[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for atum0:AAK85965.2

[Show Plain Result]


## Summary of Sequence Search
    1::1782
   62::806     e-115  37% 1520 aa  GLTA_BACSU RecName: Full=Glutamate synthase [NADPH] large chain;     
   70::826     e-109  35% 1515 aa  GLTB_AZOBR RecName: Full=Glutamate synthase [NADPH] large chain;     
   83::841     e-106  36% 1550 aa  GLTB_SYNY3 RecName: Full=Ferredoxin-dependent glutamate synthase 1;  
   74::837     e-104  36% 1549 aa  GLTB_CYACA RecName: Full=Ferredoxin-dependent glutamate synthase;    
  137::893     e-104  35% 2111 aa  GLT1_SCHPO RecName: Full=Putative glutamate synthase [NADPH];        
  200::830     e-102  35% 1538 aa  GLTB_PORPU RecName: Full=Ferredoxin-dependent glutamate synthase;    
  142::898     e-101  37% 2194 aa  GLSN_MEDSA RecName: Full=Glutamate synthase [NADH], amyloplastic;    
   83::832     e-101  34% 1517 aa  GLTB_ECOLI RecName: Full=Glutamate synthase [NADPH] large chain;     
   77::808     e-100  37% 1556 aa  GLTS_SYNY3 RecName: Full=Ferredoxin-dependent glutamate synthase 2;  
  148::908     3e-99  35% 1629 aa  GLTB2_ARATH RecName: Full=Ferredoxin-dependent glutamate synthase 2,
   74::830     6e-99  35% 1538 aa  GLTB_PORYE RecName: Full=Ferredoxin-dependent glutamate synthase;    
   67::826     3e-98  33% 1536 aa  GLTB_ANTSP RecName: Full=Ferredoxin-dependent glutamate synthase;    
  172::933     2e-97  36% 1648 aa  GLTB1_ARATH RecName: Full=Ferredoxin-dependent glutamate synthase 1,
  170::899     2e-94  35% 1616 aa  GLTB_MAIZE RecName: Full=Ferredoxin-dependent glutamate synthase,
   73::801     3e-92  34% 1517 aa  GLTB_SPIOL RecName: Full=Ferredoxin-dependent glutamate synthase,
   87::886     2e-91  34% 2145 aa  GLT1_YEAST RecName: Full=Glutamate synthase [NADH];       
   41::427     9e-40  35%  436 aa  GLTB_HORVU RecName: Full=Ferredoxin-dependent glutamate synthase;  
  204::490     1e-39  39%  510 aa  GLUS_METJA RecName: Full=Glutamate synthase;         EC=1.4.1.13;
  149::340     5e-06  30%  378 aa  Y952_ARCFU RecName: Full=Uncharacterized protein AF_0952;
   82::172     3e-04  31%  272 aa  FWDC_METMP RecName: Full=Tungsten-containing formylmethanofuran
   40::158     5e-04  26%  273 aa  FWDC_METJA RecName: Full=Tungsten-containing formylmethanofuran
  307::411     6e-04  30%  416 aa  GLYA_DESAH RecName: Full=Serine hydroxymethyltransferase;       
  325::411     9e-05  33%  510 aa  GLUS_METJA RecName: Full=Glutamate synthase;         EC=1.4.1.13;(query 538->627)
    1::1782

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSAEGVGDGAGVSLDLSLSFFRELTGDAALPAGRFGVGNFFLPQNPAFHGEAVGIIGNALKEQGFSVLLV
GLTA_BACSU      ------GDGAGLLVQIPDAFFRKECKNINLPEKRYGVGMVFFSQKEDERKKIEKQINALIEQEGQVVLGW
GLTB_AZOBR      VDADGTGDGAGIHVAVPQKFFKDVIGHRA-PDNKLAVGQVFLPRISLDAQEACRIVETEILAFGYYIYGW
GLTB_SYNY3      ------GDGAGILIQVPHKFIQKIAGGITIPAGQYAVGNIYGSPDPLARAEARQKFNDIVAQEGLKVLGW
GLTB_CYACA      ---EESGDGAGILFSIPWKFFVEWSKQFKINISQAAVAMLFLPCLSSDIQVSKNIVEEIFQDEDFIVIGW
GLT1_SCHPO      -------------------------------SGEYAIGNVFFSPEADVCREAMTAFTQVAEKLGLAILAW
GLTB_PORPU      ----------------------------------------------------------------------
GLSN_MEDSA      ------GDGAGILVALPHGFYQEVVDFQLPPQGNYAVGMFFLPKSDSRRKESKNIFTKVAESLGHKVLGW
GLTB_ECOLI      ------GDGCGLLLQKPDRFFRIVAQERGWRAKNYAVGMLFLNKDPELAAAARRIVEEELQRETLSIVGW
GLTS_SYNY3      ------GDGAGVMTAIPRELLAQWFNTRNLPGDRLGVGMVFLPQEPSXXXXXXXXXXXXXXLEKLTVLGW
GLTB2_ARATH     ------GDGSGLMTSIPWDLFNEWAGIASFDRTHTGVGMLFLPRDDNIRKEAKKVITSIFEKEGLEVLGW
GLTB_PORYE      ------GDGAGITTAIPWNLFQKSLQNQNIKFEQVGVGMLFLPAHKL--KESKLIIETVLKEENLEIIGW
GLTB_ANTSP      ------GDGAGVTIQIGINFLPKLQSNQSIL--NYGVRMILRSSDDL--DKIKKIFSWALDEYQLDLISW
GLTB1_ARATH     ------GDGSGLMSSIPWDFFNVWAKEQSLPFDKLGVGMIFLPQDDTFMQEAKQVIENIFEKEGLQVLGW
GLTB_MAIZE      -----------------------------------GVGMVFLPQDEKSMEEAKAATEKVFVDEGLEVLGW
GLTB_SPIOL      -----------------------------------GVGMVFLPKDDLLAEEAKKVVLDTFAQEGIEVIGW
GLT1_YEAST      VSSDGNGDGAGILLGIPHEFMKKLDLDLDIPEGKYAVGNVFFXXXXXXXXXXLKIFEDLAASFNLSVLGW
GLTB_HORVU      ------GDGAGLMSGIPWDLFDDWASKEGLPFERTGVGMVFLPQNENSMEEAKAAVEKVFTDEGLEVLGW
GLUS_METJA      ----------------------------------------------------------------------
Y952_ARCFU      ----------------------------------------------------------------------
FWDC_METMP      ----------------------------------------------------------------------
FWDC_METJA      ----------------------------------------------------------------------
GLYA_DESAH      ----------------------------------------------------------------------
GLUS_METJA      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           RDVPVNDTAIRPAAIPYQLPIRQWVFSAPVECATLAEFDWRIHKALLAIEALAYTVPDLAGFYPLSLSAR
GLTA_BACSU      RTVPVNVGKIGTVAQKSCPFVRQVFIGASSDLKDNLSFERKLY--VIRKQAENWGVTEGLDFYFASLSSQ
GLTB_AZOBR      RQVPINVDIIGEKANATRPEIEQ-IIVGNNKGVSDEQFELDLYIIRRRIEK-AVKGEQINDFYICSLSAR
GLTB_SYNY3      RDIPTQNEPLGETAIASE-PFMQQVYIARPEGLT---DDLDFERKLYVIRKLTHGAPKIDTYYVASLSAR
GLTB_CYACA      REVPYVKEVLGPLALRNMPQIYQIVVQSKRYQGRSLDFHYRVRRKIITVRAYSWA----KDFYFCSCSNH
GLT1_SCHPO      RSVPCDNSILGPAALSREPTILQPCVVLKAAYDGEAEFDTDLFERQLYVKQSSHLIGKEKWFYICSLHRE
GLTB_PORPU      -------------------------------------------------------------FYVCSLSCY
GLSN_MEDSA      RSVPTDNTGLGKSAQLTE-PVIEQVFLTPSSDSKVLEKQMYILRKLSMVSALNLQSDGITDFYICSLSSR
GLTB_ECOLI      RDVPTNEGVLGEIALSSLPRIEQIFVNAPAGWRP-RDMERRLFIARRRIEKRLEADKD---FYVCSLSNL
GLTS_SYNY3      REVPVNSDVLGIQAKNNQPHIEQILVTCPEGCAG-DELDRRLYIARSIIKKLA------EDFYVCSFSCR
GLTB2_ARATH     RDVPVEASIVGHNA-KQTMPNTEQVFVRIXXXXXXXXXERELYICRKLIERAVASESWASELYFSSLSNQ
GLTB_PORYE      RLVPTVQEVLGKQAYLNKPHVEQ------VFCKSSNLSKDRLEQQLFLVRKKIEKYIGINGFYICSLSCY
GLTB_ANTSP      RNVPV-DKSILGEESKFNQPL---VVQCIVRSNNLIDYKLDKHLYLVRIEKLVLDINTNKQFYICSFSSK
GLTB1_ARATH     REVPVNVPIVGKNARE-TMPNIQQVFVKIAKEDSTDDIERELYICRKLIERAVATESWGTELYFCSLSNQ
GLTB_MAIZE      RPVPFNVSVVGRNAKETMPNIQQFVKVAKEDNADDIERELYISRKLIERAAKSFSWAD--ELYFCSLSSR
GLTB_SPIOL      RSVPTNVSVVGRNA-KETMPNIQQVFVRIIKEDSTDDIERELYICRKLIERAASSHTWASELYFCSLSNQ
GLT1_YEAST      RNVPVDSTILGDVALSREPTILQPLL-VPLYDEKQPEFNFRTQLYLLRKEA-SLQIGLENWFYVCSLNNT
GLTB_HORVU      RPVPFNSVAGRNAKETMPNILQIFVRIAKEDDADDIERELYICRKL--IERATKSASWADELYFCSLSSR
GLUS_METJA      ----------------------------------------------------------------------
Y952_ARCFU      --------------------------------------------------------------YVVSSGKD
FWDC_METMP      ----------------------------------------------------------------------
FWDC_METJA      ----------------------------------------------------------------------
GLYA_DESAH      ----------------------------------------------------------------------
GLUS_METJA      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           TQVLKGRLNSQEVMPYFCDLTDPRHKVHTMYFHTRFSTNTDPHPSMAQPFRLMAHNGELNTDKKNRLSEA
GLTA_BACSU      TIVYKGLLTPEQVDAFYSDLQDEAFVSAFALVHSRFSTNTFPTWERAHPNRYLVHNGEINTLRGNRAREQ
GLTB_AZOBR      SIIYKGMFLAEQLTTFYPDLLDERFESDFAIYHQRYSTNTFPTWPLAQPFRMLAHNGEINTVKGNRMEHP
