[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for atum0:AAK86109.1

[Show Plain Result]


## Summary of Sequence Search
    1::268
    1::253     e-119 100%  268 aa  UPPP1_AGRT5 RecName: Full=Undecaprenyl-diphosphatase 1;       
    1::253     1e-84  73%  268 aa  UPPP_RHISN RecName: Full=Undecaprenyl-diphosphatase;       
    1::253     7e-84  72%  268 aa  UPPP_RHIME RecName: Full=Undecaprenyl-diphosphatase;       
    1::253     8e-83  72%  268 aa  UPPP_SINMW RecName: Full=Undecaprenyl-diphosphatase;       
    5::253     9e-74  55%  268 aa  UPPP_BRUSU RecName: Full=Undecaprenyl-diphosphatase;       
    5::253     9e-74  55%  268 aa  UPPP_BRUSI RecName: Full=Undecaprenyl-diphosphatase;       
    5::253     9e-74  55%  268 aa  UPPP_BRUO2 RecName: Full=Undecaprenyl-diphosphatase;       
    5::253     9e-74  55%  268 aa  UPPP_BRUME RecName: Full=Undecaprenyl-diphosphatase;       
    5::253     9e-74  55%  268 aa  UPPP_BRUMB RecName: Full=Undecaprenyl-diphosphatase;       
    5::253     9e-74  55%  268 aa  UPPP_BRUC2 RecName: Full=Undecaprenyl-diphosphatase;       
    5::253     9e-74  55%  268 aa  UPPP_BRUAB RecName: Full=Undecaprenyl-diphosphatase;       
    5::253     9e-74  55%  268 aa  UPPP_BRUA2 RecName: Full=Undecaprenyl-diphosphatase;       
    5::253     9e-74  55%  268 aa  UPPP_BRUA1 RecName: Full=Undecaprenyl-diphosphatase;       
    5::253     1e-73  56%  268 aa  UPPP_OCHA4 RecName: Full=Undecaprenyl-diphosphatase;       
    1::253     1e-69  57%  268 aa  UPPP1_RHILO RecName: Full=Undecaprenyl-diphosphatase 1;       
    1::253     4e-69  53%  268 aa  UPPP_MESSB RecName: Full=Undecaprenyl-diphosphatase;       
    5::251     2e-68  53%  266 aa  UPPP_PHEZH RecName: Full=Undecaprenyl-diphosphatase;       
   17::251     5e-66  54%  266 aa  UPPP_CAUCR RecName: Full=Undecaprenyl-diphosphatase;       
   17::251     5e-66  54%  266 aa  UPPP_CAUCN RecName: Full=Undecaprenyl-diphosphatase;       
   18::252     4e-62  58%  267 aa  UPPP_PARDP RecName: Full=Undecaprenyl-diphosphatase;       
    5::253     6e-59  53%  268 aa  UPPP_RHOP2 RecName: Full=Undecaprenyl-diphosphatase;       
    6::253     8e-59  53%  268 aa  UPPP_BRASO RecName: Full=Undecaprenyl-diphosphatase;       
    5::253     1e-58  54%  268 aa  UPPP_RHOPT RecName: Full=Undecaprenyl-diphosphatase;       
    5::253     1e-58  47%  268 aa  UPPP_RHOPS RecName: Full=Undecaprenyl-diphosphatase;       
    5::253     1e-58  54%  268 aa  UPPP_RHOPA RecName: Full=Undecaprenyl-diphosphatase;       
    6::253     1e-58  53%  268 aa  UPPP_BRASB RecName: Full=Undecaprenyl-diphosphatase;       
    5::253     5e-57  51%  268 aa  UPPP_RHOP5 RecName: Full=Undecaprenyl-diphosphatase;       
    5::253     1e-56  46%  268 aa  UPPP_BRAJA RecName: Full=Undecaprenyl-diphosphatase;       
    5::253     3e-56  52%  268 aa  UPPP_RHOPB RecName: Full=Undecaprenyl-diphosphatase;       
    6::253     5e-56  45%  268 aa  UPPP_NITWN RecName: Full=Undecaprenyl-diphosphatase;       
    6::253     1e-53  44%  268 aa  UPPP_NITHX RecName: Full=Undecaprenyl-diphosphatase;       
   21::253     4e-52  53%  268 aa  UPPP_RHOS4 RecName: Full=Undecaprenyl-diphosphatase;       
   21::253     4e-52  53%  268 aa  UPPP_RHOS1 RecName: Full=Undecaprenyl-diphosphatase;       
    5::253     6e-51  48%  268 aa  UPPP_OLICO RecName: Full=Undecaprenyl-diphosphatase;       
    1::253     1e-49  40%  268 aa  UPPP_PARL1 RecName: Full=Undecaprenyl-diphosphatase;       
    6::254     4e-48  42%  274 aa  UPPP_ACIAC RecName: Full=Undecaprenyl-diphosphatase;       
    6::257     1e-47  41%  277 aa  UPPP_RHOFD RecName: Full=Undecaprenyl-diphosphatase;       
    6::257     1e-47  41%  277 aa  UPPP_POLSJ RecName: Full=Undecaprenyl-diphosphatase;       
    6::253     2e-47  40%  273 aa  UPPP_NITMU RecName: Full=Undecaprenyl-diphosphatase;       
   15::253     2e-46  41%  267 aa  UPPP_ZYMMO RecName: Full=Undecaprenyl-diphosphatase;       
   21::253     3e-46  51%  268 aa  UPPP_RHOS5 RecName: Full=Undecaprenyl-diphosphatase;       
    6::254     5e-46  43%  274 aa  UPPP_DIAST RecName: Full=Undecaprenyl-diphosphatase;       
    6::254     6e-46  43%  274 aa  UPPP_ACISJ RecName: Full=Undecaprenyl-diphosphatase;       
    1::254     8e-46  40%  266 aa  UPPP3_ACIAD RecName: Full=Undecaprenyl-diphosphatase 3;       
    9::253     7e-45  38%  276 aa  UPPP_PSEMY RecName: Full=Undecaprenyl-diphosphatase;       
    6::254     2e-44  39%  274 aa  UPPP2_RHORT RecName: Full=Undecaprenyl-diphosphatase 2;       
   10::260     3e-44  41%  273 aa  UPPP_ERWT9 RecName: Full=Undecaprenyl-diphosphatase;       
    2::250     3e-44  38%  270 aa  UPPP1_CHRVO RecName: Full=Undecaprenyl-diphosphatase 1;       
    6::254     2e-43  36%  273 aa  UPPP_NEIMB RecName: Full=Undecaprenyl-diphosphatase;       
    6::254     2e-43  36%  273 aa  UPPP_NEIG1 RecName: Full=Undecaprenyl-diphosphatase;       
    6::258     2e-43  40%  271 aa  UPPP_AERS4 RecName: Full=Undecaprenyl-diphosphatase;       
    6::258     3e-43  39%  271 aa  UPPP_AERHH RecName: Full=Undecaprenyl-diphosphatase;       
    6::254     5e-43  39%  274 aa  UPPP_VEREI RecName: Full=Undecaprenyl-diphosphatase;       
    6::254     5e-43  36%  273 aa  UPPP_NEIG2 RecName: Full=Undecaprenyl-diphosphatase;       
    7::254     6e-43  43%  276 aa  UPPP_THIDA RecName: Full=Undecaprenyl-diphosphatase;       
    9::253     8e-43  43%  277 aa  UPPP_PSEA7 RecName: Full=Undecaprenyl-diphosphatase;       
    2::252     1e-42  38%  266 aa  UPPP_SPHWW RecName: Full=Undecaprenyl-diphosphatase;       
    6::254     1e-42  36%  273 aa  UPPP_NEIMF RecName: Full=Undecaprenyl-diphosphatase;       
    6::254     1e-42  36%  273 aa  UPPP_NEIMA RecName: Full=Undecaprenyl-diphosphatase;       
    6::254     1e-42  37%  273 aa  UPPP_NEIM0 RecName: Full=Undecaprenyl-diphosphatase;       
    6::257     2e-42  38%  269 aa  UPPP_METFK RecName: Full=Undecaprenyl-diphosphatase;       
    7::273     4e-42  38%  293 aa  UPPP_RALEJ RecName: Full=Undecaprenyl-diphosphatase;       
    6::256     4e-42  39%  273 aa  UPPP_KLEP7 RecName: Full=Undecaprenyl-diphosphatase;       
    6::256     4e-42  39%  273 aa  UPPP_KLEP3 RecName: Full=Undecaprenyl-diphosphatase;       
    7::254     9e-42  39%  269 aa  UPPP_CAUSK RecName: Full=Undecaprenyl-diphosphatase;       
    7::253     2e-41  35%  274 aa  UPPP_AZOSE RecName: Full=Undecaprenyl-diphosphatase;       
    6::260     2e-41  38%  280 aa  UPPP_PSYA2 RecName: Full=Undecaprenyl-diphosphatase;       
    7::273     3e-41  39%  293 aa  UPPP_RALME RecName: Full=Undecaprenyl-diphosphatase;       
