKMPF
Y075_ACTPJ      VAAAFNDAVRRAEEMQKEKMASVTAGMQLPPGMKFPF
Y075_ACTP7      VAAAFNDAVRRAEEMQKEKMASVTAGMQLPPGMKFPF
Y075_ACTP2      VAAAFNDAVRRAEEMQKEKMASVTAGMQLPPGMKFPF
Y3840_PHOLL     IAAAFNDAARRIEETQKEKMAGISSGMQLPPGFKMPF
Y1920_ACIF2     VAAAINDAVRTAEKVSAERMSEVTGGMNI-PGMNLPF
Y1592_ACIF5     VAAAINDAVRTAEKVSAERMSEVTGGMNI-PGMNLPF
Y3586_PSEPW     IAAALNDAVRKVEQSSQEKMGGMTAGMQLPPGFKMPF
Y1046_HERAR     VAAAFNDAVRKAEATSQEKMAGATA------------
Y4268_PSEPK     IAAALNDAVRKVEQSSQEKMGGMTAGMQLPPGFKMPF
Y3833_PSEPG     IAAALNDAVRKVEQSSQEKMGGMTAGMQLPPGFKMPF
Y1796_BURM1     VAAAFNDAVRKAEATSQEKMSGMTS------------
Y1600_PSEP1     IAAALNDAVRKVEQSSQEKMGGMTAGMQLPPGFKMPF
Y1040_HAEPS     VAAAFNDAVRRADEMQKEKMASVTAGMQLPPGMKFPF
Y2646_PSEMY     IAAAVNDAVRKVEQNSQEKMAGMTAGMQLPPGFKMPF
Y1036_RALPJ     IAAAFNDAVRKAEATTQEKMGSLTS------------
Y701_POLSQ      IVTAYTEAFKQVEAASTQLMSGATAGMPMPPGFKLPF
Y645_POLNS      IVTAYTEAFKQVEAASAQMMSGATAGMPMPPGFKLPF
Y4577_PSEFS     FAAAVNDAVRKIEANSQEKMGGVTAGMQLPPGMKLPF
Y3645_PSESM     IAAAVNDAVRKIEQASQDKTASMTAGMQLPPGMKLPF
Y2406_SHEFN     IAAACNDAARRIEENQKTKMAEVTGGMQLPPGMKMPF
Y1826_PSEU2     IAAAVNDAVRKIEQASQDKTASMTAGMQLPPGMKLPF
Y1786_PSE14     IAAAVNDAVRKIEQASQDKTASMTAGMQLPPGMKLPF
Y3092_YERE8     IAAAFNDAARRIDETQKEKMASVSSGMQLPPGFKMPF
Y205_PASMU      IAAAFNDAVRRAEELQKEKMASVTAGMALPPGFKMPF
Y993_YERPS      IAAALNDAARRIDETQKEKMASVSNGMQLPPGFKMPF
Y967_YERPN      IAAALNDAARRIDETQKEKMASVSNGMQLPPGFKMPF
Y326_HAEDU      VAAAFNDAVRRAEDLQKEKMASVTSGMQLPPGMKLPF
Y3197_YERPY     IAAALNDAARRIDETQKEKMASVSNGMQLPPGFKMPF
Y3121_YERPE     IAAALNDAARRIDETQKEKMASVSNGMQLPPGFKMPF
Y3058_YERP3     IAAALNDAARRIDETQKEKMASVSNGMQLPPGFKMPF
Y2890_YERPG     IAAALNDAARRIDETQKEKMASVSNGMQLPPGFKMPF
Y2758_YERPP     IAAALNDAARRIDETQKEKMASVSNGMQLPPGFKMPF
Y2615_YERPA     IAAALNDAARRIDETQKEKMASVSNGMQLPPGFKMPF
Y1810_VIBFM     IAAAFNDASRRIEETQKEKMASVTGGMQMPPGFKMPF
Y1686_VIBF1     IAAAFNDASRRIEETQKEKMASVTGGMQMPPGFKMPF
Y1036_YERPB     IAAALNDAARRIDETQKEKMASVSNGMQLPPGFKMPF
Y1429_DESPS     VTAATNDGLRRAKDLSKQEMGQLTGGMNLP-------
Y1109_EDWI9     VAAAFNDAARRIESEQKERMASVSSGMQLPPGFKMPF
Y086_RHOPS      LVXXXXXXXXXXXXXMQEKMQALT-------------
Y1789_PSEE4     IAAALNDAVRKIEQNSQDKMGSMTAGMQLPPGFKMPF
Y807_DECAR      IAAALNDAVRRGEALSKDKMSGFTSGLNLPPGFKLPF
Y4462_PSEAB     IAAAVNDAVRKIEQNNQEKMSGFTSGMQLPPGFKMPF
Y3795_PSEA8     IAAAVNDAVRKIEQNNQEKMSGFTSGMQLPPGFKMPF
Y1533_PSEAE     IAAAVNDAVRKIEQNNQEKMSGFTSGMQLPPGFKMPF
Y1086_ALISL     IAAAFNDASRRIEETQKERMAGVTGGMQMPPGFKMPF
Y2301_SHEPC     IAAACNDAARRIEENQKAKMAEVTGGMQLPPGMKMPF
Y1770_SHEB2     IAAACNDAARRIEENQKTKMAEVTGGMQLPPGMKMPF
Y1707_SHESW     IAAACNDAARRIEENQKAKMAEVTGGMQLPPGMKMPF
Y1365_RICFE     IKVAFNDAKQKCDEDSQNSLSGALNGMSLPPGFKMPF
Y1657_NEIMA     ILAALKSARDKAEETANKTMGAFTQG--LPPGV----
Y1192_RALSO     VAAAFNDAVRKAEATTQEKMGTVTSGLMLPPGFKLPF
YGG0_WIGBR      IVAAFNDAIRRISEIQQEKIASVSSSIQIPEGFKMPF
Y7555_RICPU     IKVAFNDAQQKCDEDSQNSLSGALNGMRLPPGFKMPF
Y3743_COLP3     LAAAVNDAVRRVEEQNKDKMGALTGGMQLPPGMKMPF
Y1337_RICCN     IKVAFNDAQQKCDEDSQNSLSGALNGMRLPPGFKMPF
Y1224_RICAE     IKVAFNDAQQKCDEDSQNSLSGALNGMRLPPGFKMPF
Y997_ACTSZ      IAAAFNDAVRRAEEMQKEKMASVTAGMSLPPGFKMPF
Y866_RICPR      IKVAFNDAKQKCDEDSQNSLSGALNGMSLPPGFKIPF