GLTB_SYNY3      TLVYKGMLTTAQVGQYYPELHDPDMESALALVHSRFSTNTFPSWERSHPYRYIAHNGEINTMRGNALFES
GLTB_CYACA      TIVYKGMVKSTSLGQFYQDLYNPDFEISFAVFHRRFSTNTMPRWPLAQPMRILGHNGEINTARESSLNHP
GLT1_SCHPO      TIVYKGQLAPVQVYNYFLDLNNAEYVSHFALVHSRFSTNTFPSWDRAQPMRLAAHNGEINTLRGNKWMHA
GLTB_PORPU      TIVYKGMMRSAVLGQFYQDLYHSEYTSSFAIYHRRFSTNTMPKWPLAQPMRFISHNGEINTLLGNRSREP
GLSN_MEDSA      TVIYKGQLTPAQLGEYYADLGNERFTSYMALIHSRFSTNTFPSWDRAQPFRVLGHNGEINTLRGNELGLS
GLTB_ECOLI      VNIYKGLCMPTDLPRFYLDLADLRLESAICLFHQRFSTNTVPRWPLAQPFRYLAHNGEINTITGNRQWAR
GLTS_SYNY3      TIVYKGMVRSIILGEFYLDLKNPGYTSNFAVYHRRFSTNTMPKWPLAQPMRLLGHNGEINTEKELEVSGW
GLTB2_ARATH     TIVYKGMLRSEVLGLFYPDLQNDLYKSPFAIYHRRFSTNTSPRWHLAQPMRFLGHNGEINTGNLNWMTSR
GLTB_PORYE      TIVYKGMMRSAVLGQFYQDLYHSEYTSSFAIYHRRFSTNTMPKWPLAQPMRFVSHNGEINTQSREPLLQS
GLTB_ANTSP      TIVYKGMLRSEFLVKYYNDLSNSLYVSNFAMYHRRFSTNTMPKWSLAQPMRFMAHNGEINTLLGNNWNKS
GLTB1_ARATH     TIVYKGMLRSEALGLFYLDLQNELYESPFAIYHRRYSTNTSPRWPLAQPMRFLGHNGEINTIQGNQSREA
GLTB_MAIZE      TIVYKGMLRSEVLGQFYLDLQNELYKSPFAIYHRRFSTNTSPRWPLAQPMRLLGHNGEINTIQGNLNWMR
GLTB_SPIOL      TIIYKGMLRSEVLGMFYYDLQNERYTSPFAIYHRRYSTNTSPRWPLAQPMRFLGHNGEINTIQGNRSREP
GLT1_YEAST      TIVYKGQLTPAQVYNYYPDLTNAHFKSHMALVHSRFSTNTFPSWDRAQPLRWLAHNGEINTLRGNKNWMR
GLTB_HORVU      TIIYKGMLRSEVLGQFYLDLQNELYKSPFAIYHRRFSTNTSPRWPLAQPMRLLGHNGEINTIQGNRSREA
GLUS_METJA      ----------------------------------------------------------------------
Y952_ARCFU      MGVFKGVGFPEDIAEYF--MLAEEYKGYMWTAHSRFPTNTPGWWGGAHPFCILVHNGEISSYGTNK--RY
FWDC_METMP      ----------------------------------------------------------------------
FWDC_METJA      ----------------------------------------------------------------------
GLYA_DESAH      ------------------------------------SNGTDNHLMLLN----LTHNGISGKDAENRLGAA
GLUS_METJA      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           AVALAKNASIVRPKGQSDSCRLDQTLQARVMEDGLDLVTAVVSMMPPAWENDDTLSPGVKSMLEYFSLYE
GLTA_BACSU      QFVLNKILPILNADG-SDSSILDNAFEFFVMAGRKPAHTAMM-LIPEPWTENTHMSKEKRAFYEYHSSLM
GLTB_AZOBR      AFGTMQDLKPVIGVGLSDSGSLDTVFEVMV-RAGRTAPMVKMMLVPQALTSSQTTPDNHKALIQYCNSVM
GLTB_SYNY3      SLFMAKVQPVINIDG-SDSTIFDNALELLYLA-GRSLPHAVMMMIPEPWSAHESMSQEKKAFYKYHSCLM
GLTB_CYACA      TLNEVASIGPVVNVSNSDSANLDSVVEL-FLHVGHSCPEALMFLIPEAYENNPKLKQNLISFYEYCAGFQ
GLT1_SCHPO      REGLMKSSRFIIERGGSDSAAFDNVIELLCASGVVSLPEAVMLLIPEAWQNDKNISDEKAAFYEWAACQM
GLTB_PORPU      LLPIWKNLKPITNKDNSDSANLDAAVEL-LIASGRSAEEALMILVPEAFQNQPEFNKNISDFYEYYSGLQ
GLSN_MEDSA      ENDLKKFLPIVDANSSDSGC-FDGVLEF-LLHSGKSLPEAVMMMIPEAWQNDKNMDPQRKAFYEYYSALM
GLTB_ECOLI      ARTLHDAAPFVNETG-SDSSSMDNMLEL-LLAGGMDIIRAMRLLVPPAWQNNPDMDPELRAFFDFNSMHM
GLTS_SYNY3      TKAELEALTPIVNQANSDSYNLDSALEL-LVRTGRSPLEAAMILVPEAYKNQPALKPEISDFHDYYSGLQ
GLTB2_ARATH     EASLRSPVPISNPKA-SDSANLDSAAEL-LIRSGRTPEESLMILVPEAYKNHPTLMIKYPEAVDFYDYYK
GLTB_PORYE      KVWKDRIHELITNKDNSDSANLDAAVEL-LIASGRSPEEALMILVPEAFQNDFANNTEISDFYEYYSGLQ
GLTB_ANTSP      KESLLKSSSPITNLENSDSANLDSVLEL-FIHSGRTPQEALMILIPEAYKNQPALSPEITDFYEYYSILQ
GLTB1_ARATH     SLKAAGRENEIRPFGNSDSANLDSAAEI-MIRSGRTPEEALMILVPEAYKNHPTLSPEVVDFYDYYKGQM
GLTB_MAIZE      SRETTLKSPVWRPKA-SDSANLDSTAEL-LLRSGRSPAEALMILVPEAYKNHPTLSPEVTDFYDYYKGQM
GLTB_SPIOL      SIVWRGRENEIRPYGNSDSANLDSAAEL-LIRSGRTPEEALMILVPEAYKNHPTLMIKYPEAVDFYDYYK
GLT1_YEAST      SREGVMNSATFKEEGGSDSAALDNVLELLTINGTLSLPEAVMMMVPEAYHKD--MDSDLKAWYDWAACLM
GLTB_HORVU      TIVWRGRENELRPFGDSDSANLDNAAEL-LLRSGRSPAEAMMMLVPEAYKNHPTLSPEVIDFYEYYKGQM
GLUS_METJA      ----------------------------------------------------------------------
Y952_ARCFU      LEMFGYYCTLL-----TDTEVMAYAVDLLMRKQGLPIEIVSKIFAPPMWDHIDIMDEKKKKF--YTAL--
FWDC_METMP      ----------------------------------------------------------------------
FWDC_METJA      ----------------------------------------------------------------------
GLYA_DESAH      GITVNKNAVPNDPRGPTSGIRIGTPLVTTMGETEMDLVAELITQALEAPATAETVREKVRSLCAQFPLYK
GLUS_METJA      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           EKNDGPAALIFGDGTIIGARLDRLGLRPLRTVETDDYLCVMSEAGQIAFPAESVIRRGRIEAGGMLYYDH
GLTA_BACSU      EPWDGPTAISFTDGKQIGAILDRNGLRPARYYVTDDYIIFSSEVGVIEVEQENVLYKNRLEPGKMLLIDL
GLTB_AZOBR      EPWDGPAALAMTDGRWVVGGMDRNGLRPMRTITTDGLIIGGSETGMVKIDETQVIEKGRLGPGEMIAVDL
GLTB_SYNY3      EPWDGPASIAFTNGKMMGAVLDRNGLRPSRYYVTKDDLVIMSEAGVLPIEPERVAKKGRLQPGRMFLVDM
GLTB_CYACA      EAWDGPALIVFSDGHTVGASLDRNGLRPARYCVTEDNVLILASEGGVLNLDPSLIRKGRLGPGEMIVLDL
GLT1_SCHPO      EPWDGPALFTFADGRYCGANLDRNGLRPCRYLTSDDMMICASEVGTVGIEPDRIVQKGRLYPGRMLLVDT
GLTB_PORPU      EPWDGPALVVFTDGKVIGATLDRNGLRPARYVITKDNLVIVSESGVVQVEPSNIKSKGRLGPGQMISVDI
GLSN_MEDSA      EPWDGPALISFTDGHYLGATLDRNGLRPGRFYVTHSGRVIMSEVGVVDIPPEDVCRKGRLNPGMMLLVDF
GLTB_ECOLI      EPWDGPAGIVMSDGRFAACNLDRNGLRPARYVITKDKLITASEVGIWDYQPDEVVEKGRVGPGELMVIDT
GLTS_SYNY3      EPWDGPALLVFSDGKIVGAGLDRNGLRPARCITKDDYIVLGSEAGVVDLPEVDIVEKGRLAPGQMIAVDL
GLTB2_ARATH     EPWDGPALVLFSDGKTVGACLDRNGLRPARYWRTDNVVYVASEVGVLPMDESKVTMKGRLGPGMMISVDL
GLTB_PORYE      EPWDGPALVVFTNGKVIGATLDRNGLRPARYVITKDNLVIVSESGVVQVEPGNVKSKGRLGPGQMISVDI
GLTB_ANTSP      EPWDGPALVVFTDGKFVGATLDRNGLRPARYTITDDFISLSSETGVSNINSQNVVTKGRLGPGQMLCVDL
GLTB1_ARATH     EAWDGPALLLFSDGKTVGACLDRNGLRPARYWRTDNFVYVASEVGVVPVDEAKVTMKGRLGPGMMIAVDL
GLTB_MAIZE      EAWDGPALLLFSDGRTVGATLDRNGLRPARYWRTDDFVYVASEVGVIPMDESKVVMKGRLGPGMMITVDL
GLTB_SPIOL      ETWDGPALLLFSDGKTVGACLDRNGLAPARYWRTDNVVYVASEVGVLPMDESKVTMKGRLGPGMMISVDL
GLT1_YEAST      EPWDGPALLTFTDGRYCGAILDRNGLRPCRYITSDDRVICASEVGVIPIENSLVVQKGKLKPGDLFLVDT
GLTB_HORVU      EAWDGPALLLFSDGRTVGACLDRNGLRPARYWKTSDFVYVASEVGVIPMDESKVVMKGRLGPGMMITVDL
GLUS_METJA      ----------------------------------------------------------------------
Y952_ARCFU      RMNYGPL-LINGPWTIVVARTDRIRLRPITSGEKGDLLFVSSEESAI-----------------------
FWDC_METMP      ----------------------------------------------------------------------
FWDC_METJA      ----------------------------------------------------------------------
GLYA_DESAH      D---------------------------------------------------------------------
GLUS_METJA      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           TERRAFSTVEALELLASRRDYSSLLSDARVMLGDLPEVPADKQGSPLRYNGDLERHQRYVAYSHNQESFK
GLTA_BACSU      EEGRIISDEEVKTQIATEYPYQKWLEEELVQVNPDPESREEEQFSDLL--------TRQKAFGYTYEDIQ
GLTB_AZOBR      QSGKLYRDRELKDHLATLKPWDKWVQDELVKTASLKGEPSDMDKAELR--------RRQQAFGLTMEDME
GLTB_SYNY3      EQGRIIADEEIKQEIVSQHPYGEWLAANLKSLEQLPS-PGNVPGTDAE-----SLRQRQMAFGYTFEELR
GLTB_CYACA      QEKLLMSNLEIKNKIASLRPYSDWIKQNR-------QVXXXXXXXXXXXXXXQEVFKRQTCFGYTSEDIE
GLT1_SCHPO      KEGRIVDDKELKHNIASRYDFRSWLDQELIDMNSIVDSLIESTSTPIVDDVPLADDKTMLAFGYTLEQIN
GLTB_PORPU      ISHKILNNKEIKTSVAGKTPYGDLLKESRQILGHQAFFSEQQVESK-------KLMQLQTAFGYTNEDVE
GLSN_MEDSA      EKQIVVNDDALKEQYSLARPYGDWLEKQKIELKDIIDVPPTISGVPPLSNDDVDMENMGIAFGYSVESLE
GLTB_ECOLI      RSGRILHSAETDDDLKSRHPYKEWMEKNVRRLVPFEDLPDEEVGSRELDDDTLASYQKQFNYS--AEELD
GLTS_SYNY3      AEQKILKNYQIKQQAAQKYPYGEWIKIQR------QTVASDSFAEKTLFNDAQTVLQQQAAFGYTAEDVE
GLTB2_ARATH     ENGQVYENTEVKKRVASYNPYGKWVSENLRNL-----KPSNYLSSAILETDETLRRQQ--AFGYSSEDVQ