    6::256     6e-41  38%  273 aa  UPPP_ENT38 RecName: Full=Undecaprenyl-diphosphatase;       
    4::252     1e-40  42%  265 aa  UPPP1_BACHK RecName: Full=Undecaprenyl-diphosphatase 1;       
    6::254     2e-40  38%  274 aa  UPPP_VARPS RecName: Full=Undecaprenyl-diphosphatase;       
    4::252     2e-40  42%  265 aa  UPPP1_BACAN RecName: Full=Undecaprenyl-diphosphatase 1;       
    3::256     2e-40  39%  270 aa  UPPP_NOVAD RecName: Full=Undecaprenyl-diphosphatase;       
    6::260     3e-40  38%  280 aa  UPPP_PSYCK RecName: Full=Undecaprenyl-diphosphatase;       
    4::252     4e-40  42%  265 aa  UPPP1_BACAH RecName: Full=Undecaprenyl-diphosphatase 1;       
    4::252     5e-40  42%  265 aa  UPPP1_BACCZ RecName: Full=Undecaprenyl-diphosphatase 1;       
    6::257     9e-40  36%  277 aa  UPPP_POLNA RecName: Full=Undecaprenyl-diphosphatase;       
    7::273     1e-39  37%  293 aa  UPPP_RALEH RecName: Full=Undecaprenyl-diphosphatase;       
    3::242     2e-39  43%  256 aa  UPPP_WOLSU RecName: Full=Undecaprenyl-diphosphatase;       
    6::261     3e-39  37%  281 aa  UPPP_POLNS RecName: Full=Undecaprenyl-diphosphatase;       
    6::260     3e-39  37%  272 aa  UPPP_ERWCT RecName: Full=Undecaprenyl-diphosphatase;       
   14::247     3e-39  39%  261 aa  UPPP2_MAGSA RecName: Full=Undecaprenyl-diphosphatase 2;       
    5::252     4e-39  35%  265 aa  UPPP_DESMR RecName: Full=Undecaprenyl-diphosphatase;       
    7::257     6e-39  36%  277 aa  UPPP_HERAR RecName: Full=Undecaprenyl-diphosphatase;       
    7::253     7e-39  34%  276 aa  UPPP1_PSEU5 RecName: Full=Undecaprenyl-diphosphatase 1;       
    6::254     9e-39  36%  271 aa  UPPP_THETN RecName: Full=Undecaprenyl-diphosphatase;       
    6::252     9e-39  37%  273 aa  UPPP_NITEC RecName: Full=Undecaprenyl-diphosphatase;       
    6::260     1e-38  37%  272 aa  UPPP_PECCP RecName: Full=Undecaprenyl-diphosphatase;       
   19::252     2e-38  38%  273 aa  UPPP_NITEU RecName: Full=Undecaprenyl-diphosphatase;       
    9::253     2e-38  41%  277 aa  UPPP_PSEA8 RecName: Full=Undecaprenyl-diphosphatase;       
    9::253     3e-38  41%  277 aa  UPPP_PSEAB RecName: Full=Undecaprenyl-diphosphatase;       
    7::257     3e-38  35%  277 aa  UPPP_JANMA RecName: Full=Undecaprenyl-diphosphatase;       
    9::253     5e-38  41%  277 aa  UPPP_PSEAE RecName: Full=Undecaprenyl-diphosphatase;       
    4::245     8e-38  40%  265 aa  UPPP_FLAJ1 RecName: Full=Undecaprenyl-diphosphatase;       
    6::260     1e-37  38%  272 aa  UPPP_YERE8 RecName: Full=Undecaprenyl-diphosphatase;       
    3::252     1e-37  34%  264 aa  UPPP_DESAD RecName: Full=Undecaprenyl-diphosphatase;       
    6::257     1e-37  36%  276 aa  UPPP1_BURCH RecName: Full=Undecaprenyl-diphosphatase 1;       
    6::257     1e-37  36%  276 aa  UPPP1_BURCA RecName: Full=Undecaprenyl-diphosphatase 1;       
    9::253     2e-37  35%  276 aa  UPPP_PSEU2 RecName: Full=Undecaprenyl-diphosphatase;       
    6::260     3e-37  36%  272 aa  UPPP_YERPY RecName: Full=Undecaprenyl-diphosphatase;       
    6::260     3e-37  36%  272 aa  UPPP_YERPS RecName: Full=Undecaprenyl-diphosphatase;       
    6::260     3e-37  36%  272 aa  UPPP_YERPP RecName: Full=Undecaprenyl-diphosphatase;       
    6::260     3e-37  36%  272 aa  UPPP_YERPN RecName: Full=Undecaprenyl-diphosphatase;       
    6::260     3e-37  36%  272 aa  UPPP_YERPG RecName: Full=Undecaprenyl-diphosphatase;       
    6::260     3e-37  36%  272 aa  UPPP_YERPE RecName: Full=Undecaprenyl-diphosphatase;       
    6::260     3e-37  36%  272 aa  UPPP_YERPB RecName: Full=Undecaprenyl-diphosphatase;       
    6::260     3e-37  36%  272 aa  UPPP_YERPA RecName: Full=Undecaprenyl-diphosphatase;       
    6::260     3e-37  36%  272 aa  UPPP_YERP3 RecName: Full=Undecaprenyl-diphosphatase;       
    6::256     3e-37  37%  273 aa  UPPP_SHISS RecName: Full=Undecaprenyl-diphosphatase;       
    9::253     3e-37  34%  276 aa  UPPP_PSEF5 RecName: Full=Undecaprenyl-diphosphatase;       
   13::253     3e-37  42%  274 aa  UPPP_AZOSB RecName: Full=Undecaprenyl-diphosphatase;       
    8::251     3e-37  35%  263 aa  UPPP2_BACC1 RecName: Full=Undecaprenyl-diphosphatase 2;       
    6::265     4e-37  37%  285 aa  UPPP_METPP RecName: Full=Undecaprenyl-diphosphatase;       
    6::256     5e-37  37%  273 aa  UPPP_SHIFL RecName: Full=Undecaprenyl-diphosphatase;       
    6::256     5e-37  37%  273 aa  UPPP_SHIF8 RecName: Full=Undecaprenyl-diphosphatase;       
    6::256     5e-37  37%  273 aa  UPPP_SHIBS RecName: Full=Undecaprenyl-diphosphatase;       
    6::256     5e-37  37%  273 aa  UPPP_SHIB3 RecName: Full=Undecaprenyl-diphosphatase;       
    6::256     5e-37  37%  273 aa  UPPP_ECOUT RecName: Full=Undecaprenyl-diphosphatase;       
    6::256     5e-37  37%  273 aa  UPPP_ECOSE RecName: Full=Undecaprenyl-diphosphatase;       
    6::256     5e-37  37%  273 aa  UPPP_ECOLU RecName: Full=Undecaprenyl-diphosphatase;       
    6::256     5e-37  37%  273 aa  UPPP_ECOLI RecName: Full=Undecaprenyl-diphosphatase;       
    6::256     5e-37  37%  273 aa  UPPP_ECOLC RecName: Full=Undecaprenyl-diphosphatase;       
    6::256     5e-37  37%  273 aa  UPPP_ECOL6 RecName: Full=Undecaprenyl-diphosphatase;       
    6::256     5e-37  37%  273 aa  UPPP_ECOL5 RecName: Full=Undecaprenyl-diphosphatase;       
    6::256     5e-37  37%  273 aa  UPPP_ECOK1 RecName: Full=Undecaprenyl-diphosphatase;       
    6::256     5e-37  37%  273 aa  UPPP_ECOHS RecName: Full=Undecaprenyl-diphosphatase;       
    6::256     5e-37  37%  273 aa  UPPP_ECODH RecName: Full=Undecaprenyl-diphosphatase;       
    6::256     5e-37  37%  273 aa  UPPP_ECOBW RecName: Full=Undecaprenyl-diphosphatase;       
    6::256     5e-37  37%  273 aa  UPPP_ECO8A RecName: Full=Undecaprenyl-diphosphatase;       
    6::256     5e-37  37%  273 aa  UPPP_ECO81 RecName: Full=Undecaprenyl-diphosphatase;       
    6::256     5e-37  37%  273 aa  UPPP_ECO5E RecName: Full=Undecaprenyl-diphosphatase;       
    6::256     5e-37  37%  273 aa  UPPP_ECO57 RecName: Full=Undecaprenyl-diphosphatase;       
    6::256     5e-37  37%  273 aa  UPPP_ECO55 RecName: Full=Undecaprenyl-diphosphatase;       
    6::256     5e-37  37%  273 aa  UPPP_ECO45 RecName: Full=Undecaprenyl-diphosphatase;       
    6::256     5e-37  37%  273 aa  UPPP_ECO27 RecName: Full=Undecaprenyl-diphosphatase;       
    6::256     5e-37  37%  273 aa  UPPP_ECO24 RecName: Full=Undecaprenyl-diphosphatase;       
    8::251     5e-37  35%  263 aa  UPPP3_BACHK RecName: Full=Undecaprenyl-diphosphatase 3;       
