[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for atum0:AAK86001.1

[Show Plain Result]


## Summary of Sequence Search
    1::153
   14::156     4e-42  59%  156 aa  PHNG_RHIME RecName: Full=Protein phnG;
    8::149     3e-20  35%  150 aa  PHNG_ECOLI RecName: Full=Protein phnG;
  167::241     7e-05  31%  304 aa  ESF2_ASPNC RecName: Full=Pre-rRNA-processing protein esf2;AltName:
  211::279     1e-04  34%  365 aa  ESF2_NEOFI RecName: Full=Pre-rRNA-processing protein esf2;AltName:
  211::279     1e-04  34%  361 aa  ESF2_ASPFU RecName: Full=Pre-rRNA-processing protein esf2;AltName:
  207::272     2e-04  33%  356 aa  ESF2_COCIM RecName: Full=Pre-rRNA-processing protein ESF2;AltName:
    1::153

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxSERKRVAALLARATVQELETVWSRQDASPQTENVRGPETGLVMVKGRIGGGGAPFNLGETT
PHNG_RHIME      ---------AQRREGMRLLARATLGELSLAWDAIDDKPEVAPVRGPETGLVMVRGKIGGGGDPFNLGEAT
PHNG_ECOLI      -----------RQHWMSVLAHSQPAELAARLNALNITADYEVIRAAETGLVQIQARMGGTGERFFAGDAT
ESF2_ASPNC      ----------------------------------------------------------------------
ESF2_NEOFI      ----------------------------------------------------------------------
ESF2_ASPFU      ----------------------------------------------------------------------
ESF2_COCIM      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VTRATVKLASGTVGHAHVLGTGRKKAWYAAVFDALWQESQTRGFIEAELLSPVEKRLSEEKQRKTKETAA
PHNG_RHIME      VSRATVRLSTGEVGHGQLLGTDKARARLAAIFDALFQSAAHRASVEA-LHEQVAARLDAEDRRKAEETAA
PHNG_ECOLI      LTRAAVRLTDGTLGYSWVQGRDKQHAERCALIDALMQQSRHFQNLSETLIAPLDADRMARIAARQAEVNA
ESF2_ASPNC      -SKKTAKICAETL-NATIIG-GKKGGWY---HDDVWNMKYLKGFRWADLMEQVQRERSEREARKRVEDSR
ESF2_NEOFI      -SKKTAKICAETL-NATIVG-GKKGGWY---HDDVWNMKYLKGFKWADLMEQVQRERSEEAKRRIEDTRA
ESF2_ASPFU      -SKKTAKICAETL-NATIVG-GKKGGWY---HDDVWNMKYLKGFKWADLMEQVQRERSEEAKRRIEDTRA
ESF2_COCIM      -SKRTAKICAETL-NATIVG-GKKGGWY---HDDVWNMKYLRGFKWADLMEQVQRERKETEARRRVEDAK


                         +         .         .         .         .         *         .:210
query           TRVDFFTMVRGED
PHNG_RHIME      TRVDFFTMVRGED
PHNG_ECOLI      SRVDFFTMVRGDN
ESF2_ASPNC      ARKEDKVFLEG--
ESF2_NEOFI      RKED---------
ESF2_ASPFU      RKED---------
ESF2_COCIM      AR-----------