GLTB_PORYE      FSHKILNNKEIKTSVTTKIPYGELLTDARQILEHKPFL-SDQQ-------VDIKKMQLQTAFGYTNEDVE
GLTB_ANTSP      SKNLVLDNWMIKQQISQKFPYKEWVNKYQSLLEYLNDFTFDK----------VQMNRWHTAFGYTNEDVE
GLTB1_ARATH     VNGQVYENTEVKKRISSFNPYGKWIKENSRFL-----KPVNFKSSTVMENEEILRSQQ--AFGYSSEDVQ
GLTB_MAIZE      QTGQVLENTEVKKTVASASPYGTWLQECTRLI-----KPVNFLSSTIMDNETVLRHQQ--AFGYSSEDVQ
GLTB_SPIOL      SSGQVYENTEVKKRVASSNPYGKWVKE---NLRSLKAV--NFLSRALLENDTILRNQQ--AFGYSSEDVQ
GLT1_YEAST      QLGEMVDTKKLKSQISKRQDFKSWLSKV-IKLDDLPKEFISQDSLSLKVQSD----PRLLANGYTFEQVT
GLTB_HORVU      ETGQVLENTEVKKNVASAKPYGTWLQES------------------------------------------
GLUS_METJA      ----------------------------------------------------------------------
Y952_ARCFU      ----------------------------------------------------------------------
FWDC_METMP      ----------------------------------------------------------------------
FWDC_METJA      ----------------------------------------------------------------------
GLYA_DESAH      ----------------------------------------------------------------------
GLUS_METJA      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           FLMDPMLASGAEKISAMGYGNAINALSDQEGGVAKYFSQRFAQVTNPPLDSIREADGMTLRVALGAKPNS
GLTA_BACSU      KYLIPVIKEGKDPLGSMGNDAPLAVLSDRAQSLFNYFKQLFAQVTNPPIDAIRETSTMTWLGAEGDLLHP
GLTB_AZOBR      LILHPMVEDGKEAIGSMGDDSPIAVLSDKYRGLHHFFRQNFSQVTNPPIDSLRERRVMSLKTRLGNLGNE
GLTB_SYNY3      ILLAPMGRDGVEAIGSMGADTPLAVLSDKPKLLYNYFQQLFAQVTNPPIDSIREEIITSAETTIGGEGNP
GLTB_CYACA      LVIENMAIQGKEPTFCMGDDTPLAVLSGKSHVLYDYFKQRFAQVTNPPIDSLRESLVMSISSYLGSKTNS
GLT1_SCHPO      MIMAPMANGGKETLGSMGNDAAIACLSDQPRLLYDYFRQLFAQVTNPPIDPIREAIVMSLQCYIGPSGNI
GLTB_PORPU      LVIEHMASQGKEPTFCMGDDIPLAILSEKSHILYDYFKQRFAQVTNPAIDPLRESLVMSLTIQIGHKSND
GLSN_MEDSA      ILLLPMAKDGVEALGSMGNDTPLAVMSNREKLTFEYFKQMFAQVTNPPIDPIREKIVTSMRCMVGPEGDT
GLTB_ECOLI      SVIRVLGENGQEAVGSMGDDTPFAVLSSQPRIIYDYFRQQFAQVTNPPIDPLREAHVMSLATSIGREMNE
GLTS_SYNY3      MVVVPMASQGKEPTFCMGDDTPLAVLSHKPRLLYDYFKQRFAQVTNPPIDPLRENLVMSLAMFLGKRGNP
GLTB2_ARATH     MVIESMAAQGKEPTFCMGDDTPVAVLSQKPHMLYDYFKQRFAQVTNPAIDPLREGLVMSLEVNIGKRGNV
GLTB_PORYE      LVIEHMASQAKEPTFCMGDDIPLSILSEKSHILYDYFKQRFAQVTNPAIDPLRESLVMSLAIQIGHKSND
GLTB_ANTSP      LVIEHMASSAKEPTFSMGDDTPLPILSEKPHLIYDYFKQRFAQVTNPAIDPLRESLVMSLITYLGPKGNP
GLTB1_ARATH     MVIESMASQGKEPTFCMGDDIPLAGLSQRPHMLYDYFKQRFAQVTNPAIDPLREGLVMSLEVNIGKRGNL
GLTB_MAIZE      MVIESMASQGKEPTFCMGDDIPLAVLSQRPHLLYDYFKQRFAQVTNPAIDPLREGLVMSLEVNIGKRGNV
GLTB_SPIOL      MVIESMASQGKEPTFCMGDDIPLAVMSQKPHMLYDYFKQRFAQVTNPAIDPLREGLVMSLEVNIGKRGNV
GLT1_YEAST      FLLTPMALTGKEALGSMGNDAPLACLNENPVLLYDYFRQLFAQVTNPPIDPIREANVMSLECYVGPQGNM
GLTB_HORVU      ----------------------------------------------------------------------
GLUS_METJA      ----------------------------------------------------------------------
Y952_ARCFU      ----------------------------------------------------------------------
FWDC_METMP      ----------------------------------------------------------------------
FWDC_METJA      ----------------------------------------------------------------------
GLYA_DESAH      ----------------------------------------------------------------------
GLUS_METJA      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           GAKKARQIVVRSPILTHLDMLRIREQPETPVRRFEMLYTPVFDAEDANEAALRQAIDGLCGEVVAFAAEE
GLTA_BACSU      SERNVRRIKLYTPVLSNEQFYALKTHPDLKSQKIDVLFS-----ED-----LERGLKDMFTQAEKAISQG
GLTB_AZOBR      DETQTRLLQLESPVLTTAEFRAMRDYMGDTAAEIDATF-PV----DGGPEALRDALRRIRQETEDAVRGG
GLTB_SYNY3      RPESCRLIELKTPILTNXXXXXXXXXXEFKSVTLDILFDP-----NQGEAGLKTALDNLFTEADQAISQG
GLTB_CYACA      FEESSEKILIKTPILSENDLVLIKNSXXXXXXXXXXXXAH-FDSPQANGQSLFSTINQLCKQAKNLIQAG
GLT1_SCHPO      NQSQCRRLRMPTPILTVEEFNALRIYPDWKVASIDITF---FKSEGV--AGYAAAIERICSEADTAVNEG
GLTB_PORPU      QPVLAKHIKLDSPIINEGELNAILESKLSCAH-----INTIFKVEKGPNDFKKQ-IEQLCESASQAILSG
GLSN_MEDSA      TEEQCHRLSLKGPLLSTKEMEAIKKMN---YRGWRSKVIDITYSKERGTKGLEEALDRICTEAHNAISEG
GLTB_ECOLI      AEGQAHRLSFKSPILLYSDFKQLTTMKEEHYRADTLDIT-----FDVTKTTLEATVKELCDKAEKMVRSG
GLTS_SYNY3      KAESARTIKLRSPLVNEVELQAIK-TGQLQVAEVSTLY----DLDGVN--SLETALDNLVKTAIATVQAG
GLTB2_ARATH     GPQNVSQVVLSGPVLNERELEGLLGD---PLLKSQILPT-FFDIRRGIEGSLKKGLLKLCEAADEAVRNG
GLTB_PORYE      QPTLAKHIKLESPVINEGELNAIFESKLSCIR-----INTLFQLEDGPK-NFKQQIQQLCENASQAILDG
GLTB_ANTSP      TAIMAKSIKLESPIINENELAQLNS------FNLSVVTVPTFIDKHLSTQTFVDKILEICSQCDSYISQG
GLTB1_ARATH     GPENASQVILSNPVLNELEEL-MKDQYLKP-----KVLSTYFDIRKGVEGSLQKALYYLC-EAADDAVRS
GLTB_MAIZE      GPENADQVALSSPVLNEGELETLLNDSKLKPK----VLSTYFDIRKGLDGSLDKTIQALCEEADAAVRSG
GLTB_SPIOL      GPENASQVILPSPVLNEGELEAL---VNDPLLKAQML--PIFDIRKGVEGTLEKRLNRLCEAADEAVRNG
GLT1_YEAST      HSSQCDRLLLKSPIL-HWNEFQALKNIEAAYPSWSVAEIDITFDKSEGLLGYTDTIDKIT-KLASEAIDD
GLTB_HORVU      ----------------------------------------------------------------------
GLUS_METJA      ----------------------------------------------------------------------
Y952_ARCFU      ----------------------------------------------------------------------
FWDC_METMP      ----------------------------------------------------------------------
FWDC_METJA      ----------------------------------------------------------------------
GLYA_DESAH      ----------------------------------------------------------------------
GLUS_METJA      -----------------------------------------------NAPAIAVGIATSDADAVVIDGYK


                         .         .         .         *         .         .         .:630
query           GGIAVVTDRHVSAGRAALPMIMVVSAINQRLIEEGLRLRISLIVESGQFSSSHHIAAGLGFGASAVYPLG
GLTA_BACSU      VSLLILSDKKMNERLTPIPPLLAVSALHQHLIRKGLRTKVSIIVESGEAREVHHFAALIGYGADAIYATY
GLTB_AZOBR      ATHVILTDEAMGPARAAIPAILATGAVHTHLIRSNLRTFTSLNVRTAEGLDTHYFAVLIGVGATTVEAIA
GLTB_SYNY3      ANLIILSDRQVSAEKAAIPALLAVSGLHHHLIRNGSRTKVGLVLESGEPREVHHFAVLLGYGCGAINPLD
GLTB_CYACA      TKIIILSDKFESRTESYIPPLLVVGSLHQYLIKQGVRQKVSLIVETGQCWSTHHFACLLGYGASAVCPLA
GLT1_SCHPO      YKAIVLSDRNVNSERVPLASIAACGAVHHYLVQNKLRSRVALVCESGDAREVHHMCTLLGYGADAVCPLA
GLTB_PORPU      NNILILSDKNLESEKVSIPPLLAAGAVHHHLINKGLRQDASIIIETAQCWSTHHFACLIGYGASAICPYL
GLSN_MEDSA      YTTLVLSDRAFSKKHXXXXXXXXXXXXHQHLVKTLERTRVALMVESAEPREVHHFCTLVGFGADAICPLQ
GLTB_ECOLI      TVLLVLSDRNIAKDRLPVPAPMAVGAIQTRLVDQSLRCDANIIVETASARDPHHFAVLLGFGATAIYPLG
GLTS_SYNY3      AEILVLTDRPLTENQSFIPPLLAVGAVHHHLIRAGLRLKASLIVDTAQCWSTHHFACLVGYGASAICPLA
GLTB2_ARATH     SQVLVLSDRNPEPTRPAIPMLLAVGAVHQHLIQNGLRMSASIIADTAQCFSTHHFACLIGYGASAICPLA
GLTB_PORYE      NNILVLSDKNLDSEKVSIPPLLAVGAVHHHLINKGLRQEASILVETAQCWSTHHFACLIGYGASAICPYL
GLTB_ANTSP      IEILVLSDRILPVDKIFVSPLLIVGAVHHYLIKKQLRHKVSLVIDTGQCWTTHHFALLIGYGASAICPLT
GLTB1_ARATH     GSLLVLSDRRLEPTRPSIPIMLAVGAVHQHLIQNGLRMSASIVADTAQCFSTHHFACLVGYGASAVCPLA
GLTB_MAIZE      SQLLVLSDRSEAPTRPAIPILLAVGAIHQHLIQNGLRMSASIVADTAQCFSTHHFACLIGYGASAVCPLA
GLTB_SPIOL      SQMLVLSDRELEPTRPAIPILLAVGAVHQHLIQNGLRMYTSIVVDTAQCFSTHQFACLIGYGASAICPLA
GLT1_YEAST      GKILIITDRKMGANRVSISSLIAISCIHHHLIRNKQRSQVALILETGEAREIHHFCVLLGYGCDGVYPTL
GLTB_HORVU      ----------------------------------------------------------------------