    7::256     5e-37  38%  267 aa  UPPP2_SHEON RecName: Full=Undecaprenyl-diphosphatase 2;       
   19::252     7e-37  37%  266 aa  UPPP_SPHAL RecName: Full=Undecaprenyl-diphosphatase;       
    9::253     7e-37  35%  276 aa  UPPP_PSESM RecName: Full=Undecaprenyl-diphosphatase;       
    6::256     7e-37  37%  273 aa  UPPP_ESCF3 RecName: Full=Undecaprenyl-diphosphatase;       
    6::256     7e-37  37%  273 aa  UPPP_ECO7I RecName: Full=Undecaprenyl-diphosphatase;       
    6::255     7e-37  36%  272 aa  UPPP_CITK8 RecName: Full=Undecaprenyl-diphosphatase;       
   10::254     9e-37  34%  277 aa  UPPP_PSE14 RecName: Full=Undecaprenyl-diphosphatase;       
    6::254     9e-37  34%  274 aa  UPPP_CELJU RecName: Full=Undecaprenyl-diphosphatase;       
    9::253     1e-36  38%  276 aa  UPPP_PSEPW RecName: Full=Undecaprenyl-diphosphatase;       
    6::253     1e-36  35%  274 aa  UPPP_DECAR RecName: Full=Undecaprenyl-diphosphatase;       
    6::257     1e-36  36%  276 aa  UPPP1_BURCM RecName: Full=Undecaprenyl-diphosphatase 1;       
    9::253     2e-36  38%  276 aa  UPPP_PSEPG RecName: Full=Undecaprenyl-diphosphatase;       
    1::254     2e-36  37%  272 aa  UPPP_ACIBY RecName: Full=Undecaprenyl-diphosphatase;       
    1::254     2e-36  37%  272 aa  UPPP_ACIBT RecName: Full=Undecaprenyl-diphosphatase;       
    1::254     2e-36  37%  272 aa  UPPP_ACIBS RecName: Full=Undecaprenyl-diphosphatase;       
    1::254     2e-36  37%  272 aa  UPPP_ACIBC RecName: Full=Undecaprenyl-diphosphatase;       
    1::254     2e-36  37%  272 aa  UPPP_ACIB5 RecName: Full=Undecaprenyl-diphosphatase;       
    1::254     2e-36  37%  272 aa  UPPP_ACIB3 RecName: Full=Undecaprenyl-diphosphatase;       
    1::242     2e-36  35%  254 aa  UPPP3_BACCZ RecName: Full=Undecaprenyl-diphosphatase 3;       
    1::242     2e-36  35%  254 aa  UPPP3_BACAH RecName: Full=Undecaprenyl-diphosphatase 3;       
    1::242     2e-36  35%  254 aa  UPPP2_BACAN RecName: Full=Undecaprenyl-diphosphatase 2;       
    5::253     3e-36  33%  276 aa  UPPP_PSEE4 RecName: Full=Undecaprenyl-diphosphatase;       
    4::260     3e-36  35%  276 aa  UPPP_LACF3 RecName: Full=Undecaprenyl-diphosphatase;       
    6::257     3e-36  36%  276 aa  UPPP1_BURS3 RecName: Full=Undecaprenyl-diphosphatase 1;       
    7::253     4e-36  33%  276 aa  UPPP1_PSEPF RecName: Full=Undecaprenyl-diphosphatase 1;       
    4::237     6e-36  39%  252 aa  UPPP_SULSY RecName: Full=Undecaprenyl-diphosphatase;       
    6::260     6e-36  36%  272 aa  UPPP_PHOLL RecName: Full=Undecaprenyl-diphosphatase;       
    6::256     8e-36  36%  273 aa  UPPP_SALPC RecName: Full=Undecaprenyl-diphosphatase;       
    8::260     1e-35  38%  273 aa  UPPP_SODGM RecName: Full=Undecaprenyl-diphosphatase;       
    6::257     1e-35  36%  276 aa  UPPP_BURMS RecName: Full=Undecaprenyl-diphosphatase;       
    6::257     1e-35  36%  276 aa  UPPP_BURMA RecName: Full=Undecaprenyl-diphosphatase;       
    6::257     1e-35  36%  276 aa  UPPP_BURM9 RecName: Full=Undecaprenyl-diphosphatase;       
    6::257     1e-35  36%  276 aa  UPPP_BURM7 RecName: Full=Undecaprenyl-diphosphatase;       
    6::257     1e-35  36%  276 aa  UPPP2_BURPS RecName: Full=Undecaprenyl-diphosphatase 2;       
    6::257     1e-35  36%  276 aa  UPPP2_BURP1 RecName: Full=Undecaprenyl-diphosphatase 2;       
    6::257     1e-35  36%  276 aa  UPPP2_BURP0 RecName: Full=Undecaprenyl-diphosphatase 2;       
    3::237     3e-35  40%  254 aa  UPPP_PERMH RecName: Full=Undecaprenyl-diphosphatase;       
    4::260     4e-35  34%  275 aa  UPPP_LACPL RecName: Full=Undecaprenyl-diphosphatase;       
    7::187     4e-35  42%  187 aa  UPPP_AZOBR RecName: Full=Undecaprenyl-diphosphatase;       
   13::273     6e-35  36%  293 aa  UPPP_RALPJ RecName: Full=Undecaprenyl-diphosphatase;       
    6::263     8e-35  35%  283 aa  UPPP_PSYWF RecName: Full=Undecaprenyl-diphosphatase;       
    5::253     8e-35  33%  277 aa  UPPP2_PSEPF RecName: Full=Undecaprenyl-diphosphatase 2;       
    6::257     8e-35  38%  276 aa  UPPP1_BURTA RecName: Full=Undecaprenyl-diphosphatase 1;       
    6::256     8e-35  39%  274 aa  UPPP1_ACIAD RecName: Full=Undecaprenyl-diphosphatase 1;       
    6::255     1e-34  35%  272 aa  UPPP_ENTS8 RecName: Full=Undecaprenyl-diphosphatase;       
   13::273     2e-34  36%  293 aa  UPPP_RALSO RecName: Full=Undecaprenyl-diphosphatase;       
    4::252     2e-34  38%  265 aa  UPPP_DESVH RecName: Full=Undecaprenyl-diphosphatase;       
    4::252     3e-34  38%  265 aa  UPPP_DESVV RecName: Full=Undecaprenyl-diphosphatase;       
    3::252     3e-34  33%  265 aa  UPPP_DESDA RecName: Full=Undecaprenyl-diphosphatase;       
    4::260     5e-34  36%  275 aa  UPPP_LACDB RecName: Full=Undecaprenyl-diphosphatase;       
    4::260     5e-34  36%  275 aa  UPPP_LACDA RecName: Full=Undecaprenyl-diphosphatase;       
    4::259     5e-34  35%  272 aa  UPPP_LACC3 RecName: Full=Undecaprenyl-diphosphatase;       
    9::258     9e-34  34%  278 aa  UPPP1_BURXL RecName: Full=Undecaprenyl-diphosphatase 1;       
    4::246     1e-33  41%  258 aa  UPPP_CAMFF RecName: Full=Undecaprenyl-diphosphatase;       
    4::259     2e-33  34%  272 aa  UPPP_LACCB RecName: Full=Undecaprenyl-diphosphatase;       
    6::258     3e-33  32%  273 aa  UPPP_CLOPH RecName: Full=Undecaprenyl-diphosphatase;       
    2::243     6e-33  36%  263 aa  UPPP_BDEBA RecName: Full=Undecaprenyl-diphosphatase;       
    7::253     2e-32  35%  273 aa  UPPP_METCA RecName: Full=Undecaprenyl-diphosphatase;       
   10::254     3e-32  36%  277 aa  UPPP_PSEPK RecName: Full=Undecaprenyl-diphosphatase;       
   16::241     3e-32  39%  261 aa  UPPP_FLAPJ RecName: Full=Undecaprenyl-diphosphatase;       
    8::263     3e-32  32%  276 aa  UPPP2_ENTFA RecName: Full=Undecaprenyl-diphosphatase;       
    6::264     3e-32  35%  276 aa  UPPP2_BACLD RecName: Full=Undecaprenyl-diphosphatase 2;       
    6::256     5e-32  34%  273 aa  UPPP_SALAR RecName: Full=Undecaprenyl-diphosphatase;       
    9::253     5e-32  36%  276 aa  UPPP_PSEP1 RecName: Full=Undecaprenyl-diphosphatase;       
    6::243     5e-32  36%  256 aa  UPPP_AQUAE RecName: Full=Undecaprenyl-diphosphatase;       
    6::256     7e-32  34%  273 aa  UPPP_SALDC RecName: Full=Undecaprenyl-diphosphatase;       
    4::252     9e-32  31%  269 aa  UPPP_THEPX RecName: Full=Undecaprenyl-diphosphatase;       
    6::261     9e-32  35%  273 aa  UPPP_GEOTN RecName: Full=Undecaprenyl-diphosphatase;       
    4::243     9e-32  36%  263 aa  UPPP_CYTH3 RecName: Full=Undecaprenyl-diphosphatase;       