Y1444_NEIMB     ILAALKSARGKAEETANKTMGAFTQG--LPPGV----
Y1380_NEIMF     ILAALKSARGKAEETANKTMGAFTQG--LPPGV----
Y1355_NEIM0     ILAALKSARDKAEETANKTMGAFAQG--LPPGV----
Y1967_ACIBY     IAAAVNDAVRQAEVVSEEKMQKANSGMGLPPGL----
Y1914_ACIBS     IAAAVNDAVRQAEVVSEEKMQKANSGMGLPPGL----
Y1909_ACIB5     IAAAVNDAVRQAEVVSEEKMQKANSGMGLPPGL----
Y1813_ACIB3     IAAAVNDAVRQAEVVSEEKMQKANSGMGLPPGL----
Y1718_ACIBC     IAAAVNDAVRQAEVVSEEKMQKANSGMGLPPGL----
Y1684_ACIBT     IAAAVNDAVRQAEVVSEEKMQKANSGMGLPPGL----
Y799_PSYCK      IAAAINDAVRQADALYEETMAGATSGMGLPPGMQ---
Y7310_RICRS     IKVAFNNAQQKCDEDSQNSLSGALNGMRLPPGFKMPF
Y5067_ANASP     VTAAMKDAYIKSTATMRERMEDLTSGLELP-------
Y1848_IDILO     IAAATNDAVRRVEETSKERMSEITGGMGLPPGFKMPF
Y1562_RICRO     IKVAFNNAQQKCDEDSQNSLSGALNGMRLPPGFKMPF
Y558_CHLSY      LLVAINDASRKAQQLAEERMQPLTGGL----------
Y522_CHLAA      LLVAINDASRKAQQLAEERMQPLTGGL----------
Y1912_CORU7     IIGAFQDANQKLQDLAQEKM-----------------
Y742_NEIG1      ILAALKSARGKAEETANKTMGAFTQ--DLPPGV----
Y723_THEEB      VTAAMRDAYQKSTATMRERMEELTGSLNVP-------
Y1136_NEIG2     ILAALKSARGKAEETANKTMGAFTQ--DLPPGV----
Y2322_ANAVT     VTAAMKDAYIKSTATMRERMEDLTSGLELP-------
Y1327_METCA     IAAAFNDGVRRVAKLKQEKMAGLTGSLGIPPGFNLPF
Y2292_ROSCS     IVAAITDASKKAQELAEQRLGPLAGGMKLP-------
Y1534_ROSS1     IVAAIADASKKAQELAEQRLGPLAGGMKLP-------
Y448_NOSP7      VTVAMKEAYNKSTATMRERMEELTSGLELP-------
Y3694_ANASK     VTAAVNAAVEKARTAADESMSKATGGIKIP-------
Y3636_ANADE     ITAAVNAAVEKARTAADESMSKATGGIKIP-------
Y793_PSYA2      IAAAINDAVRQADELYETTMAGATSGMGLPPGMQ---
Y3777_ANAD2     VTAAVNAAVEKARTAADESMSKATGGIKIP-------
Y2305_RHOCS     XXAAFNDAKNKVEAHMAEETAKLMGGLKLPPGFKLPF
Y5550_RICCK     IKVAFNDAKQKCDEDSQNSLSGALNGINLPPGFKMPF
Y667_RHOP2      XXXXXXXXHRKAEAAMQEKMQALT-------------
Y4104_MAGSA     ILAAFNDXXXXXXXXXXXXXXXXTGGLNLPPGFKLPF
Y3826_CLOK5     VLTACNQALKSAEDQTASEMKKLTGGLNIP-------
Y3200_CHLAD     LLVAINDASRKAQQLAEERMQPLTGGL----------
Y464_SYNE7      VAAAMKDAYQKSTAAMKEKMEALTAGLGIP-------
Y329_EUBR3      IMAATNEALRQIDEQSQASMSKITGGL----------
Y2087_AERS4     XXXXXXXXXXXXEEQSKSKMGELTGGMQLPPGMKLPF
Y1143_ANATD     IVACVNEAIRKVDKMVEEEMQKVTGGIP---------
Y1054_SYNP6     VAAAMKDAYQKSTAAMKEKMEALTAGLGIP-------
Y019_BACCN      VLAATNDALKKAEELSNATMGQFTKGLNLPGGL----
Y5293_BACC2     VLAATNDALKKADELSNSTMGKFTKGLNLPGGM----
Y1113_GEMAT     IVXXXXXXXXXXXXXXXXXLQKVTGGIDLP--FKLPF
Y025_BACCR      VLAATNDALKKADELSNSTMGKFTKGLNLPGGM----
Y025_BACC4      VLAATNDALKKADELSNSTMGKFTKGLNLPGGM----
Y899_CYAP4      VTAAMKDAYLKSXXXXXXXXXXLTGGLSLP-------
Y2234_SHELP     IAAACNDAARRVEESQKEKMAEVTGGMQLPPGMKMPF
Y2011_CORJK     LLGAFKDANQKLQTLAEEKMGPLSQGM----------
Y017_CLOD6      VLSAVNQALRNIDDIQASQMSKVTGGMNIP-------
Y952_BURP8      VAAAFNDAVRKAEATAQEKMGGMTS------------
Y2072_BURXL     VAAAFNDAVRKAEATAQEKMGGMTS------------
Y1827_BURPP     VAAAFNDAVRKAEATAQEKMGGMTS------------
Y1171_CHLPD     VIAAVNSALDEAAKVAQEELVKVTGGMMNP-------
Y1177_ERWCT     XXXXXXXXXXXXXETQKEKMATVSSGMQLPPGFKMPF
Y6253_BURCA     VAAAFNDAVRKAEATSQEKMSGMTS------------
Y5127_BURS3     VAAAFNDAVRKAEATSQEKMSGMTS------------
Y199_DEIRA      ILAAINDAAEKAEGLQRE----ATAGLGLP-------
Y1861_BURCJ     VAAAFNDAVRKAEATSQEKMSGMTS------------