GLUS_METJA      ----------------------------------------------------------------------
Y952_ARCFU      ----------------------------------------------------------------------
FWDC_METMP      ----------------------------------------------------------------------
FWDC_METJA      ----------------------------------------------------------------------
GLYA_DESAH      ----------------------------------------------------------------------
GLUS_METJA      GGTGAAPK--VFRDHVGIPIEMAIAAVDQRLREEGLRNEIS-IIASGGIRCSADVFKAIALGADAVY---


                         .         +         .         .         .         .         *:700
query           VQFRAEXXXXXXXXXXXXXXXXXXXXSLMKTMGKVGLCTAESYIGGEFFEPNFLDTSDPVLKRYFPNVKT
GLTA_BACSU      KQEIDEGRLDISYEEAVSKYGKSITEGVVKVMSKMGISTVQSYRGAQIFEA--VGISRDVIDRYFSGTAS
GLTB_AZOBR      ERHRRGLFGSMPLEKGMANYKKAIDDGLLKIMSKMGISVISSYRGGGNFEA--IGLSRALVAEHFPAMVS
GLTB_SYNY3      GMIAEGLLVNVDHKTACKNYIKAATKGVIKVASKIGISTIQSYRGAQIFEAVGLNQS--VIDEYFCRTSS
GLTB_CYACA      LEMSKGKMPNLTLIEVQNNYCKSVERGLLKILSKMGISLLTSYIGAQIFE--ILGLGKEVVDLAFEGTVS
GLT1_SCHPO      MEALTKMKPGITEETAIKNFKHAINGGILKVMSKMGISTLQSYKGAQIFEA--LGIDNEVINKCFLGTAS
GLTB_PORPU      AFETARHWWSNPKTKMLMSKGRLPACNLLKILSKMGISLLSSYHGAQIFE--ILGLGSEVVNFAFKGTTS
GLSN_MEDSA      VDGKIPPKASGDFNSKDELVKKYFKASMMKVLAKMGISTLASYKGAQIFEA--LGLSSEVIEKCFAGTPS
GLTB_ECOLI      -RLVDTHAIAKDYRTVMLNYRNGINKGLYKIMSKMGISTIASYRCSKLFEA--VGLHDDVVGLCFQGAVS
GLTS_SYNY3      LEMENGRLDRIDLPTALKNYRQSVEAGLFKILSKMGISLLASYHGAQIFEA--IGLGAELVEYAFAGTTS
GLTB2_ARATH     LEMRNGKMPTVTMEQAQKNYRKAVNTGLLKVLSKMGISLFSSYCGAQIFE--IYGLGNEVVEFSFRGSAS
GLTB_PORYE      AFETARHWWSNPKTKMLMSKGRLPACNLLKILSKMGISLLSSYHGAQIFE--ILGLGSEVVNLAFKGTTS
GLTB_ANTSP      VRMSTGKLSRLTIQESQDNYRSAIEKGLLKILSKMGISLLSSYHGAQIFE--ILGLGQDVVDLAFSGTVS
GLTB1_ARATH     LEMRNGKIPTVTIEQAQKNYTKAVNAGLLKILSKMGISLLSSYCGAQIFE--IYGLGQDVVDLAFTGSVS
GLTB_MAIZE      LEMRNGKMPTVTIEQAQRNFIKAVKSGLLKILSKMGISLLSSYCGAQIFE--IYGLGQEVVDLAFCGSVS
GLTB_SPIOL      LEMRTGKIPTVTIEQAQNNFCKAVKSGLLKILSKMGISLLSSYCGAQIFE--IYGLGKDVVDIAFQGSVS
GLT1_YEAST      VRMNREGLLRNVNNDNDTLEEGQILENILKVMSKMGISTLASYKGAQIFEALGLDNS--IVDLCFTGTSS
GLTB_HORVU      ----------------------------------------------------------------------
GLUS_METJA      ----------------------------------------------------------------------
Y952_ARCFU      ----------------------------------------------------------------------
FWDC_METMP      ----------------------------------------------------------------------
FWDC_METJA      ----------------------------------------------------------------------
GLYA_DESAH      ----------------------------------------------------------------------
GLUS_METJA      ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           PVGGVTFAVIAQAVADWHRKALSVKGENDIPLLGLFKERAEGAGHSYGTTAVRGFVDMTEEKxxxxxxxx
GLTA_BACSU      QLGGIDLQTIAEEAQRRHREAYQDDYSKTLEPGSDFQWRNGGEHHAFNPKTI------------------
GLTB_AZOBR      RISGIGLNGIQKKVLEQHATAYN-EEVVALPVGGFYRFRKSGDRHGW-----------------------
GLTB_SYNY3      RIQGSDLGVIAQEAILRHQHAFAPRGDHTLDVGGEYQWRKDGEEHLFSPQTI------------------
GLTB_CYACA      RIGGLSFADLAMETIDLCSAGFSKLNKKKLDNHGFVQYRPGGEYH-------------------------
GLT1_SCHPO      RIRGVTFEHIALDAFALHERGYPTDRSLQIPDMGDFYYRDGGEQHVNHPKAIASLQDAVRNK--------
GLTB_PORPU      QIGGLSMEELGQETVNIHSKAFSQVKTKKLANYGFVQYRPGGEYH-------------------------
GLSN_MEDSA      RVEGATFEMLAQDALHLHELA-------------------------------------------------
GLTB_ECOLI      RIGGASFEDFQQDLLNLSKRAWLAR--KPISQGGLLKYVHGGEYHAYNPDVVR-----------------
GLTS_SYNY3      RVGGLTIADVAGEVMVFHGMA-------------------------------------------------
GLTB2_ARATH     QIGGLTLDELARETLTFWVRAFSEDTAKRLENFGFIQFRPGGEYH-------------------------
GLTB_PORYE      QIGGLSMIELGRETVNIHSKAFSEVKTKKLANYGFVQYRPGGEYH-------------------------
GLTB_ANTSP      RLNGMTLNELYEDSLKSYNLAFITEIPKKLPNLGYVQYRPSAEYH-------------------------
GLTB1_ARATH     KISGLTFDELARETLSFWVKAFSEDTTKRLENFGFIQFRPGGEYHS------------------------
GLTB_MAIZE      KIGGLTLDELGRETLSFWVKAFSEDTAKRLENFGFIQSRPGGEYHA------------------------
GLTB_SPIOL      KMGGLTLDELARETLSFWVKAFSEDTAKRLENFGFIQFRPGGEYH-------------------------
GLT1_YEAST      RIRGVTFEYLAQDAFSLHERGYTISKSVNLPESGEYHFRDGGYKHVNEPTAIASLQDTVRNK--------
GLTB_HORVU      ----------------------------------------------------------------------
GLUS_METJA      ----------------------------------------------------------------------
Y952_ARCFU      ----------------------------------------------------------------------
FWDC_METMP      ----------------------------------------------------------------------
FWDC_METJA      ----------------------------------------------------------------------
GLYA_DESAH      ----------------------------------------------------------------------
GLUS_METJA      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GLTA_BACSU      ----------------------------------------------------------------------
GLTB_AZOBR      ----------------------------------------------------------------------
GLTB_SYNY3      ----------------------------------------------------------------------
GLTB_CYACA      ----------------------------------------------------------------------
GLT1_SCHPO      ----------------------------------------------------------------------
GLTB_PORPU      ----------------------------------------------------------------------
GLSN_MEDSA      ----------------------------------------------------------------------
GLTB_ECOLI      ----------------------------------------------------------------------
GLTS_SYNY3      ----------------------------------------------------------------------
GLTB2_ARATH     ----------------------------------------------------------------------
GLTB_PORYE      ----------------------------------------------------------------------
GLTB_ANTSP      ----------------------------------------------------------------------
GLTB1_ARATH     ----------------------------------------------------------------------
GLTB_MAIZE      ----------------------------------------------------------------------
GLTB_SPIOL      ----------------------------------------------------------------------
GLT1_YEAST      ----------------------------------------------------------------------
GLTB_HORVU      ----------------------------------------------------------------------
GLUS_METJA      ----------------------------------------------------------------------
Y952_ARCFU      ----------------------------------------------------------------------
FWDC_METMP      ----------------------------------------------------------------------
FWDC_METJA      ----------------------------------------------------------------------
GLYA_DESAH      ----------------------------------------------------------------------
GLUS_METJA      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GLTA_BACSU      ----------------------------------------------------------------------
GLTB_AZOBR      ----------------------------------------------------------------------
GLTB_SYNY3      ----------------------------------------------------------------------