    6::256     1e-31  34%  273 aa  UPPP_SALTY RecName: Full=Undecaprenyl-diphosphatase;       
    6::256     1e-31  34%  273 aa  UPPP_SALTI RecName: Full=Undecaprenyl-diphosphatase;       
    6::256     1e-31  34%  273 aa  UPPP_SALSV RecName: Full=Undecaprenyl-diphosphatase;       
    6::256     1e-31  34%  273 aa  UPPP_SALNS RecName: Full=Undecaprenyl-diphosphatase;       
    6::256     1e-31  34%  273 aa  UPPP_SALHS RecName: Full=Undecaprenyl-diphosphatase;       
    6::256     1e-31  34%  273 aa  UPPP_SALA4 RecName: Full=Undecaprenyl-diphosphatase;       
    5::262     1e-31  33%  275 aa  UPPP_LACSS RecName: Full=Undecaprenyl-diphosphatase;       
    8::251     1e-31  33%  263 aa  UPPP2_BACCR RecName: Full=Undecaprenyl-diphosphatase 2;       
    6::256     1e-31  34%  273 aa  UPPP_SALPK RecName: Full=Undecaprenyl-diphosphatase;       
    6::256     1e-31  34%  273 aa  UPPP_SALPA RecName: Full=Undecaprenyl-diphosphatase;       
    6::256     1e-31  34%  273 aa  UPPP_SALCH RecName: Full=Undecaprenyl-diphosphatase;       
    9::254     1e-31  33%  277 aa  UPPP_AZOVD RecName: Full=Undecaprenyl-diphosphatase;       
   10::266     2e-31  33%  284 aa  UPPP_STRTD RecName: Full=Undecaprenyl-diphosphatase;       
    6::261     2e-31  34%  273 aa  UPPP_GEOSW RecName: Full=Undecaprenyl-diphosphatase;       
    4::252     3e-31  30%  269 aa  UPPP_THEP3 RecName: Full=Undecaprenyl-diphosphatase;       
    4::253     3e-31  33%  265 aa  UPPP_DESDG RecName: Full=Undecaprenyl-diphosphatase;       
    6::253     4e-31  32%  274 aa  UPPP_DEIGD RecName: Full=Undecaprenyl-diphosphatase;       
    6::262     6e-31  33%  274 aa  UPPP_SERP5 RecName: Full=Undecaprenyl-diphosphatase;       
    9::203     7e-31  38%  274 aa  UPPP1_CLOD6 RecName: Full=Undecaprenyl-diphosphatase 1;       
   14::270     1e-30  32%  288 aa  UPPP_STRT2 RecName: Full=Undecaprenyl-diphosphatase;       
   14::270     1e-30  32%  288 aa  UPPP_STRT1 RecName: Full=Undecaprenyl-diphosphatase;       
    2::261     1e-30  37%  280 aa  UPPP_PORGI RecName: Full=Undecaprenyl-diphosphatase;       
    2::261     1e-30  38%  280 aa  UPPP_PORG3 RecName: Full=Undecaprenyl-diphosphatase;       
    6::260     1e-30  32%  278 aa  UPPP_DESHD RecName: Full=Undecaprenyl-diphosphatase;       
    6::243     1e-30  38%  267 aa  UPPP_CAMJE RecName: Full=Undecaprenyl-diphosphatase;       
    9::254     2e-30  31%  266 aa  UPPP_LAWIP RecName: Full=Undecaprenyl-diphosphatase;       
    6::248     2e-30  33%  274 aa  UPPP_DEIRA RecName: Full=Undecaprenyl-diphosphatase;       
    6::260     2e-30  32%  274 aa  UPPP1_CLOAB RecName: Full=Undecaprenyl-diphosphatase 1;       
    4::259     8e-30  32%  280 aa  UPPP_RENSM RecName: Full=Undecaprenyl-diphosphatase;       
    3::250     8e-30  34%  266 aa  UPPP_FUSNN RecName: Full=Undecaprenyl-diphosphatase;       
    5::264     1e-29  35%  282 aa  UPPP_LEUCK RecName: Full=Undecaprenyl-diphosphatase;       
    6::265     1e-29  34%  278 aa  UPPP_EXIS2 RecName: Full=Undecaprenyl-diphosphatase;       
    5::261     2e-29  33%  278 aa  UPPP_STRSY RecName: Full=Undecaprenyl-diphosphatase;       
    5::261     2e-29  33%  278 aa  UPPP_STRS2 RecName: Full=Undecaprenyl-diphosphatase;       
    2::246     2e-29  38%  258 aa  UPPP_CAMHC RecName: Full=Undecaprenyl-diphosphatase;       
    4::257     3e-29  33%  272 aa  UPPP_CLOTH RecName: Full=Undecaprenyl-diphosphatase;       
    4::243     3e-29  34%  267 aa  UPPP_CAMJ8 RecName: Full=Undecaprenyl-diphosphatase;       
    3::242     5e-29  32%  255 aa  UPPP_META3 RecName: Full=Undecaprenyl-diphosphatase;       
    5::261     5e-29  36%  278 aa  UPPP1_OENOB RecName: Full=Undecaprenyl-diphosphatase 1;       
    6::243     7e-29  37%  267 aa  UPPP_CAMJR RecName: Full=Undecaprenyl-diphosphatase;       
    6::243     7e-29  37%  267 aa  UPPP_CAMJJ RecName: Full=Undecaprenyl-diphosphatase;       
    6::263     9e-29  32%  282 aa  UPPP_STRGC RecName: Full=Undecaprenyl-diphosphatase;       
    6::256     9e-29  41%  307 aa  UPPP_SORC5 RecName: Full=Undecaprenyl-diphosphatase;       
    2::254     2e-28  35%  292 aa  UPPP_THEFY RecName: Full=Undecaprenyl-diphosphatase;       
    7::249     2e-28  34%  266 aa  UPPP_SHEFN RecName: Full=Undecaprenyl-diphosphatase;       
    6::243     2e-28  36%  267 aa  UPPP_CAMJD RecName: Full=Undecaprenyl-diphosphatase;       
    7::253     2e-28  34%  266 aa  UPPP_SHESH RecName: Full=Undecaprenyl-diphosphatase;       
    4::266     2e-28  33%  284 aa  UPPP_LACLA RecName: Full=Undecaprenyl-diphosphatase;       
    6::264     3e-28  31%  281 aa  UPPP_STRZT RecName: Full=Undecaprenyl-diphosphatase;       
    6::264     3e-28  31%  281 aa  UPPP_STRZP RecName: Full=Undecaprenyl-diphosphatase;       
    6::264     3e-28  31%  281 aa  UPPP_STRZJ RecName: Full=Undecaprenyl-diphosphatase;       
    6::264     3e-28  31%  281 aa  UPPP_STRR6 RecName: Full=Undecaprenyl-diphosphatase;       
    6::264     3e-28  31%  281 aa  UPPP_STRPS RecName: Full=Undecaprenyl-diphosphatase;       
    6::264     3e-28  31%  281 aa  UPPP_STRPN RecName: Full=Undecaprenyl-diphosphatase;       
    6::264     3e-28  31%  281 aa  UPPP_STRPJ RecName: Full=Undecaprenyl-diphosphatase;       
    6::264     3e-28  31%  281 aa  UPPP_STRPI RecName: Full=Undecaprenyl-diphosphatase;       
    6::264     3e-28  31%  281 aa  UPPP_STRP7 RecName: Full=Undecaprenyl-diphosphatase;       
    6::264     3e-28  31%  281 aa  UPPP_STRP4 RecName: Full=Undecaprenyl-diphosphatase;       
    6::264     3e-28  31%  281 aa  UPPP_STRP2 RecName: Full=Undecaprenyl-diphosphatase;       
    3::243     3e-28  39%  256 aa  UPPP2_PSEHT RecName: Full=Undecaprenyl-diphosphatase 2;       
    6::262     3e-28  32%  279 aa  UPPP_STRPZ RecName: Full=Undecaprenyl-diphosphatase;       
    6::262     3e-28  32%  279 aa  UPPP_STRPF RecName: Full=Undecaprenyl-diphosphatase;       
    6::262     3e-28  32%  279 aa  UPPP_STRPD RecName: Full=Undecaprenyl-diphosphatase;       
    8::273     4e-28  36%  287 aa  UPPP_BORPD RecName: Full=Undecaprenyl-diphosphatase;       
    2::243     8e-28  33%  261 aa  UPPP_NAUPA RecName: Full=Undecaprenyl-diphosphatase;       
    6::262     1e-27  32%  279 aa  UPPP_STRPG RecName: Full=Undecaprenyl-diphosphatase;       
    6::262     2e-27  32%  279 aa  UPPP_STRPM RecName: Full=Undecaprenyl-diphosphatase;       
    6::262     2e-27  32%  279 aa  UPPP_STRP8 RecName: Full=Undecaprenyl-diphosphatase;       
    6::262     2e-27  32%  279 aa  UPPP_STRP6 RecName: Full=Undecaprenyl-diphosphatase;       