Y1850_BURCC     VAAAFNDAVRKAEATSQEKMSGMTS------------
Y1826_BURCH     VAAAFNDAVRKAEATSQEKMSGMTS------------
Y1077_PECCP     XXXXXXXXXXXXXETQKEKMAAVSSGMQLPPGFKMPF
Y3650_BURMS     VAAAFNDAVRKAEATSQEKMSGMTS------------
Y3622_BURM7     VAAAFNDAVRKAEATSQEKMSGMTS------------
Y2851_SHESH     IAAACNDAARRVEENQKERMAEVTGGMQLPPGMKMPF
Y2372_BURP1     VAAAFNDAVRKAEATSQEKMSGMTS------------
Y2346_BURM9     VAAAFNDAVRKAEATSQEKMSGMTS------------
Y2243_BURP0     VAAAFNDAVRKAEATSQEKMSGMTS------------
Y2220_BURTA     VAAAFNDAVRKAEVTSQEKMSGMTA------------
Y2205_BURP6     VAAAFNDAVRKAEATSQEKMSGMTS------------
Y1794_SHEWM     IAAACNDAARRVEENQKDKMAEVTGGMQLPPGMKMPF
Y1764_BURCM     VAAAFNDAVRKAEATSQEKMSGMTS------------
Y1753_BURVG     VAAAFNDAVRKAEATSQEKMSGMTS------------
Y1737_BURA4     VAAAFNDAVRKAEATSQEKMSGMTS------------
Y1499_BURPS     VAAAFNDAVRKAEATSQEKMSGMTS------------
Y1360_BURMA     VAAAFNDAVRKAEATSQEKMSGMTS------------
Y434_NITEU      XXXXXXXXXXXXXTVTQEKMASVAGGLGLPAGMKFPF
Y4227_KLEP3     VAAAFNDAARRIEETQKEKMASVSAGMQLPPGFKMPF
Y371_HYPNA      IKAAHSDARKRLDQAMEDAMKTATAGFGMLPGFKLPF
Y369_PHEZH      IVAAHADAKRKLDEKQAEVMREAAGPFAGMPGM----
Y3038_LEGPC     IAAAVNDAVRKIEKASKEKISQLTAGLNIP-------
Y2803_LEGPA     IAAAVNDAVRKIEKASKEKISQLTAGLNIP-------
Y2755_LEGPH     IAAAVNDAVRKIEKASKEKISQLTAGLNIP-------
Y2672_LEGPL     IAAAVNDAVRKIEKASKEKISQLTAGLNIP-------
Y1934_CUPTR     VAAAFNDAVRKAEATTQEKMGSMTS------------
Y482_BUCAI      AAAAFNDATRRISEVQKKKMSAISTGMQLPNGFNMP-
Y476_BUCAT      AAAAFNDATRRISEVQKKKMSAISTGMQLPNGFNMP-
Y475_BUCA5      AAAAFNDATRRISEVQKKKMSAISTGMQLPNGFNMP-
Y2216_TOLAT     IAAAFNDAVRRAEEQNKAKMAEITGGMQLPPGFKMPF
Y143_CORK4      VLGALQDANTALQSYAQEKMGPFSQAL----------
Y019_BACWK      VLAATNDALKKVDELSNSTMGKFTKGMNLPGGM----
YBAB_SALPK      VAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF
YBAB_SALPA      VAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF
Y1285_PELLD     VLAAVNSALEASGRMAQEEISKVAGGMINP-------
Y028_MOOTA      ILAAVNEALHQSQEMVTREMAKITGNIRLP-------
Y4332_LEPIN     VMAATNDALKKAKEATAYEFQSASGGL----------
Y3475_LEPIC     VMAATNDALKKAKEATAYEFQSASGGL----------
Y1710_EXISA     VLAAINDAMKQADQLVNDKMGRFTQGMNLP-------
Y1591_SHEHH     IAAACNDAARRVEENQKEKMAEVTGGMQLPPGMKMPF
Y1509_SHEPA     IAAACNDAARRVEENQKEKMAEVTGGMQLPPGMKMPF
Y1190_CHLCH     VVAAVNSALDASLKLAQDEIGKVTGGMMNP-------
Y1717_SHEPW     IAAACNDAARRVEENQKDKMAEVTGGMQLPPGMKMPF
Y3002_LEPBJ     VMAATNDALKKAEATAYEFQA----------------
Y065_LEPBL      VMAATNDALKKAEATAYEFQA----------------
Y4780_ALKMQ     IMAAVNEAMRGAEEMVSKEMGKVTGGMNIP-------
Y2678_CITK8     VAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF
Y1034_PROVI     VLAAVNSAIEESGRVSQEEIAKVAGGMINP-------
Y048_RICBR      XXVAFNDAKQKCDADSQNSMSGALSGMSLPPGFKMPF
Y020_GEOSW      VLAATNDALKKADELAAEMMGQFTKGLNIP-------
Y477_PARUW      IRAAHADAHKRLKEQS---------------------
Y1931_MYXXD     ITAAVNAALASSRQHMQRELAKISGGVKIP-------
Y1311_SHEAM     VAAACNDAARRVEENQKTKMAEVTGGMQLPPGMKMPF
Y116_BAUCH      ITAAFNDAVRRITEIKKDKMTSLSSSLQMPLGFNMPF
Y660_RICB8      XXVAFNDAKQKCDSDSQNSMSGALSGMSLPPGFKMPF
Y513_FINM2      VMVAVNDAIKKVLDMSESELGKITGGINIP-------