GLTB_CYACA      ----------------------------------------------------------------------
GLT1_SCHPO      ----------------------------------------------------------------------
GLTB_PORPU      ----------------------------------------------------------------------
GLSN_MEDSA      ----------------------------------------------------------------------
GLTB_ECOLI      ----------------------------------------------------------------------
GLTS_SYNY3      ----------------------------------------------------------------------
GLTB2_ARATH     ----------------------------------------------------------------------
GLTB_PORYE      ----------------------------------------------------------------------
GLTB_ANTSP      ----------------------------------------------------------------------
GLTB1_ARATH     ----------------------------------------------------------------------
GLTB_MAIZE      ----------------------------------------------------------------------
GLTB_SPIOL      ----------------------------------------------------------------------
GLT1_YEAST      ----------------------------------------------------------------------
GLTB_HORVU      ----------------------------------------------------------------------
GLUS_METJA      ----------------------------------------------------------------------
Y952_ARCFU      ----------------------------------------------------------------------
FWDC_METMP      ----------------------------------------------------------------------
FWDC_METJA      ----------------------------------------------------------------------
GLYA_DESAH      ----------------------------------------------------------------------
GLUS_METJA      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxIRTAPNSIPLETVQKASEITKTLASGAMSXXXXXXXXXXXXXX
GLTA_BACSU      ----------------------------------LKLEEVESAESIVKRFKTGAMSFGSLSKEAHEALAI
GLTB_AZOBR      ---------------------------LRSTKAPVPVDEVESITAIRKRFITPGMSMGALSPEAHGTLNV
GLTB_SYNY3      ---------------------------------SIPLEEVEPIEAIMKRFKTGAMSYGSISKEAHESLAI
GLTB_CYACA      ---------------------------------SVPLEKVENIFEITKRFCTGGMSLGALSREAHETLSI
GLT1_SCHPO      ---------------------------------AIPIEQVEPWTEIVRRFCTGAMSYGSISMESHSSLAI
GLTB_PORPU      ---------------------------LKSNKQPIAIDKVESMENILHKFCTGGMSLGALSRETHETLAI
GLSN_MEDSA      ----------------------------KDAASKVPISEVEPASEIVKRFCTGAMSYGSISLEAHTALAT
GLTB_ECOLI      ---------------------------ITPGENAVNIADVEPASELFKRFDTAAMSIGALSPEAHEALAE
GLTS_SYNY3      -----------------------------------------------KRFCTGGMSLGALSREAHETLAI
GLTB2_ARATH     --------------------------------NPIPVGKVEPASSIVERFCTGGMSLGAISRETHETIAI
GLTB_PORYE      ----------------------------------------------------------------------
GLTB_ANTSP      ---------------------------LKTDRQPISIDQVEDVNSVLMRFCTGGMSLGALSRETHETLAI
GLTB1_ARATH     ----------------------------------IPVGKVEPAVAIVQRFCTGGMSLGAISRETHEAIAI
GLTB_MAIZE      ----------------------------------IPIGKVESATSIVERFCTGGMSLGAISRETHEAIAI
GLTB_SPIOL      ----------------------------------ISVGKVEPATSIVERFCTGGMSLGAISRETHEAIAI
GLT1_YEAST      ---------------------------------SIPLEQVEPWTEIARRFASGAMSYGSISMEAHSTLAI
GLTB_HORVU      ----------------------------------------------------------------------
GLUS_METJA      ----------------------------------------------------------------------
Y952_ARCFU      ----------------------------------------------------------------------
FWDC_METMP      ----------------------------------------------------------------------
FWDC_METJA      ----------------------------------------------------------------------
GLYA_DESAH      ----------------------------------------------------------------------
GLUS_METJA      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           XTNMVGGMSNSGEGGEHISRYGTIRASRIKQFASGRFGVWAGYLADPMLEEIEIKIGQGAKPGEGGQLPS
GLTA_BACSU      AMNRLGGKSNSGEGGEDPKRFGDDRRSAIKQIASGRFGVKSHYLVNA--DELQIKMAQGAKPGEGGQLPG
GLTB_AZOBR      AMNRIGAKSDSGEGGEDPARFGDNWNSAIKQVASGRFGVTAEYLNQ--CRELEIKVAQGAKPGEGGQLPG
GLTB_SYNY3      AMNRIGGKSNTGEGGEDPERFGDSKNSAIKQVASGRFGVTSLYLSQA--KEIQIKMAQGAKPGEGGQLPG
GLTB_CYACA      AMNRIGGKSNSGEGGEDSLRFGDSLSSAIKQIASGRFGVTPEYLVNA--KQLEIKISQGAKPGEGGQLPG
GLT1_SCHPO      AMNRLGGKSNTGEGGEDPARSGDTMRSAIKQIASGRFGVTSWYLSDA--DELQIKMAQGAKPGEGGELPG
GLTB_PORPU      AMNRIGGKSNSGEGGEDPVRFGDTASSAIKQIASGRFGVTPEYLMNA--KQLEIKIAQGAKPGEGGQLPG
GLSN_MEDSA      AMNTIGGKSNTGEGGEQPSRMEPLKRSAIKQVASGRFGVSSYYLTNA--DELQIKMAQGAKPGEGGELPG
GLTB_ECOLI      AMNSIXXXXXXXXXXXDPARYGTNKVSRIKQVASGRFGVTPAYLVNA--DVIQIKVAQGAKPGEGGQLPG
GLTS_SYNY3      AMNRLGAKSNSGEGGEDVVRYGDTANSAIKQIASGRFGVTPEYLMSG--KQLEIKMAQGAKPGEGGQLPG
GLTB2_ARATH     AMNRLGGKSNSGEGGEHLKRNGDTATSAIKQVASGRFGVTPTFLVNA--DQLEIKVAQGAKPGEGGQLPG
GLTB_PORYE      --NRIGGKSNSGEGGEDPVRFGDTASSAIKQIASGRFGVTPEYLMNA--KQLEIKIAQGAKPGEGGQLPG
GLTB_ANTSP      RMNRIGGKSNSGEGGEDSTRFKSIQSSAIKQIASGRFGVTPEYLVNA--KQLEIKIAQGAKPGEGGQLPG
GLTB1_ARATH     AMNRIGGKSNSGEGGEDPIRWGDIATSAIKQVASGRFGVTPTFLVNA--DQLEIKVAQGAKPGEGGQLPG
GLTB_MAIZE      AMNRIGGKSNSGEGGEDPIRWGDTATSAIKQVASGRFGVTPTFLVNA--DQIEIKIAQGAKPGEGGQLPG
GLTB_SPIOL      AMNRLGGKSNSGEGGEDPIRWGDTATSAIKQVASGRFGVTPTFLVNA--DQIEIKIAQGAKPGEGGQLPG
GLT1_YEAST      AMNRLGAKSNCGEGGEDAERSGDTMRSAIKQVASARFGVTSYYLSDA--DEIQIKIAQGAKPGEGGELPA
GLTB_HORVU      ----------------------------------------------------------------------
GLUS_METJA      -----GTFMGTGEGGLPKALY-PYADHIITQVASGRFGVNEEYLMKG--SAIEIKIGQGAKPGIGGHLPG
Y952_ARCFU      ----------------------------------------------------------------------
FWDC_METMP      ----------------------------------------------------------------------
FWDC_METJA      ----------------------------------------------------------------------
GLYA_DESAH      ----------------------------------------------------------------------
GLUS_METJA      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           PKVTVEIAAARGGTPGVELVSPPPHHDTYSIEDLAQLIHDAKAARVRVIVKLVSSEGIGTIAVGVAKAGA
GLTA_BACSU      NKVYPWVADVRGSTPGVGLISPPPHHDIYSIEDLAQLIHDLKNANARISVKLVSKAGVGTIAAGVAKATA
GLTB_AZOBR      FKVTEMIARLRHSTPGVMLISPPPHHDIYSIEDLAQLIYDLKQINAKVTVKLVSRSGIGTIAAGVAKANA
GLTB_SYNY3      KKVYPWIAKVRHSTPGVGLISPPPHHDIYSIEDLAELIHDLKNANARINVKLVSEVGVGTIAAGVAKAHA
GLTB_CYACA      KKVSPYIATLRACKPGVTLISPPPHHDIYSIEDLAQLIFDLHQVNCKVSVKLVSEIGVGTIAVGVAKAGA
GLT1_SCHPO      NKVSESIAKTRHSTAGVGLISPPPHHDIYSIEDLKQLIYDMKSARARVSVKLVSEVGVGIVASGVAKAKA
GLTB_PORPU      KKISPYIATLRKCKPGVPLISPPPHHDIYSIEDLSQLIFDLHQINAKISVKLVSEIGIGTIAAGVAKGNA
GLSN_MEDSA      HKVIGDIAITRNSTAGVGLISPPPHHDIYSIEDLAQLIHDLKNANARISVKLVSEAGVGVIASGVVKGHA
GLTB_ECOLI      DKVTPYIAKLRYSVPGVTLISPPPHHDIYSIEDLAQLIFDLKQVKAMISVKLVSEPGVGTIATGVAKAYA
GLTS_SYNY3      KKVSEYIAMLRRSKPGVTLISPPPHHDIYSIEDLAQLIYDLHQINAQVSVKLVAEIGIGTIAAGVAKANA
GLTB2_ARATH     KKVSAYIARLRNSKPGVPLISPPPHHDIYSIEDLAQLIFDLHQVKAKVSVKLVSETGIGTVASGVAKANA
GLTB_PORYE      KKISPYIATLRKCKPGVPLISPPPHHDIYSIEDLSQLIFDLHQIKAKISVKLVSEIGIGTIAAGVAKGNA