    6::262     2e-27  32%  279 aa  UPPP_STRP3 RecName: Full=Undecaprenyl-diphosphatase;       
    6::262     2e-27  32%  279 aa  UPPP_STRP1 RecName: Full=Undecaprenyl-diphosphatase;       
   15::268     2e-27  33%  286 aa  UPPP_ARTS2 RecName: Full=Undecaprenyl-diphosphatase;       
    6::262     2e-27  32%  279 aa  UPPP_STRPC RecName: Full=Undecaprenyl-diphosphatase;       
    6::262     2e-27  32%  279 aa  UPPP_STRPB RecName: Full=Undecaprenyl-diphosphatase;       
    9::262     2e-27  31%  276 aa  UPPP1_ENTFA RecName: Full=Undecaprenyl-diphosphatase;       
    7::253     3e-27  33%  266 aa  UPPP_SHEWM RecName: Full=Undecaprenyl-diphosphatase;       
    6::271     4e-27  33%  291 aa  UPPP_STAAN RecName: Full=Undecaprenyl-diphosphatase;       
    6::271     4e-27  33%  291 aa  UPPP_STAAM RecName: Full=Undecaprenyl-diphosphatase;       
    6::271     4e-27  33%  291 aa  UPPP_STAAB RecName: Full=Undecaprenyl-diphosphatase;       
    6::271     4e-27  33%  291 aa  UPPP_STAA9 RecName: Full=Undecaprenyl-diphosphatase;       
    6::271     4e-27  33%  291 aa  UPPP_STAA2 RecName: Full=Undecaprenyl-diphosphatase;       
    6::271     4e-27  33%  291 aa  UPPP_STAA1 RecName: Full=Undecaprenyl-diphosphatase;       
    9::261     4e-27  34%  273 aa  UPPP_GEOKA RecName: Full=Undecaprenyl-diphosphatase;       
    4::253     4e-27  31%  275 aa  UPPP_DEIDV RecName: Full=Undecaprenyl-diphosphatase;       
    6::260     4e-27  34%  273 aa  UPPP_ANOFW RecName: Full=Undecaprenyl-diphosphatase;       
    6::271     5e-27  33%  291 aa  UPPP_STAAW RecName: Full=Undecaprenyl-diphosphatase;       
    6::271     5e-27  33%  291 aa  UPPP_STAAS RecName: Full=Undecaprenyl-diphosphatase;       
    7::253     5e-27  31%  266 aa  UPPP_SHEHH RecName: Full=Undecaprenyl-diphosphatase;       
    7::253     5e-27  34%  266 aa  UPPP_SHEDO RecName: Full=Undecaprenyl-diphosphatase;       
    8::259     5e-27  33%  277 aa  UPPP_ARTCA RecName: Full=Undecaprenyl-diphosphatase;       
    4::259     5e-27  33%  277 aa  UPPP_ARTAT RecName: Full=Undecaprenyl-diphosphatase;       
    6::271     6e-27  33%  291 aa  UPPP_STAAT RecName: Full=Undecaprenyl-diphosphatase;       
    6::271     6e-27  33%  291 aa  UPPP_STAAE RecName: Full=Undecaprenyl-diphosphatase;       
    6::271     6e-27  33%  291 aa  UPPP_STAA8 RecName: Full=Undecaprenyl-diphosphatase;       
    6::271     6e-27  33%  291 aa  UPPP_STAA3 RecName: Full=Undecaprenyl-diphosphatase;       
    6::262     8e-27  33%  279 aa  UPPP_STRA5 RecName: Full=Undecaprenyl-diphosphatase;       
    6::262     8e-27  33%  279 aa  UPPP_STRA3 RecName: Full=Undecaprenyl-diphosphatase;       
    9::264     8e-27  31%  276 aa  UPPP_BACSU RecName: Full=Undecaprenyl-diphosphatase;       
    6::264     8e-27  32%  276 aa  UPPP_BACA2 RecName: Full=Undecaprenyl-diphosphatase;       
    6::262     1e-26  33%  279 aa  UPPP_STRA1 RecName: Full=Undecaprenyl-diphosphatase;       
    2::266     1e-26  34%  291 aa  UPPP2_STRAW RecName: Full=Undecaprenyl-diphosphatase 2;       
    6::271     1e-26  33%  291 aa  UPPP_STAAU RecName: Full=Undecaprenyl-diphosphatase;       
    6::271     1e-26  33%  291 aa  UPPP_STAAC RecName: Full=Undecaprenyl-diphosphatase;       
    7::253     1e-26  34%  266 aa  UPPP_SHESW RecName: Full=Undecaprenyl-diphosphatase;       
    7::253     1e-26  34%  266 aa  UPPP_SHEPC RecName: Full=Undecaprenyl-diphosphatase;       
    7::253     1e-26  32%  266 aa  UPPP_SHEPA RecName: Full=Undecaprenyl-diphosphatase;       
    4::242     2e-26  35%  257 aa  UPPP_THEYD RecName: Full=Undecaprenyl-diphosphatase;       
    7::264     2e-26  36%  291 aa  UPPP_STAHJ RecName: Full=Undecaprenyl-diphosphatase;       
   14::264     2e-26  30%  281 aa  UPPP_LEUMM RecName: Full=Undecaprenyl-diphosphatase;       
    4::249     3e-26  36%  265 aa  UPPP_XANAC RecName: Full=Undecaprenyl-diphosphatase;       
    7::253     3e-26  32%  266 aa  UPPP_SHEPW RecName: Full=Undecaprenyl-diphosphatase;       
    2::266     3e-26  35%  291 aa  UPPP2_STRCO RecName: Full=Undecaprenyl-diphosphatase 2;       
   19::262     4e-26  36%  280 aa  UPPP_STRSV RecName: Full=Undecaprenyl-diphosphatase;       
    7::253     4e-26  35%  266 aa  UPPP_SHEB9 RecName: Full=Undecaprenyl-diphosphatase;       
    7::253     4e-26  35%  266 aa  UPPP_SHEB8 RecName: Full=Undecaprenyl-diphosphatase;       
    7::253     4e-26  35%  266 aa  UPPP_SHEB5 RecName: Full=Undecaprenyl-diphosphatase;       
    7::253     4e-26  35%  266 aa  UPPP_SHEB2 RecName: Full=Undecaprenyl-diphosphatase;       
    3::243     5e-26  32%  255 aa  UPPP_THICR RecName: Full=Undecaprenyl-diphosphatase;       
    7::253     7e-26  35%  266 aa  UPPP_SHESR RecName: Full=Undecaprenyl-diphosphatase;       
    7::253     7e-26  33%  266 aa  UPPP_SHESM RecName: Full=Undecaprenyl-diphosphatase;       
    8::273     7e-26  32%  287 aa  UPPP_BORPE RecName: Full=Undecaprenyl-diphosphatase;       
    4::249     9e-26  35%  265 aa  UPPP_XANC5 RecName: Full=Undecaprenyl-diphosphatase;       
    7::253     9e-26  34%  266 aa  UPPP_SHESA RecName: Full=Undecaprenyl-diphosphatase;       
    8::273     9e-26  32%  287 aa  UPPP_BORPA RecName: Full=Undecaprenyl-diphosphatase;       
    8::273     9e-26  32%  287 aa  UPPP_BORBR RecName: Full=Undecaprenyl-diphosphatase;       
    4::249     2e-25  35%  265 aa  UPPP_XANOR RecName: Full=Undecaprenyl-diphosphatase;       
    4::249     2e-25  35%  265 aa  UPPP_XANOP RecName: Full=Undecaprenyl-diphosphatase;       
    4::249     2e-25  35%  265 aa  UPPP_XANOM RecName: Full=Undecaprenyl-diphosphatase;       
    2::256     2e-25  30%  273 aa  UPPP_PELPD RecName: Full=Undecaprenyl-diphosphatase;       
    5::263     3e-25  31%  277 aa  UPPP_LEPIN RecName: Full=Undecaprenyl-diphosphatase;       
    5::263     3e-25  31%  277 aa  UPPP_LEPIC RecName: Full=Undecaprenyl-diphosphatase;       
   13::253     4e-25  31%  271 aa  UPPP_CLOTE RecName: Full=Undecaprenyl-diphosphatase;       
    2::264     5e-25  32%  282 aa  UPPP_CHLTE RecName: Full=Undecaprenyl-diphosphatase;       
    7::253     5e-25  34%  266 aa  UPPP1_SHEON RecName: Full=Undecaprenyl-diphosphatase 1;       
    2::253     8e-25  33%  266 aa  UPPP1_PSEHT RecName: Full=Undecaprenyl-diphosphatase 1;       
    4::253     1e-24  30%  266 aa  UPPP_SHEAM RecName: Full=Undecaprenyl-diphosphatase;       
    4::249     1e-24  34%  263 aa  UPPP_XANCP RecName: Full=Undecaprenyl-diphosphatase;       
    4::249     1e-24  34%  263 aa  UPPP_XANC8 RecName: Full=Undecaprenyl-diphosphatase;       
    2::253     1e-24  34%  266 aa  UPPP_PSEA6 RecName: Full=Undecaprenyl-diphosphatase;       