Y2790_SYNFM     IVAAVNDGLRKSQEMAAQEMGKIAGGLNI-PGLKIP-
Y444_KLEP7      VAAAFNDAARRIEETQKEKMASVSAGMQLPPGFKMPF
Y2224_CYAP7     VTEAMKDAYSKSTDTMRQKMEELTSGLNLP-------
Y2199_THEP3     VLAAVNQALRNAEEMIASEMAKITGGLNIP-------
Y140_PROMH      IAAAFNDAARRIEETQKEKMASVSNGMQLPPGFKMPF
Y074_CLOTE      ILSACNEALKKAEHETANEMKKLTGGMNLP-------
Y027_BACCQ      VLAATNDALKKADELSNSTMGKFTKGLNLPGGM----
Y027_BACC7      VLAATNDALKKADELSNSTMGKFTKGLNLPGGM----
Y027_BACC3      VLAATNDALKKADELSNSTMGKFTKGLNLPGGM----
Y027_BACAC      VLAATNDALKKADELSNSTMGKFTKGLNLPGGM----
Y027_BACAA      VLAATNDALKKADELSNSTMGKFTKGLNLPGGM----
Y024_BACC0      VLAATNDALKKADELSNSTMGKFTKGLNLPGGM----
Y021_BACC1      VLAATNDALKKADELSNSTMGKFTKGLNLPGGM----
Y020_BACHK      VLAATNDALKKADELSNSTMGKFTKGLNLPGGM----
Y020_BACCZ      VLAATNDALKKADELSNSTMGKFTKGLNLPGGM----
Y020_BACAN      VLAATNDALKKADELSNSTMGKFTKGLNLPGGM----
Y020_BACAH      VLAATNDALKKADELSNSTMGKFTKGLNLPGGM----
Y2894_SYNJB     LLTAMVNAYTQSAETMRKRMEELTGNISLP-------
Y243_CLOCE      ILSAVNEALRKADELANSEMSKITGGLGGLPGM----
Y294_NOCFA      VIGAINDAMARAQQLAAERLGPLAGGGSMP-------
Y1369_SYNJA     LLTAMVNAYTQSAETMRKRMEELTGNISLP-------
Y1069_THEYD     VLAAVNEAIKRAHELAQSEMAKVSMPFNLP-------
Y040_THETN      VLAAVNQALRNAEEMIASEMAKITGGFNIP-------
YBAB_SHISS      VAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF
YBAB_SHIFL      VAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF
YBAB_SHIF8      VAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF
YBAB_SHIDS      VAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF
YBAB_SHIBS      VAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF
YBAB_SHIB3      VAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF
YBAB_SALTY      VAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF
YBAB_SALTI      VAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF
YBAB_SALSV      VAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF
YBAB_SALPC      VAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF
YBAB_SALPB      VAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF
YBAB_SALNS      VAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF
YBAB_SALHS      VAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF
YBAB_SALG2      VAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF
YBAB_SALEP      VAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF
YBAB_SALDC      VAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF
YBAB_SALCH      VAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF
YBAB_SALAR      VAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF
YBAB_SALA4      VAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF
YBAB_ESCF3      VAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF
YBAB_ECOSM      VAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF
YBAB_ECOSE      VAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF
YBAB_ECOLU      VAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF
YBAB_ECOLI      VAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF
YBAB_ECOLC      VAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF
YBAB_ECOL6      VAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF
YBAB_ECOL5      VAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF
YBAB_ECOK1      VAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF
YBAB_ECOHS      VAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF
YBAB_ECODH      VAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF
YBAB_ECOBW      VAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF
YBAB_ECO81      VAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF
YBAB_ECO7I      VAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF
YBAB_ECO5E      VAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF
YBAB_ECO57      VAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF
YBAB_ECO55      VAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF
YBAB_ECO45      VAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF
YBAB_ECO27      VAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF
Y2800_ENTS8     VAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF
Y260_CORDI      LVGAFAEAHEKLGTLAEQKMGPLSQGFDGLGGM----
Y1507_MANSM     XXXXXXXXXXXXELQ-KEKMASVTAGMPIPPGFKMPF
Y1196_FRATN     IAAAVNSAVKKVEENSTHKMAK-DAGIDLPSGINFPF
Y034_THEPX      VLAAVNQALRNAEEMIASEMAKITGGLNIP-------
YBAB_ECO8A      VAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF
Y810_FRATT      IAAAVNSAVKKVEENSTAKMAK-DAGIDLPSGINFPF
Y810_FRAT1      IAAAVNSAVKKVEENSTAKMAK-DAGIDLPSGINFPF
Y1974_ACIBL     VTAAVNEGSRRVDQAMQSNLSXXXXXXXLP-------
Y1499_FRATF     IAAAVNSAVKKVEENSTAKMAK-DAGIDLPSGINFPF
Y1411_FRATH     IAAAVNSAVKKVEENSTAKMAK-DAGIDLPSGINFPF
Y1374_FRATO     IAAAVNSAVKKVEENSTAKMAK-DAGIDLPSGINFPF
Y1023_FRATM     IAAAVNSAVKKVEENSTAKMAK-DAGIDLPSGINFPF
YBAB_ECO24      VAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF
Y772_COXBR      IKAALNDANQKILKITQEKM-----------------
Y666_COXBN      IKAALNDANQKILKITQEKM-----------------
Y656_COXBU      IKAALNDANQKILKITQEKM-----------------
Y1603_COXB1     IKAALNDANQKILKITQEKM-----------------
Y1351_COXB2     IKAALNDANQKILKITQEKM-----------------
Y951_ENT38      VAAAFNDAARRIDETQKEKMASVSSGMQLPPGFKMPF
Y390_RHOE4      VIGAIEDASRKAQEVAAEK------------------
Y330_CHLCV      FRSAFKEAKE----AMDKEMSVMRAGMP---------
Y2212_AERHH     XXXXXXXXXXXXXEQNKSKMGELTGGMQLPPGFKMPF
Y1593_CALS8     IVACVNEAIRKVEKMIEEEM-----------------
Y2473_ERWT9     AAAFNDAARRISEAQ-KDKMASVSNGMSLPPGFKMPF
Y2391_MICAN     ILEAMKVAYDASTETMRSKMEELTSGLNIP-------
Y672_CHLFF      FRSAFKEAK----TAMDQEMSVMRAGLP---------
Y035_BACHD      ILAATNEALKKVDELVEQDMGKFTKGLNMP-------
Y701_BUCCC      ITSAINNAVNK--------------------------
Y533_PERMH      LVAAFNEANRRTKEVMGEKMTQ-AAGLP---------
Y210_COREF      VQGAFLDAHKKVADLAQEKMGPLSQG-----------
Y039_LYSSC      IVIATNEALKKVEEKTNSTMGKFTQGLNLP-------
Y6705_RICAH     IKVAFNDAKQKCDEDSQNSLSGALNGMSLPPGFKMPF
Y2855_ALKOO     IMAAMNEAIRAADDMMSSEMGKITGKMNMP-------
Y1847_SYNY3     VTEAMKAAYAESTETMRSKMEELTSGLNLP-------
YAAK_BACSU      VLAATNEALKKVDEITNETMGQFTKGMNMP-------
Y120_FRAP2      IAAAVNSAVKKVEDSSSSKMAK-EAGIDLPNGFNFPF
Y2555_FLAJ1     LVVTLNKVIEKA-TSVNERELDAVARMDMPPGM----
Y1806_PSEPF     XXXXXXXXXXQIEANSQAKMGSMTAGMNLPAGMKLPF
Y5272_MYCSJ     VVGAIADAAKQVTILAHDR------------------
Y4993_MYCSK     VVGAIADAAKQVTILAHDR------------------