GLTB_ANTSP      KKVSPYIAELRNCKPGVTLISPPPHHDIYSIEDLAQLIFDLHQINAQVSVKLVASLGIGTIAAGVAKGNA
GLTB1_ARATH     KKVSAYIARLRSSKPGVPLISPPPHHDIYSIEDLAQLIFDLHQINAKVSVKLVAEAGIGTVASGVAKGNA
GLTB_MAIZE      KKVSAYIARLRNSKPGVPLISPPPHHDIYSIEDLAQLIYDLHQPKAKVSVKLVSEAGIGTVASGVSKANA
GLTB_SPIOL      KKVSAYIARLRNSKPGVPLISPPPHHDIYSIEDLAQLIYDLHQPKAKVSVKLVAEAGIGTVASGVAKGNA
GLT1_YEAST      HKVSKDIAKTRHSTPNVGLISPPPHHDIYSIEDLKQLIYDLKCANPRISVKLVSEVGVGIVASGVAKAKA
GLTB_HORVU      ----------------------------------------------------------------------
GLUS_METJA      EKVTAEISATRMIPEGSDAISPAPHHDIYSIEDLAQLVRSLKEAKKPVFVKIAAVHNAPAIAVGIATSDA
Y952_ARCFU      ----------------------------------------------------------------------
FWDC_METMP      ----------------------------------------------------------------------
FWDC_METJA      ----------------------------------------------------------------------
GLYA_DESAH      ----------------------------------------------------------------------
GLUS_METJA      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1190
query           DVIXXXXXXXXXXXXXXXSLKYTGRAAEIGIAEVHQALCATGLRAKVLLRCSGAHQTASDVVKSALLGGD
GLTA_BACSU      DVIVISGYDGGTGASPKTSIKHTGLPWELGLAEAHQTLMLNGLRDRVVLETDGKLMTGRDVVMAALLGAE
GLTB_AZOBR      DIILISGNSGGTGASPQTSIKFAGLPWEMGLSEVHQVLTLNRLRHRVRLRTDGGLKTGRDIVIAAMLGAE
GLTB_SYNY3      DVVLVSGYDGGTGASPQTSIKHAGLPWELGLAETHQTLVLNNLRSRIVVETDGQMKTGRDVAIAALLGAE
GLTB_CYACA      EIIQISGHDGGTGASPLSSIKHAGVPWELGLHEVHCLLVENNLREKVILRVDGGLRTGQDVVMAALLGAD
GLT1_SCHPO      DHILVSGHDGGTGASRWTGIKYAGLPWELGVAETHQTLVLNDLRGRVVIQTDGQIRTGRDVAIACLLGAE
GLTB_PORPU      DIIQISGHDGGTGASPLSSIKHAGSPWELGLSEVHQLLAENQLRDRVTLRVDGGLRTGSDIVLAAIMGAE
GLSN_MEDSA      EHVLISGHDGGTGASRWTGIKSAGLPWELGLAETHQTLVANDLRGRTTLQTDGQLKTGRDVAIAALLGAE
GLTB_ECOLI      DLITIAGYDGGTGASPLSSVKYAGCPWELGLVETQQALVANGLRHKIRLQVDGGLKTGVDIIKAAILGAE
GLTS_SYNY3      DIIQISGHDGGTGASPLSSIKHAGSPWELGVTEVHRVLMENQLRDRVLLRADGGLKTGWDVVMAALMGAE
GLTB2_ARATH     DIIQISGYDGGTGASPISSIKHAGGPWELGLAETQKTLIGNGLRERVIIRVDGGFKSGVDVLIAAAMGAD
GLTB_PORYE      DIIQISGHDGGTGASPLSSIKHAGSPWELGLSEVHQLLAENQLRDRVTLRVDGGLRTGSDIVLAAIMGAE
GLTB_ANTSP      DIIQISGHDGGTGASPLSSIKHAGAPWDVGLAEVHTTLVENSLREKVILRVDGGLRTGKDIIIAALMGAE
GLTB1_ARATH     DIIQISGHDGGTGASPISSIKHAGGPWELGLTETHQTLIANGLRERVILRVDGGLKSGVDVLMAAAMGAD
GLTB_MAIZE      DIIQISGHDGGTGASPISSIKHAGGPWELGLTETNQTLIQNGLRERVVLRVDGGFRSGQDVLIAAAMGAD
GLTB_SPIOL      DIIQVSGHDGGTGASPISSIKHAGGPWELGLSETHQTLISNGLRERVILRVDGGLKCXXXXXXXXXXXXX
GLT1_YEAST      DHILVSGHDGGTGAARWTSVKYAGLPWELGLAETHQTXXXXXXXXXXXXQTDGQLRTGFDIAVAVLLGAE
GLTB_HORVU      ----------------------------------------------------------------------
GLUS_METJA      DAVVIDGYKGGTGAAPKVFRDHVGIPIEMAIAAVDQRLREEGLRNEISIIASGGIRCSADVFKAIALGAD
Y952_ARCFU      ----------------------------------------------------------------------
FWDC_METMP      ----------------------------------------------------------------------
FWDC_METJA      ----------------------------------------------------------------------
GLYA_DESAH      ----------------------------------------------------------------------
GLUS_METJA      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:1260
query           SFEFGTTALMMLKCVMAKNCNIKCPAGLTTNQEAFNGDPRALAQYLMNIAHETREILAGLGLRSLREARG
GLTA_BACSU      EFGFATAPLVVLGCVMMRACHLDCPVGVATQRKKFMGDPDHIVNYMLFIAEEVREYMAALGFKTFDEMIG
GLTB_AZOBR      EFGIGTASLIAMGCIMVRQCHSNCPVGVCVQRQKFVGTPEKVVNLFTFLAEEVREILAGLGFRSLNEVIG
GLTB_SYNY3      EFGFSTAPLVSLGCIMMRACHLNCPVGIATQRAKFTGDPAHAVNFMTFIATELREVMAQLGFRTINEMVG
GLTB_CYACA      EYGFGTIAMIAGGCIMARVCHTSCPVGVATQKERYPGVPENVVNYFIFLAEEIRVILSKLGFETLSQIIG
GLT1_SCHPO      EWGFATTPLIALGCIMMRKCHLNCPVGIATQRKKFEGQPEHVVNFFYYVAEELRGIMAKLGFRTINEMVG
GLTB_PORPU      EFGFGTIAMIATGCIMARICHTKCPVGVATQRERFSGVPEALVNFFLFIGNEVREILASLGYKSLDEITG
GLSN_MEDSA      EYGFSTAPLITLGCIMMRKCHKNCPVGIATQREKFAGEPEHVINFFFMVAEEMREIMSQLGFRTVNEMVG
GLTB_ECOLI      SFGFGTGPMVALGCKYLRICHLNCATGVATQDDKYHGLPFKVTNYFEFIARETRELMAQLGVTRLVDLIG
GLTS_SYNY3      EYGFGSIAMIAEGCIMARVCHTNCPVGVATQQERFKGVPGQVVNFFYFIAEEVRSLLAHLGYRSLDDIIG
GLTB2_ARATH     EYGFGTLAMIATGCIMARICHTNCPVGVASQRERFPGLPGDLVNFFLYIAEEVRGILAQLGYEKLDDIIG
GLTB_PORYE      EFGFGTVAMIATGCIMARICHTKCPVGVATQRERFSGVPEALVNFFLFIGNEVREILASLGYKSLDDITG
GLTB_ANTSP      EFGFGTVAMIATGCVMARVCHTNCPVGVATQRQRFPGIPSDVVNFFIFVAEEVREILAELGYKSLEELIG
GLTB1_ARATH     EYGFGSLAMIATGCVMARICHTNCPVGVASQRERFPGVPGDLVNYFLYVAEEVRGILAQLGYNSLDDIIG
GLTB_MAIZE      EYGFGSVAMIATGCVMARICHTNCPVGVASQRERFPGVPGDLVNYFLFVAEEVRAALAQLGYEKLDDIIG
GLTB_SPIOL      EYGFGSLAMIATGCVMARICHTNCPVGVASQRERFPGVPGDLVNFFLYVAEEVRGILAQLGFEKLDDIIG
GLT1_YEAST      SFTLATVPLIAMGCVMLRRCHLNCAVGIATQRSKFKGQPEHVINFFYYLIQDLRQIMAKLGFRTIDEMVG
GLTB_HORVU      ----------------------------------------------------------------------
GLUS_METJA      AVYIGTAAMVALGCRVCGRCYTLCAWGIATQRPELRLDPEVGARRVANLTHEIKELLGAAGINSIESLRG
Y952_ARCFU      ----------------------------------------------------------------------
FWDC_METMP      ----------------------------------------------------------------------
FWDC_METJA      ----------------------------------------------------------------------
GLYA_DESAH      ----------------------------------------------------------------------
GLUS_METJA      ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:1330
query           RSDLLHLLDHPASVGQLDLRAMLAVVEEVKIDNPVYMEKDFALDDAFIELVRSALVDSRRENIELGGNRF
GLTA_BACSU      RTDVLHASERAKEASQLDLSTLLYQPEGVRFQSPQNHKIDQSLDTTILPAVQEAIESGKEADISIE----
GLTB_AZOBR      RTDLLHQVSRGAELDDLDLNPRLAQVDPG--ENARYCEVPDTLDARIVADARPLFEEG--EKMQLAYN--
GLTB_SYNY3      RTDILEAVAHWKAKG-IDLSTILHQ-PEVGDDVGRYCQQDHGLQHSLLDLCQPAIAKGEKVTATLP----
GLTB_CYACA      RKDLIHNFDKKCKTHCIDTSIFFNIKEYNFLEIPGGHSKKLKTSLLDYELLNSSDILYAIDNHKLEKHIK
GLT1_SCHPO      RSDKLKVAEPINNKSKLDLTPLLTPAFTLRPGAATYNVRK--QDHRLYTRLDNKLIDEAEVTLEEG----
GLTB_PORPU      QNHLLNTDIELAKTRGIELNSLINIFNSVHTNGPV-------MDDDILAI--PEINDAIKLENEVAKHFK
GLSN_MEDSA      RSDMLEVVKGNAKLENIDLSLLLRPAAELRPEAAQYCVQDMALDNKLISLSNAALEKGLPVYIETP----
GLTB_ECOLI      RTDLLKELDGFTXXXXXXXXXXXXETAEPHPGKALYCTEDNGXXXXXXXXXXKPFVDERQSKTFWFD---
GLTS_SYNY3      RTDLLKVRSQLSKTQNLTLDCLLNLPEPVHSNGPV-LDDDILADPDIQEAINHQTTATKTYR--------
GLTB2_ARATH     RTDLLKARDISLVKTHLDLSYLLSSVQEVHSNGPV-------LDDTLLQ--DPEIMDAIENEKTVHKTMS
GLTB_PORYE      QN---HLLIKNTDINQLDTLININNNTWTKF-NSVHTNGPVMDDDI---LAIPEVSNAIKLETEITKHFK
GLTB_ANTSP      LNDLFKVKDIELSKTKXXXXXXXXXXXXXKLKHKTVHTNGNVLDD--ILLSKSNIINAINLQSNIVQDIE
GLTB1_ARATH     RTELLRPRDSLVKTQHLDLSYLLSSVQEVHTNGPV-LDDDILADPLVIDAIENEKVVEKTVKI-------
GLTB_MAIZE      RTDLLKVKTQHIDLGYLLSNAGLPEWSSSQIRSQDVHTNGPVLDETI--LADPEIADAIENEKEVSKAFQ
GLTB_SPIOL      RTDILKPRDISLMKTQLDLSYILASAQEVHTNGPV-LDDQILSDPEIIDAIENEKIVNKTVKI-------
GLT1_YEAST      HSEKLKKRDDVAKAINIDLSPILTPAHVIRPGVPTKFTKKTRLDNKLIDEAEVTLDRGLPVNIDAS----
GLTB_HORVU      ----------------------------------------------------------------------
GLUS_METJA      NRDRL-----------------------------------------------------------------
Y952_ARCFU      ----------------------------------------------------------------------