    7::42      1e-24  47%  275 aa  UPPP_BAUCH RecName: Full=Undecaprenyl-diphosphatase;       
    6::261     2e-24  29%  281 aa  UPPP_MACCJ RecName: Full=Undecaprenyl-diphosphatase;       
    4::249     2e-24  31%  272 aa  UPPP_RUBXD RecName: Full=Undecaprenyl-diphosphatase;       
    6::253     3e-24  29%  273 aa  UPPP_LARHH RecName: Full=Undecaprenyl-diphosphatase;       
    3::246     3e-24  33%  259 aa  UPPP_HALOH RecName: Full=Undecaprenyl-diphosphatase;       
    6::261     3e-24  34%  275 aa  UPPP_ALKMQ RecName: Full=Undecaprenyl-diphosphatase;       
    4::249     4e-24  34%  261 aa  UPPP_XYLFT RecName: Full=Undecaprenyl-diphosphatase;       
    6::253     4e-24  32%  265 aa  UPPP_ALCBS RecName: Full=Undecaprenyl-diphosphatase;       
    2::253     5e-24  32%  267 aa  UPPP_VIBHB RecName: Full=Undecaprenyl-diphosphatase;       
    3::253     7e-24  31%  264 aa  UPPP_TERTT RecName: Full=Undecaprenyl-diphosphatase;       
    4::242     7e-24  33%  259 aa  UPPP4_BACAH RecName: Full=Undecaprenyl-diphosphatase 4;       
    7::263     7e-24  38%  275 aa  UPPP2_BACSK RecName: Full=Undecaprenyl-diphosphatase 2;       
    4::242     9e-24  33%  259 aa  UPPP4_BACCZ RecName: Full=Undecaprenyl-diphosphatase 4;       
    6::259     1e-23  28%  279 aa  UPPP_ALKOO RecName: Full=Undecaprenyl-diphosphatase;       
    4::242     1e-23  33%  259 aa  UPPP3_BACCR RecName: Full=Undecaprenyl-diphosphatase 3;       
    2::253     1e-23  32%  267 aa  UPPP_VIBVY RecName: Full=Undecaprenyl-diphosphatase;       
    2::253     1e-23  32%  267 aa  UPPP_VIBVU RecName: Full=Undecaprenyl-diphosphatase;       
    6::263     2e-23  30%  281 aa  UPPP_STRMU RecName: Full=Undecaprenyl-diphosphatase;       
    6::262     2e-23  31%  279 aa  UPPP_STREM RecName: Full=Undecaprenyl-diphosphatase;       
   13::276     2e-23  33%  296 aa  UPPP_STACT RecName: Full=Undecaprenyl-diphosphatase;       
    3::256     3e-23  30%  270 aa  UPPP_GEOSF RecName: Full=Undecaprenyl-diphosphatase;       
    2::264     3e-23  29%  282 aa  UPPP_CHLPB RecName: Full=Undecaprenyl-diphosphatase;       
    6::258     3e-23  29%  278 aa  UPPP2_AGRT5 RecName: Full=Undecaprenyl-diphosphatase 2;       
    2::255     3e-23  30%  277 aa  UPPP1_BACSK RecName: Full=Undecaprenyl-diphosphatase 1;       
    4::248     3e-23  35%  265 aa  UPPP_RHIL3 RecName: Full=Undecaprenyl-diphosphatase;       
    4::242     3e-23  33%  259 aa  UPPP3_BACC1 RecName: Full=Undecaprenyl-diphosphatase 3;       
    4::249     4e-23  33%  266 aa  UPPP_RHILW RecName: Full=Undecaprenyl-diphosphatase;       
    8::250     4e-23  31%  268 aa  UPPP_METI4 RecName: Full=Undecaprenyl-diphosphatase;       
   16::266     4e-23  31%  284 aa  UPPP_LACLS RecName: Full=Undecaprenyl-diphosphatase;       
    4::242     4e-23  33%  259 aa  UPPP4_BACHK RecName: Full=Undecaprenyl-diphosphatase 4;       
    6::262     6e-23  31%  279 aa  UPPP_STRE4 RecName: Full=Undecaprenyl-diphosphatase;       
    4::248     6e-23  36%  265 aa  UPPP_RHIEC RecName: Full=Undecaprenyl-diphosphatase;       
    6::262     7e-23  31%  279 aa  UPPP_STRS7 RecName: Full=Undecaprenyl-diphosphatase;       
    2::249     7e-23  30%  266 aa  UPPP_PARD8 RecName: Full=Undecaprenyl-diphosphatase;       
   16::266     7e-23  31%  284 aa  UPPP_LACLM RecName: Full=Undecaprenyl-diphosphatase;       
    2::253     1e-22  32%  267 aa  UPPP_VIBSL RecName: Full=Undecaprenyl-diphosphatase;       
    7::231     1e-22  31%  281 aa  UPPP_CLOCE RecName: Full=Undecaprenyl-diphosphatase;       
    2::239     1e-22  31%  283 aa  UPPP_CHLL2 RecName: Full=Undecaprenyl-diphosphatase;       
    7::255     1e-22  33%  266 aa  UPPP_PROM5 RecName: Full=Undecaprenyl-diphosphatase;       
    4::257     2e-22  33%  273 aa  UPPP_DESOH RecName: Full=Undecaprenyl-diphosphatase;       
    2::254     2e-22  30%  272 aa  UPPP_CLAM3 RecName: Full=Undecaprenyl-diphosphatase;       
    9::266     2e-22  31%  284 aa  UPPP2_CLOD6 RecName: Full=Undecaprenyl-diphosphatase 2;       
    6::246     2e-22  32%  261 aa  UPPP_CARHZ RecName: Full=Undecaprenyl-diphosphatase;       
    4::248     3e-22  34%  265 aa  UPPP_RHIE6 RecName: Full=Undecaprenyl-diphosphatase;       
   27::58      3e-22  46%  294 aa  UPPP_BLOPB RecName: Full=Undecaprenyl-diphosphatase;       
    2::265     4e-22  30%  290 aa  UPPP_STRGG RecName: Full=Undecaprenyl-diphosphatase;       
   19::271     4e-22  32%  291 aa  UPPP_STAAR RecName: Full=Undecaprenyl-diphosphatase;       
    7::255     4e-22  31%  266 aa  UPPP_PROM2 RecName: Full=Undecaprenyl-diphosphatase;       
    7::255     5e-22  31%  266 aa  UPPP_PROMP RecName: Full=Undecaprenyl-diphosphatase;       
    2::264     5e-22  30%  282 aa  UPPP_PROA2 RecName: Full=Undecaprenyl-diphosphatase;       
   17::287     5e-22  31%  304 aa  UPPP_CLOPS RecName: Full=Undecaprenyl-diphosphatase;       
   17::287     5e-22  31%  304 aa  UPPP_CLOPE RecName: Full=Undecaprenyl-diphosphatase;       
   17::287     5e-22  31%  304 aa  UPPP_CLOP1 RecName: Full=Undecaprenyl-diphosphatase;       
    6::253     6e-22  30%  267 aa  UPPP_VIBF1 RecName: Full=Undecaprenyl-diphosphatase;       
    6::253     8e-22  30%  267 aa  UPPP_VIBFM RecName: Full=Undecaprenyl-diphosphatase;       
    2::253     8e-22  29%  267 aa  UPPP_VIBCM RecName: Full=Undecaprenyl-diphosphatase;       
    2::253     8e-22  29%  267 aa  UPPP_VIBCH RecName: Full=Undecaprenyl-diphosphatase;       
    2::253     8e-22  29%  267 aa  UPPP_VIBC3 RecName: Full=Undecaprenyl-diphosphatase;       
    4::226     8e-22  31%  249 aa  UPPP_METVS RecName: Full=Undecaprenyl-diphosphatase;       
    6::253     1e-21  29%  267 aa  UPPP_ALISL RecName: Full=Undecaprenyl-diphosphatase;       
    2::253     1e-21  30%  267 aa  UPPP_VIBPA RecName: Full=Undecaprenyl-diphosphatase;       
    3::251     1e-21  29%  265 aa  UPPP_SACD2 RecName: Full=Undecaprenyl-diphosphatase;       
    5::265     1e-21  33%  279 aa  UPPP_LEPBP RecName: Full=Undecaprenyl-diphosphatase;       
  105::265     1e-21  37%  280 aa  UPPP_LEPBL RecName: Full=Undecaprenyl-diphosphatase;       
  105::265     1e-21  37%  280 aa  UPPP_LEPBJ RecName: Full=Undecaprenyl-diphosphatase;       
    5::265     1e-21  33%  279 aa  UPPP_LEPBA RecName: Full=Undecaprenyl-diphosphatase;       
  111::263     2e-21  38%  291 aa  UPPP_STAS1 RecName: Full=Undecaprenyl-diphosphatase;       
    2::249     2e-21  28%  264 aa  UPPP_BACTN RecName: Full=Undecaprenyl-diphosphatase;       
    3::253     2e-21  29%  266 aa  UPPP_SHELP RecName: Full=Undecaprenyl-diphosphatase;       