Y4904_MYCSS     VVGAIADAAKQVTILAHDR------------------
Y039_CHLPN      FRAAFKLAKE----QMDQEMSLMRSTMP---------
Y1287_MYCGI     IVGAIADAAKQVTILAHDK------------------
Y1612_MARAV     LAAAVNDAVRRVEANQKD-------------------
Y690_SODGM      XXXXXXXXXXXXETQ-KEKMAAVSSGMQLPPGFKMPF
Y426_BUCBP      ITAAFNDAVRKISDLQKQKMSSISSEMKFSNNLNLPF
Y3761_ANADF     -------------------------------------
Y326_CHLAB      FHSAFKEAKE---------------------------
Y2444_LACCB     IIEAVNQAMGTIDKETQDKMGKYTRGLPM--------
Y4556_STRAW     -------------------------------------
Y1796_GRAFK     VLTMNKAIEKATNINEAEIGAAAKDGMPDIPGM----
Y038_BACSK      IIAATNEALKKVDELVEQDLGKFTKGLNMP-------
Y5528_MYCVP     IVGAVADAAKQVTILAHDR------------------
Y3619_STRCO     -------------------------------------
Y2831_LISMH     VLAATNDVLKQIEDTTSQTMGKFTQGLNIP-------
Y2703_LISMO     VLAATNDVLKQIEDTTSQTMGKFTQGLNIP-------
Y2683_LISMF     VLAATNDVLKQIEDTTSQTMGKFTQGLNIP-------
Y2677_LISMC     VLAATNDVLKQIEDTTSQTMGKFTQGLNIP-------
Y2851_LISIN     VLAATNDVLKQIEDTTSQTMGKFTQGLNLP-------
Y1483_PEDPA     IVAAVNDAMNRVDSETNKTMGKYTKGIP---------
Y319_MYCA9      IIGALADLTSKTQELASQR------------------
Y2654_LISW6     VLAATNDVLKQIEDTTSQTMGKFTQGLNLP-------
Y113_CAMLR      LIAAINDVMKMVEQNKKSMASNLFSGM----------
Y1136_SERP5     XXXXXXXXXXXXXTQ-KEKMASVSNGMQLPPGFKMPF
Y824_CLONN      ILAACNQALKTADEETANEMKKLTGGLNMP-------
Y4210_RHOSR     VIGAIEDASNKAQEIAAQK------------------
Y4137_RHOOB     VIGAIEDASSKAQEIAAQK------------------
Y3446_CLOBB     VLTAVNEALRKAEEETASKMGKLTGGMP---------
Y3225_CLOBA     VLTAVNEALRKAEEETASKMGKLTGGMP---------
Y2358_BACLD     VLAATNDALKKVDEVTNETMGKFTKGMNMP-------
Y066_CAMFF      LISAINDAIKLSEDEKKRAASAMFGGL----------
Y4574_CAUSK     IV-----------------------------------
Y607_FRATW      IXXXXXXXXXXXXXXSTAKMAK-DAGIDLPSGINFPF
Y2143_CLOTH     ILAAVNEALRKADEMVTAEISKITGGLGGIPGL----
Y020_PROM4      ILEALKDAHELSTSTMKERMQELTGGLNL--------
Y1174_PELPB     VLAAVNNALDESARLAQEEISKVTGGMMNP-------
Y699_LACPL      VVAAVNDALTKVDEQTQSTMGKYTKGL----------
Y492_ACIC5      ITAAINEAGRRAEEILKSSM-----------------
Y1642_CAMJE     LISAINDVLAM-VAQNRSSMADVLGGF---GGMKL--
Y128_LACLM      VTDAVNDALSQIEKVTEQKLGKFTKGLP---------
Y106_LACLS      VTDAVNDALSQIEKVTEQKLGKFTKGLP---------
Y025_PROMM      ILAALQSAYEHSTTTMKEQMEELTGGLNLNPGM----
Y019_PROM1      ILEAMKSAHEVSTSTMKERMEDLTGGFKLNPGM----
Y987_STRP2      TVQAINSALEQIDETTKKKLGAFAGKLP---------
Y1459_CHRSD     XXXXXXXVR-KVEETSRGRMEEATEGMNLPPGFKMPF
Y1347_PROMT     ILDAMKSAHEVSTSTMKERMEDLTGGFKLNPGM----
Y1195_STRPI     TVQAINSALEQIDETTKKKLGAFAGKLP---------
Y1178_STRPS     TVQAINSALEQIDETTKKKLGAFAGKLP---------
Y1174_STRP7     TVQAINSALEQIDETTKKKLGAFAGKLP---------
Y1149_STRZT     TVQAINSALEQIDETTKKKLGAFAGKLP---------
Y1108_STRZP     TVQAINSALEQIDETTKKKLGAFAGKLP---------
Y1102_STRPN     TVQAINSALEQIDETTKKKLGAFAGKLP---------
Y1041_STRZJ     TVQAINSALEQIDETTKKKLGAFAGKLP---------
Y1024_STRPJ     TVQAINSALEQIDETTKKKLGAFAGKLP---------
Y1021_STRP4     TVQAINSALEQIDETTKKKLGAFAGKLP---------
Y1010_STRR6     TVQAINSALEQIDETTKKKLGAFAGKLP---------
Y052_PELTS      ILAAVNEALKKAQDMISQEMGRLTGNLKIP-------