FWDC_METMP      ----------------------------------------------------------------------
FWDC_METJA      ----------------------------------------------------------------------
GLYA_DESAH      ----------------------------------------------------------------------
GLUS_METJA      ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:1400
query           LNNCNKSVGGQLAVDIERMLNHELSDEQLDALPAVKRDSRGRRFLEAGSVRIDTSGSAGQSFGAFCNDGM
GLTA_BACSU      INNTNRVAGTITGSEISKRY--------------------GEEGLPEDTIKLHFTGSAGQSFGAFVPKGM
GLTB_AZOBR      ARNTQRAIGTRLSSMVTRKF--------------------GMFGLQPGHITIRLRGTAGQSLGAFAVQGI
GLTB_SYNY3      ITNINRVVG--------TIVGNEITKRHWEGLPE-------------DTVHLHFQGSAGQSFGAFIPKGM
GLTB_CYACA      ISNSDRSVGAKLAGRLAKQYKNE-----------------GFR----GSLILNFYGTAGQSFGSFNIKGV
GLT1_SCHPO      ----IPSVVECEIINTDRTLGATLSNK------ISKR--YGEEGLPTDSIRVNVFGSAGQSFGAFLAPGV
GLTB_PORPU      IANTNRTVG-----------------TRLSGVIAQKYGNEGFK----GLIKLNFYGSAGQSFGAFLASGV
GLSN_MEDSA      ICNTNRAVGTMLSHEVTKRYN-------LAGLPA-------------DTIHIQFTGSAGQSFGAFLCPGI
GLTB_ECOLI      IRNTDRSVGASLSGYIAQ--------------------THGDQGLAADPIKAYFNGTAGQSFGVWNAGGV
GLTS_SYNY3      LVNTDRTVGTRLSGAI-----------------AKKYGNNGFE----GNITLNFQGAAGQSFGAFNLDGM
GLTB2_ARATH     IYNVDRSVCGRIA-----------------GVIAKKYGDTG----FAGQLNLTFTGSAGQSFACFLTPGM
GLTB_PORYE      IANTNRTVG-----------------TRLSGIIAKNYGNTGFK----GLIKLNFYGSAGQSFGAFLASGI
GLTB_ANTSP      ILNTDRCVGARISGLITKMYGRDNFN---------------------GNLQLNFVGSAGQSFGAFISKGI
GLTB1_ARATH     -CNVDRAACGRVA-----------------GVIAKKYGDTG----FAGQVNLTFLGSAGQSFGCFLIPGM
GLTB_MAIZE      IYNVDRAVCGRVA-----------------GVIAKKYGDTG----FAGQLNITFNGSAGQSFGCFLTPGM
GLTB_SPIOL      -FNVDRAVCGRIA-----------------GVIAKKYGDTG----FAGQLNLTFEGSAGQSFAVFLTPGM
GLT1_YEAST      IINTDRALGSTLSYRVSKKFGE-------DGLPK-------------DTVVVNIEGSAGQSFGAFLASGI
GLTB_HORVU      ----------------------------------------------------------------------
GLUS_METJA      ----------------------------------------------------------------------
Y952_ARCFU      ----------------------------------------------------------------------
FWDC_METMP      ------------------------------------------------SGEIVVNGDAGMYIGVEMKGGK
FWDC_METJA      -------VQGRKRIKVADIFDVELNDIEGEPRIVIKNSSPKLKYIGSKMTKIVVEGDAGMYVGAEMKGGK
GLYA_DESAH      ----------------------------------------------------------------------
GLUS_METJA      ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:1470
query           IMVHTGTCNDGVGKSACGGTIVVRSPGGGSKETGGNVLVGNFALFGATGGRTFVEGQAGDRFAVRNSGAT
GLTA_BACSU      TLYLDGDSNDYVGKGLSGGKIIVKSSEGFNSASDDNVIIGNVAFYGATSGEAYINGRAGERFAVRNSGVN
GLTB_AZOBR      KLEVMGDANDYVGKGLSGGTIVVRPTTSSPLETNKNTIIGNTVLYGATAGKLFAAGQAGERFAVRNSGAT
GLTB_SYNY3      TLELEGDANDYLGKGLSGGKIIVYPPKGSSFIASENIIAGNVCLYGATAGEVYISGMVGERFCVRNSGVN
GLTB_CYACA      TLRLIGEANDYVGKSMSGGEIVIVPPSEVAFDASEQVILGNTCLYGATGGFLFAYGAAGERFAVRNSNAF
GLT1_SCHPO      TLQLEGDCNDYVGKGLSGGRLIIYPPRVSPFKPEENMIIGNVCLYGATSGHAFISGVAAERFAVRNSGAI
GLTB_PORPU      NLKLMGEANDYVGKGMNGGSIIIVPPAGTTYEDNNQVIIGNTCLYGATGGYLFAQGQAGERFAVRNSLAK
GLSN_MEDSA      TLELEGDSNDYIGKGLSGGKVVVYPPKGSNFDPKDNILIGNVALYGATRGEAYFNGMAAERFCVRNSGAL
GLTB_ECOLI      ELYLTGDANDYVGKGMAGGLIAIRPPVGSAFRSHEASIIGNTCLYGATGGRLYAAGRAGERFGVRNSGAI
GLTS_SYNY3      TLHLQGEANDYVGKGMNGGEIVIVPHPQASFAPEDNVIIGNTCLYGATGGNLYANGRAGERFAVRNSVGK
GLTB2_ARATH     NIRLVGEANDYVGKGMAGGEVVILPVESTGFRPEDATIVGNTCLYGATGGLLFVRGKAGERFAVRNSLAQ
GLTB_PORYE      NLKLMGEANDYVGKGMNGGSIVIVPPAGTIYEDNNQVIIGNTCLYGATGGYLFAQGQAGERFAVRNSLAE
GLTB_ANTSP      HLYLKGEANDYVGKGMNGGEIIICPPIEQKTSSSNQVILGNTCLYGATGGYLFANGQAGERFAVRNSNGY
GLTB1_ARATH     NIRLIGESNDYVGKGMAGGEIVVTPVEKIGFVPEEATIVGNTCLYGATGGQIFARGKAGERFAVRNSLAE
GLTB_MAIZE      NIRLVGEANDYVGKGMAGGELVVVPVDKTGFVPEDATIVGNTCLYGATGGQVFVRGKAGERFAVRNSLCQ
GLTB_SPIOL      NIRLVGESNDYVGKGMAGGELIVTPAENPGFRPEDATIVGNTCLYGATGGQIFVRGKAGERFAVRNSLAE
GLT1_YEAST      TFILNGDANDYVGKGLSGGIIVIKPPKDSKFKSDENVIVGNTCFYGATSGTAFISGSAGERFGVRNSGAT
GLTB_HORVU      ----------------------------------------------------------------------
GLUS_METJA      ----------------------------------------------------------------------
Y952_ARCFU      ----------------------------------------------------------------------
FWDC_METMP      ITVN-GDAESWVGQNLKGGEIIIN---GNAENYVGSAYRGDWR--GMSGGKITITGNAGSELGEYLKGGT
FWDC_METJA      IVVN-GNAESWAGQNMKGGELLIK---GNAGDYVGSAYRGDWR--GMSGGTIIVEGNAGN----------
GLYA_DESAH      ----------------------------------------------------------------------
GLUS_METJA      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:1540
query           AVVEGVGDFACEYMTNGAVXXXXXXXXXXXXXXXXXFVYQYDPYGDLPKKVSHDSILLGSITGEDEQAAI
GLTA_BACSU      VVVEGIGDHGCEYMTGGSVVVLGDVGKNFAAGMSGGIAYVLEDVKAFKRKCNLEMILFESLEDEKE----
GLTB_AZOBR      VVVEGCGSNGCEYMTGGTAVILGRVGDNFAAGMTGGMAYVYDLDDSLPLYINDESVIFQRI-----EVGH
GLTB_SYNY3      TVVEAVGDHGCEYMTGGKVVVLGQTGRNFAAGMSGGVAYIFDETGDFATRC--NSAMVGLEKLEDPEEI-
GLTB_CYACA      SVLEGVGDHACEYMTGGRVVVLGKAGRNIAAGMTGGIAYFLDEYSNLPEKVNLDIVRI--------QRVV
GLT1_SCHPO      AVVEGVGDHGCEYMTGGRVVILGSTGRNFAAGMSGGIAYVYDMQMDFAGKINTEMVDISSVTDAAEIAFL
GLTB_PORPU      SVVEGVGDHACEYMTGGTIVVLGKAGRNVGAGMTGGLAYFLDEENKFIERVNSEIVKVQRVITKAGEQQL
GLSN_MEDSA      AVVEGVGDHGCEYM--------------------------------------------------------
GLTB_ECOLI      TVVEGIGDNGCEYMTGGIVCILGKTGVNFGAGMTGGFAYVLDESGDFRKRVNPELVEVLSV----DALAI
GLTS_SYNY3      AVIEGAGDHCCEYMTGGVIVVLGPVGRNVGAGMTGGLAYFLDEVGDLPEKINPEIITLQRIT-----ASK
GLTB2_ARATH     AVVEGTGDHCCEYMTGGCVVILGKVGRNVAAGMTGGLAYILDEDNTLLPKMNKEIVKIQRVTSPVGQTQL
GLTB_PORYE      SVVEGVGDHACEYMTGGVIVVLGKAGRNVGAGMTGGLAYFLDEDENFIDRVNSEIVKIQRVITKAGEEQL
GLTB_ANTSP      SVVEGVGDHACEYMTGGLIVVLGTFGRNIGAGMTGGIAYFLDEDNTLKNKLNTEIVKAQRLLTKESEEQL
GLTB1_ARATH     AVVEGTGDHCCEYMTGGCVVVLGKVGRNVAAGMTGGLAYLLDEDDTLLPKINREIVKIQRVT-----APA
GLTB_MAIZE      AVVEGTGDHCCEYMTGGCVVVLGKAGRNVAAGMTGGLAYILDEDDTLVPKVNKEIVKMQRVNAPAGQMQL
GLTB_SPIOL      AVVEGTGDHCCEYMTGGCVVILGKVGRNVAAGMTGGLAYILDEDDTLIPKVNKEIVKIQRVTAPVGQMQL
GLT1_YEAST      IVVERIGNNAFEYMTGGAIVLSQMESLNAFSGATGGIAYLTSDYDDFVGKINKDTVELESLCDPVEIAFV
GLTB_HORVU      ----------------------------------------------------------------------
GLUS_METJA      ----------------------------------------------------------------------
Y952_ARCFU      ----------------------------------------------------------------------
FWDC_METMP      IVIKG-----------------------------------------------------------------
FWDC_METJA      ----------------------------------------------------------------------
GLYA_DESAH      ----------------------------------------------------------------------
GLUS_METJA      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:1610
query           HNQAVHQLLTLHVAETGSAKAAWLLENWESEQHNFAYGMPRALLxxxxxxxxxxxxxxxxxxxxxxxxxx
GLTA_BACSU      -IQQIKAMLERHTAYTNSQKAEDLLDQWEDSVKKFVKVIPK-----------------------------
GLTB_AZOBR      YESQLKHLIEEHVTETQSRFAAEILNDWAREVTKFWQVVPKEML--------------------------
GLTB_SYNY3      --KDLKELIQNHVNYTDSAKGKAVLADWEASIPKFVKVMPR-----------------------------
GLTB_CYACA      TNEARKQLIQLHVLKTGSKKAVLILQQWEIFIHYF-----------------------------------