    2::246     2e-21  29%  264 aa  UPPP_PELTS RecName: Full=Undecaprenyl-diphosphatase;       
   20::268     2e-21  33%  286 aa  UPPP_CLONN RecName: Full=Undecaprenyl-diphosphatase;       
    6::241     2e-21  35%  268 aa  UPPP_BUCBP RecName: Full=Undecaprenyl-diphosphatase;       
    6::249     2e-21  31%  266 aa  UPPP_BACFR RecName: Full=Undecaprenyl-diphosphatase;       
    6::249     2e-21  31%  266 aa  UPPP_BACFN RecName: Full=Undecaprenyl-diphosphatase;       
   19::270     3e-21  33%  290 aa  UPPP_STAES RecName: Full=Undecaprenyl-diphosphatase;       
   19::270     3e-21  33%  290 aa  UPPP_STAEQ RecName: Full=Undecaprenyl-diphosphatase;       
   19::275     3e-21  29%  293 aa  UPPP_COREF RecName: Full=Undecaprenyl-diphosphatase;       
    2::248     5e-21  29%  264 aa  UPPP_CALS8 RecName: Full=Undecaprenyl-diphosphatase;       
    2::191     7e-21  31%  257 aa  UPPP_RHOBA RecName: Full=Undecaprenyl-diphosphatase;       
    4::259     7e-21  31%  277 aa  UPPP_MICLC RecName: Full=Undecaprenyl-diphosphatase;       
    4::255     7e-21  30%  269 aa  UPPP_GEOMG RecName: Full=Undecaprenyl-diphosphatase;       
    2::205     7e-21  32%  267 aa  UPPP_GEMAT RecName: Full=Undecaprenyl-diphosphatase;       
    9::43      9e-21  49%  282 aa  UPPP_BORA1 RecName: Full=Undecaprenyl-diphosphatase;       
   14::260     1e-20  29%  276 aa  UPPP_SYMTH RecName: Full=Undecaprenyl-diphosphatase;       
    2::253     1e-20  29%  267 aa  UPPP_PSYIN RecName: Full=Undecaprenyl-diphosphatase;       
    4::216     1e-20  31%  249 aa  UPPP_METMP RecName: Full=Undecaprenyl-diphosphatase;       
    4::272     1e-20  29%  290 aa  UPPP2_CORJK RecName: Full=Undecaprenyl-diphosphatase 2;       
    2::218     2e-20  30%  282 aa  UPPP_CHLPD RecName: Full=Undecaprenyl-diphosphatase;       
    2::253     2e-20  28%  266 aa  UPPP_ALTMD RecName: Full=Undecaprenyl-diphosphatase;       
   23::275     3e-20  28%  293 aa  UPPP_CORGL RecName: Full=Undecaprenyl-diphosphatase;       
    2::245     3e-20  28%  260 aa  UPPP_SYNWW RecName: Full=Undecaprenyl-diphosphatase;       
    2::246     3e-20  26%  261 aa  UPPP_MOOTA RecName: Full=Undecaprenyl-diphosphatase;       
    4::259     3e-20  27%  277 aa  UPPP_KOCRD RecName: Full=Undecaprenyl-diphosphatase;       
    7::246     3e-20  29%  261 aa  UPPP_DESAP RecName: Full=Undecaprenyl-diphosphatase;       
    4::216     4e-20  31%  249 aa  UPPP_METM5 RecName: Full=Undecaprenyl-diphosphatase;       
   23::275     4e-20  28%  293 aa  UPPP_CORGB RecName: Full=Undecaprenyl-diphosphatase;       
    3::258     6e-20  27%  270 aa  UPPP_MAGSM RecName: Full=Undecaprenyl-diphosphatase;       
   13::267     6e-20  29%  281 aa  UPPP_CORST RecName: Full=Undecaprenyl-diphosphatase;       
   15::264     6e-20  31%  282 aa  UPPP_CORDI RecName: Full=Undecaprenyl-diphosphatase;       
    4::253     6e-20  30%  265 aa  UPPP_CHRSD RecName: Full=Undecaprenyl-diphosphatase;       
    8::263     6e-20  31%  292 aa  UPPP2_FRASC RecName: Full=Undecaprenyl-diphosphatase 2;       
    2::264     8e-20  29%  282 aa  UPPP_PROVI RecName: Full=Undecaprenyl-diphosphatase;       
    2::253     8e-20  30%  267 aa  UPPP_PHOPR RecName: Full=Undecaprenyl-diphosphatase;       
    4::264     1e-19  35%  276 aa  UPPP_DESAA RecName: Full=Undecaprenyl-diphosphatase;       
    6::249     1e-19  30%  265 aa  UPPP_ANATD RecName: Full=Undecaprenyl-diphosphatase;       
    9::263     1e-19  29%  281 aa  UPPP1_CORJK RecName: Full=Undecaprenyl-diphosphatase 1;       
    4::266     1e-19  36%  284 aa  UPPP_PROAC RecName: Full=Undecaprenyl-diphosphatase;       
    3::239     1e-19  28%  276 aa  UPPP_DESAH RecName: Full=Undecaprenyl-diphosphatase;       
    7::255     2e-19  31%  266 aa  UPPP_PROM0 RecName: Full=Undecaprenyl-diphosphatase;       
    6::250     2e-19  30%  266 aa  UPPP_BACV8 RecName: Full=Undecaprenyl-diphosphatase;       
    7::258     2e-19  34%  270 aa  UPPP1_BACCR RecName: Full=Undecaprenyl-diphosphatase 1;       
    4::216     2e-19  29%  249 aa  UPPP_METM7 RecName: Full=Undecaprenyl-diphosphatase;       
    3::252     2e-19  28%  264 aa  UPPP_CAMC1 RecName: Full=Undecaprenyl-diphosphatase;       
    2::267     2e-19  33%  294 aa  UPPP_BIFLO RecName: Full=Undecaprenyl-diphosphatase;       
    2::267     2e-19  33%  294 aa  UPPP_BIFLD RecName: Full=Undecaprenyl-diphosphatase;       
    7::258     3e-19  35%  270 aa  UPPP3_BACAN RecName: Full=Undecaprenyl-diphosphatase 3;       
    7::258     3e-19  35%  270 aa  UPPP2_BACHK RecName: Full=Undecaprenyl-diphosphatase 2;       
    7::258     3e-19  35%  270 aa  UPPP2_BACCZ RecName: Full=Undecaprenyl-diphosphatase 2;       
    7::258     3e-19  35%  270 aa  UPPP2_BACAH RecName: Full=Undecaprenyl-diphosphatase 2;       
    7::258     3e-19  35%  270 aa  UPPP1_BACC1 RecName: Full=Undecaprenyl-diphosphatase 1;       
   17::272     4e-19  34%  286 aa  UPPP_ACIBL RecName: Full=Undecaprenyl-diphosphatase;       
    4::216     5e-19  28%  249 aa  UPPP_METM6 RecName: Full=Undecaprenyl-diphosphatase;       
    6::270     5e-19  33%  287 aa  UPPP_HALHL RecName: Full=Undecaprenyl-diphosphatase;       
    6::225     5e-19  33%  248 aa  UPPP_FERNB RecName: Full=Undecaprenyl-diphosphatase;       
   86::243     5e-19  35%  254 aa  UPPP_DESPS RecName: Full=Undecaprenyl-diphosphatase;       
    2::252     6e-19  31%  269 aa  UPPP_TREDE RecName: Full=Undecaprenyl-diphosphatase;       
    6::258     6e-19  33%  270 aa  UPPP_SALRD RecName: Full=Undecaprenyl-diphosphatase;       
    4::244     6e-19  29%  258 aa  UPPP_ELUMP RecName: Full=Undecaprenyl-diphosphatase;       
    4::257     6e-19  30%  276 aa  UPPP_ACIC1 RecName: Full=Undecaprenyl-diphosphatase;       
    9::260     6e-19  30%  277 aa  UPPP1_STRAW RecName: Full=Undecaprenyl-diphosphatase 1;       
   10::257     8e-19  29%  268 aa  UPPP_PROM9 RecName: Full=Undecaprenyl-diphosphatase;       
   20::208     8e-19  31%  264 aa  UPPP_BUCAP RecName: Full=Undecaprenyl-diphosphatase;       
    4::252     1e-18  30%  266 aa  UPPP_HAHCH RecName: Full=Undecaprenyl-diphosphatase;       
   20::229     1e-18  30%  265 aa  UPPP_BUCAT RecName: Full=Undecaprenyl-diphosphatase;       
   20::229     1e-18  30%  265 aa  UPPP_BUCAI RecName: Full=Undecaprenyl-diphosphatase;       
   20::229     1e-18  30%  265 aa  UPPP_BUCA5 RecName: Full=Undecaprenyl-diphosphatase;       
   44::301     1e-18  29%  320 aa  UPPP_ANASP RecName: Full=Undecaprenyl-diphosphatase;       
    2::259     1e-18  28%  278 aa  UPPP3_FRASC RecName: Full=Undecaprenyl-diphosphatase 3;       