Y2554_CYAP8     VTDAMKDAYTQSTETMRTKMEELTSGLNLP-------
Y2017_EUBE2     IVAATNEALRKCEEESQAQMAKIT-------------
Y056_CLOPS      VFSAVKQALEKASEETSEKMGKLTGGMGMP-------
Y053_CLOP1      VFSAVKQALEKASEETSEKMGKLTGGMGMP-------
Y046_CLOPE      VFSAVKQALEKASEETSEKMGKLTGGMGMP-------
Y024_PROM3      ILAALQSAYEHSTTTMKEQMEELTGGLNLNPGM----
Y1366_SULSY     LIAAINEVSERSKEVVADKISQAT-GLPM--------
Y120_LACLA      VTDAVNDALSQIEKVTEQKLGKFTKGLP---------
Y834_CHLP8      -------------------------------------
Y1179_CHLPB     -------------------------------------
Y019_EXIS2      VLAATNDALKKVDELVSSKMGKFTQGMNMP-------
Y467_BUCAP      XXXFNDATRRISEVQ-KKKMSAISTGMQLPTGFNIP-
Y3378_STRGG     -------------------------------------
Y315_CORGB      LLGAFKDAHNKVANVAEEKMGPLSQGM----------
Y243_CORGL      LLGAFKDAHNKVANVAEEKMGPLSQGM----------
Y1672_METI4     IV-----------------------------------
Y1157_CHLT3     XXAAVNQALTEATKMAQEEMSKVTGGM----------
Y018_GEOKA      ILAATNDALKKADELANEMMGQFTKGLNIP-------
Y805_CHLTE      -------------------------------------
Y270_STRPG      TTQAINDALTQIDEATKKTLGAFAGKLP---------
Y2128_RALME     XXXXFNDAVRKAEATTQEKMGSMTS------------
Y2111_RALEJ     XXXXFNDAVRKAEATTQEKMGSMTS------------
Y1606_STRP3     TTQAINDALTQIDEATKKTLGAFAGKLP---------
Y1591_STRP6     TTQAINDALTQIDEATKKTLGAFAGKLP---------
Y026_SYNPW      XXXXXXXXYERSTATMKERMQDLTGGLDLNPGM----
Y1227_AKKM8     LLQTINXXXXXXXXXXXXXMKKLTGGLDLPPGM----
Y200_CAMHC      LISAINDA-----------------------------
Y195_STRS2      TIQAVNAALTKVDEATQKKLGAFAGKLP---------
Y194_STRSY      TIQAVNAALTKVDEATQKKLGAFAGKLP---------
Y429_ARCB4      LISCMNDVIKQSDENKKMMAMNLMGGL----------
Y017_GEOTN      ILAATNDALKKVDELANDMMGQFTKGLNIP-------
Y1774_ALCBS     -------------------------------------
Y2780_ENTFA     VIMAVNDALVKIEKETEATLGKYTKGMP---------
Y1599_THET8     LLVAIQDAQTKAHELSEKEMAKELGGV----------
Y1235_THET2     LLVAIQDAQTKAHELSEKEMAKELGGV----------
Y159_MYCA5      VMLA---------------------------------
Y999_THELT      IVAAINEALREVTKKREEELSKIVSGLP---------
Y462_BORBU      IKSALNDAVSK----VKEEIKLKTMGV-LPFGM----
Y2278_SULNB     LISAMNDVNKMIEDNKKSQAMGMMGGM----------
Y1819_CAMC5     LISAINDVLKMAEDDKKAIAGRMLGGL----------
Y491_BORAP      VKSALNDAVSK----VKEEIKLKTMGV-LPFGM----
Y1791_STRA3     TTQAINDALSQVDDATKKIMGAFAGKMP---------
Y1770_STRA1     TTQAINDALSQVDDATKKIMGAFAGKMP---------
Y1747_STRA5     TTQAINDALSQVDDATKKIMGAFAGKMP---------
Y027_SYNSC      -------------------------------------
Y020_PROMP      ILEAIKKAHESSTTTMKERM-----------------
Y019_PROM5      ILEAIKKAHETSTTTMKERM-----------------
Y126_CLOAB      ILSACNEALKKAEEETSGEMKKLTGGLNIP-------
Y043_DESRM      LITAVNDALRQSQEMVAKEMGKLTGGLNIP-------
Y462_BORHD      IKSAFNDAISKVKEEIKSK------------------
Y401_LACH4      VI----DAVNKGLSQIDE-------------------
Y2277_STAS1     VIAATNEAMNKADELTQERLGKHTQGLNIP-------
Y1598_STRT2     TVQALNDALGQIDEATKKSMGAFAGKLP---------
Y1598_STRT1     TVQALNDALGQIDEATKKSMGAFAGKLP---------
Y1560_STRTD     TVQALNDALGQIDEATKKSMGAFAGKLP---------
Y027_SYNPX      TLEALQAAYEQSTA-----------------------
Y048_HELAH      -------------------------------------
Y369_LACGA      VIDAVNKGIKAVDDATQASMGKYTKGL----------