GLT1_SCHPO      RG-----LIQDHRHYTGSQVADRILSDFPRHLSRFVKVLPR-----------------------------
GLTB_PORPU      KN-----LIENHSAKTGSLKAHNILENWNTYLPQFWQVVP------------------------------
GLSN_MEDSA      ----------------------------------------------------------------------
GLTB_ECOLI      HEEHLRGLITEHVQHTGSQRGEEILANWSTFATKFALVKPKS----------------------------
GLTS_SYNY3      GEEQLKSLITAHVEHTGSPKGKAILANWSDYLGKFWQAVP------------------------------
GLTB2_ARATH     KS-----LIQAHVEKTGSSKGAMIVEEWD-----------------------------------------
GLTB_PORYE      KN-----LIENHAAKTGSLKAHTILEKWNSYLPQFWQVVP------------------------------
GLTB_ANTSP      KN-----IMELYEIKTKSEKAKLILDNWSQYLAKFYQIVP------------------------------
GLTB1_ARATH     GELQLKSLIEAHVEKTGSSKGATILNEWE-----------------------------------------
GLTB_MAIZE      KG-----LIEAYVEKTGSEKGIAILREWEA----------------------------------------
GLTB_SPIOL      KN-----LIEAHVEKTGSSKGASILKDWD-----------------------------------------
GLT1_YEAST      KN-----LIQEHWNYTQSDLAARILGNFNHYLKDFVKVIP------------------------------
GLTB_HORVU      ----------------------------------------------------------------------
GLUS_METJA      ----------------------------------------------------------------------
Y952_ARCFU      ----------------------------------------------------------------------
FWDC_METMP      ----------------------------------------------------------------------
FWDC_METJA      ----------------------------------------------------------------------
GLYA_DESAH      ----------------------------------------------------------------------
GLUS_METJA      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:1680
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GLTA_BACSU      ----------------------------------------------------------------------
GLTB_AZOBR      ----------------------------------------------------------------------
GLTB_SYNY3      ----------------------------------------------------------------------
GLTB_CYACA      ----------------------------------------------------------------------
GLT1_SCHPO      ----------------------------------------------------------------------
GLTB_PORPU      ----------------------------------------------------------------------
GLSN_MEDSA      ----------------------------------------------------------------------
GLTB_ECOLI      ----------------------------------------------------------------------
GLTS_SYNY3      ----------------------------------------------------------------------
GLTB2_ARATH     ----------------------------------------------------------------------
GLTB_PORYE      ----------------------------------------------------------------------
GLTB_ANTSP      ----------------------------------------------------------------------
GLTB1_ARATH     ----------------------------------------------------------------------
GLTB_MAIZE      ----------------------------------------------------------------------
GLTB_SPIOL      ----------------------------------------------------------------------
GLT1_YEAST      ----------------------------------------------------------------------
GLTB_HORVU      ----------------------------------------------------------------------
GLUS_METJA      ----------------------------------------------------------------------
Y952_ARCFU      ----------------------------------------------------------------------
FWDC_METMP      ----------------------------------------------------------------------
FWDC_METJA      ----------------------------------------------------------------------
GLYA_DESAH      ----------------------------------------------------------------------
GLUS_METJA      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1750
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GLTA_BACSU      ----------------------------------------------------------------------
GLTB_AZOBR      ----------------------------------------------------------------------
GLTB_SYNY3      ----------------------------------------------------------------------
GLTB_CYACA      ----------------------------------------------------------------------
GLT1_SCHPO      ----------------------------------------------------------------------
GLTB_PORPU      ----------------------------------------------------------------------
GLSN_MEDSA      ----------------------------------------------------------------------
GLTB_ECOLI      ----------------------------------------------------------------------
GLTS_SYNY3      ----------------------------------------------------------------------
GLTB2_ARATH     ----------------------------------------------------------------------
GLTB_PORYE      ----------------------------------------------------------------------
GLTB_ANTSP      ----------------------------------------------------------------------
GLTB1_ARATH     ----------------------------------------------------------------------
GLTB_MAIZE      ----------------------------------------------------------------------
GLTB_SPIOL      ----------------------------------------------------------------------
GLT1_YEAST      ----------------------------------------------------------------------
GLTB_HORVU      ----------------------------------------------------------------------
GLUS_METJA      ----------------------------------------------------------------------
Y952_ARCFU      ----------------------------------------------------------------------
FWDC_METMP      ----------------------------------------------------------------------
FWDC_METJA      ----------------------------------------------------------------------
GLYA_DESAH      ----------------------------------------------------------------------
GLUS_METJA      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1820
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GLTA_BACSU      --------------------------------
GLTB_AZOBR      --------------------------------
GLTB_SYNY3      --------------------------------
GLTB_CYACA      --------------------------------
GLT1_SCHPO      --------------------------------
GLTB_PORPU      --------------------------------
GLSN_MEDSA      --------------------------------
GLTB_ECOLI      --------------------------------
GLTS_SYNY3      --------------------------------
GLTB2_ARATH     --------------------------------
GLTB_PORYE      --------------------------------
GLTB_ANTSP      --------------------------------
GLTB1_ARATH     --------------------------------
GLTB_MAIZE      --------------------------------
GLTB_SPIOL      --------------------------------
GLT1_YEAST      --------------------------------
GLTB_HORVU      --------------------------------
GLUS_METJA      --------------------------------
Y952_ARCFU      --------------------------------
FWDC_METMP      --------------------------------
FWDC_METJA      --------------------------------
GLYA_DESAH      --------------------------------
GLUS_METJA      --------------------------------