Y019_PROMS      ILQAIKKAHELSTTTMKERMNDLTGGLNL--------
Y521_STAAC      VLAATNEAMNKADELTQERLGKHTQGLNIP-------
Y513_STAA2      VLAATNEAMNKADELTQERLGKHTQGLNIP-------
Y500_STAA9      VLAATNEAMNKADELTQERLGKHTQGLNIP-------
Y479_STAAM      VLAATNEAMNKADELTQERLGKHTQGLNIP-------
Y478_STAAT      VLAATNEAMNKADELTQERLGKHTQGLNIP-------
Y478_STAAR      VLAATNEAMNKADELTQERLGKHTQGLNIP-------
Y476_STAA1      VLAATNEAMNKADELTQERLGKHTQGLNIP-------
Y453_STAA3      VLAATNEAMNKADELTQERLGKHTQGLNIP-------
Y444_STAA8      VLAATNEAMNKADELTQERLGKHTQGLNIP-------
Y443_STAAE      VLAATNEAMNKADELTQERLGKHTQGLNIP-------
Y437_STAAN      VLAATNEAMNKADELTQERLGKHTQGLNIP-------
Y436_STAAS      VLAATNEAMNKADELTQERLGKHTQGLNIP-------
Y434_STAAW      VLAATNEAMNKADELTQERLGKHTQGLNIP-------
Y428_STAAB      VLAATNEAMNKADELTQERLGKHTQGLNIP-------
Y2533_STAHJ     VLAATNEAMNKADELTQERLGKHTQGLNIP-------
Y1729_PSYWF     XXXXXXXV-TKADELSETTLAKATSGMGLPPGMQ---
Y030_OCEIH      ILAATNDVLNQIDEKTNDTMGQFTKGMNMP-------
Y3778_MYCBT     IVGAMRDASQQVTKMAQERL-----------------
Y3776_MYCBP     IVGAMRDASQQVTKMAQERL-----------------
Y3753_MYCTA     IVGAMRDASQQVTKMAQERL-----------------
Y3743_MYCBO     IVGAMRDASQQVTKMAQERL-----------------
Y3716_MYCTU     IVGAMRDASQQVTKMAQERL-----------------
Y269_CAUCN      -------------------------------------
Y268_CAUCR      -------------------------------------
Y1634_LACDA     VIDAVNKGLKQIDQATQQSLGKYTKGL----------
Y1514_LACDB     VIDAVNKGLKQIDQATQQSLGKYTKGL----------
Y019_PROM2      LQAIQK-AHESSTTTMKERMNDLTGGLNL--------
Y424_LACJO      VIDAVNKGIKAVDDATQASMGKYTKGL----------
Y332_HELHP      LMSALNDVRKSVEDNRQSSAMNLFNGL----------
Y031_HELP2      -------------------------------------
Y020_PROM9      LQAIQK-AHELSTTTMKERMNDLTGGLNL--------
Y019_PROM0      ILQAIKKAHELSTTTMKERMNDLTGGLNL--------
Y326_STRSV      TAQALNHALAQIDDATQKKMGAFAGKLP---------
Y317_MYCPA      VVGAMADASKQVTRMAQERLGSL--------------
Y175_HELPS      -------------------------------------
Y035_HELPY      -------------------------------------
Y033_HELPH      -------------------------------------
Y612_CHLMU      -------------------------------------
Y2330_MYCLE     IVGAMADASKQVTKLAQERLGALTSAM----------
Y2330_MYCLB     IVGAMADASKQVTKLAQERLGALTSAM----------
Y589_CHLT2      -------------------------------------
Y586_CHLTB      -------------------------------------
Y363_CHLTA      -------------------------------------
Y335_CHLTR      -------------------------------------
Y1926_STRP8     TTQAINDALTQIDETTKKTLGAFAGKLP---------
Y1862_STRP1     TTQAINDALTQIDETTKKTLGAFAGKLP---------
Y1647_STRPD     TTQAINDALTQIDEATKKTLGAFAGKLP---------
Y1638_STRPF     TTQAINDALTQIDETTKKTLGAFAGKLP---------
Y1605_STRPB     TTQAINDALTQIDEATKKTLGAFAGKLP---------
Y1585_STRPC     TTQAINDALTQIDEATKKTLGAFAGKLP---------
Y1568_STRPM     TTQAINDALTQIDEATKKTLGAFAGKLP---------
Y857_RICTY      ---AFNDAKQKCDEDSQNSLSGALNGMSLPPGFKIPF
Y254_SACEN      XXXXXXXXXXXXQELQQEKMGPVT-------------
Y032_HELPG      -------------------------------------
Y031_HELPJ      -------------------------------------
PGK_LEUCK       MAEADSIAADAFSNDAKTEVVDATAGIP---------
Y205_PROAC      -------------------------------------