    2::264     2e-18  30%  282 aa  UPPP_PELPB RecName: Full=Undecaprenyl-diphosphatase;       
    4::261     2e-18  26%  276 aa  UPPP_METST RecName: Full=Undecaprenyl-diphosphatase;       
    2::260     2e-18  28%  272 aa  UPPP_COLP3 RecName: Full=Undecaprenyl-diphosphatase;       
    9::266     3e-18  29%  283 aa  UPPP_SYNS9 RecName: Full=Undecaprenyl-diphosphatase;       
   16::263     3e-18  30%  274 aa  UPPP_PROMS RecName: Full=Undecaprenyl-diphosphatase;       
   25::287     4e-18  32%  293 aa  UPPP_PROM3 RecName: Full=Undecaprenyl-diphosphatase;       
   52::309     5e-18  28%  326 aa  UPPP_SYNY3 RecName: Full=Undecaprenyl-diphosphatase;       
    3::35      5e-18  45%  264 aa  UPPP_GRAFK RecName: Full=Undecaprenyl-diphosphatase;       
    2::218     7e-18  31%  280 aa  UPPP_GLUOX RecName: Full=Undecaprenyl-diphosphatase;       
    2::269     9e-18  33%  294 aa  UPPP_BIFAA RecName: Full=Undecaprenyl-diphosphatase;       
    4::39      2e-17  51%  261 aa  UPPP_XYLFA RecName: Full=Undecaprenyl-diphosphatase;       
    2::256     2e-17  27%  268 aa  UPPP_MARMM RecName: Full=Undecaprenyl-diphosphatase;       
    3::254     3e-17  29%  266 aa  UPPP_THISH RecName: Full=Undecaprenyl-diphosphatase;       
    3::43      4e-17  45%  269 aa  UPPP_GEOSL RecName: Full=Undecaprenyl-diphosphatase;       
    2::274     4e-17  27%  285 aa  UPPP_ERYLH RecName: Full=Undecaprenyl-diphosphatase;       
    1::24      8e-17  43%  261 aa  UPPP_THET2 RecName: Full=Undecaprenyl-diphosphatase;       
   13::243     1e-16  26%  254 aa  UPPP_SULNB RecName: Full=Undecaprenyl-diphosphatase;       
   16::248     1e-16  28%  265 aa  UPPP_IDILO RecName: Full=Undecaprenyl-diphosphatase;       
    1::24      1e-16  38%  261 aa  UPPP_THET8 RecName: Full=Undecaprenyl-diphosphatase;       
    6::255     1e-16  29%  267 aa  UPPP_DICNV RecName: Full=Undecaprenyl-diphosphatase;       
    3::256     2e-16  28%  270 aa  UPPP2_PSEU5 RecName: Full=Undecaprenyl-diphosphatase 2;       
   16::264     3e-16  28%  281 aa  UPPP_SYNFM RecName: Full=Undecaprenyl-diphosphatase;       
   16::253     3e-16  26%  265 aa  UPPP_MARAV RecName: Full=Undecaprenyl-diphosphatase;       
    3::244     3e-16  35%  266 aa  UPPP_BORBZ RecName: Full=Undecaprenyl-diphosphatase;       
    3::244     3e-16  35%  266 aa  UPPP_BORBU RecName: Full=Undecaprenyl-diphosphatase;       
    2::267     3e-16  28%  294 aa  UPPP_BIFLI RecName: Full=Undecaprenyl-diphosphatase;       
   16::257     3e-16  26%  278 aa  UPPP2_BACHD RecName: Full=Undecaprenyl-diphosphatase 2;       
   20::252     4e-16  31%  263 aa  UPPP_PELCD RecName: Full=Undecaprenyl-diphosphatase;       
    2::202     5e-16  28%  267 aa  UPPP_JANSC RecName: Full=Undecaprenyl-diphosphatase;       
    3::254     7e-16  24%  264 aa  UPPP_VESOH RecName: Full=Undecaprenyl-diphosphatase;       
    3::258     7e-16  30%  275 aa  UPPP_SOLUE RecName: Full=Undecaprenyl-diphosphatase;       
    4::196     9e-16  27%  248 aa  UPPP_THEAB RecName: Full=Undecaprenyl-diphosphatase;       
  107::233     9e-16  35%  256 aa  UPPP_PELUB RecName: Full=Undecaprenyl-diphosphatase;       
   16::256     1e-15  29%  270 aa  UPPP1_BACLD RecName: Full=Undecaprenyl-diphosphatase 1;       
    2::37      2e-15  49%  256 aa  UPPP_SULDN RecName: Full=Undecaprenyl-diphosphatase;       
    2::263     2e-15  33%  295 aa  UPPP_BIFA0 RecName: Full=Undecaprenyl-diphosphatase;       
    2::70      3e-15  36%  282 aa  UPPP_CHLP8 RecName: Full=Undecaprenyl-diphosphatase;       
    2::253     3e-15  26%  266 aa  UPPP_ACAM1 RecName: Full=Undecaprenyl-diphosphatase;       
    3::221     4e-15  26%  250 aa  UPPP_THEM4 RecName: Full=Undecaprenyl-diphosphatase;       
   17::268     4e-15  28%  286 aa  UPPP_SYNR3 RecName: Full=Undecaprenyl-diphosphatase;       
   23::274     4e-15  27%  289 aa  UPPP_PROMA RecName: Full=Undecaprenyl-diphosphatase;       
    6::218     4e-15  42%  290 aa  UPPP_ALHEH RecName: Full=Undecaprenyl-diphosphatase;       
   16::257     6e-15  28%  276 aa  UPPP_MYCVP RecName: Full=Undecaprenyl-diphosphatase;       
  173::230     6e-15  60%  295 aa  UPPP_GRABC RecName: Full=Undecaprenyl-diphosphatase;       
    7::271     6e-15  28%  285 aa  UPPP_GLUDA RecName: Full=Undecaprenyl-diphosphatase;       
    8::43      6e-15  43%  297 aa  UPPP3_FRAAA RecName: Full=Undecaprenyl-diphosphatase 3;       
    2::222     7e-15  26%  267 aa  UPPP_SILPO RecName: Full=Undecaprenyl-diphosphatase;       
    5::44      7e-15  43%  274 aa  UPPP_NOCSJ RecName: Full=Undecaprenyl-diphosphatase;       
    5::208     7e-15  30%  281 aa  UPPP_KINRD RecName: Full=Undecaprenyl-diphosphatase;       
   20::42      7e-15  46%  307 aa  UPPP2_CLOAB RecName: Full=Undecaprenyl-diphosphatase 2;       
   18::281     1e-14  28%  287 aa  UPPP_SYNPX RecName: Full=Undecaprenyl-diphosphatase;       
  104::249     1e-14  36%  264 aa  UPPP_STRMK RecName: Full=Undecaprenyl-diphosphatase;       
   13::263     1e-14  25%  282 aa  UPPP_MYCTU RecName: Full=Undecaprenyl-diphosphatase;       
    7::257     1e-14  25%  276 aa  UPPP_MYCTA RecName: Full=Undecaprenyl-diphosphatase;       
    2::205     1e-14  28%  276 aa  UPPP_MYCS2 RecName: Full=Undecaprenyl-diphosphatase;       
    7::257     1e-14  25%  276 aa  UPPP_MYCBT RecName: Full=Undecaprenyl-diphosphatase;       
    7::257     1e-14  25%  276 aa  UPPP_MYCBP RecName: Full=Undecaprenyl-diphosphatase;       
    7::257     1e-14  25%  276 aa  UPPP_MYCBO RecName: Full=Undecaprenyl-diphosphatase;       
   36::243     1e-14  29%  312 aa  UPPP_TRIEI RecName: Full=Undecaprenyl-diphosphatase;       
   25::278     1e-14  28%  297 aa  UPPP_SYNP6 RecName: Full=Undecaprenyl-diphosphatase;       
   16::269     1e-14  28%  288 aa  UPPP_SYNE7 RecName: Full=Undecaprenyl-diphosphatase;       
    2::37      1e-14  41%  257 aa  UPPP_PARUW RecName: Full=Undecaprenyl-diphosphatase;       
    9::247     2e-14  26%  276 aa  UPPP_MYCUA RecName: Full=Undecaprenyl-diphosphatase;       
   16::257     2e-14  28%  276 aa  UPPP_MYCGI RecName: Full=Undecaprenyl-diphosphatase;       
    2::35      2e-14  44%  304 aa  UPPP_ANADF RecName: Full=Undecaprenyl-diphosphatase;       
   15::253     2e-14  26%  282 aa  UPPP_MYCMM RecName: Full=Undecaprenyl-diphosphatase;       
  104::249     4e-14  35%  264 aa  UPPP_STRM5 RecName: Full=Undecaprenyl-diphosphatase;       
   13::251     4e-14  28%  282 aa  UPPP_MYCLE RecName: Full=Undecaprenyl-diphosphatase;       
   13::251     4e-14  28%  282 aa  UPPP_MYCLB RecName: Full=Undecaprenyl-diphosphatase;       
    3::264     4e-14  27%  283 aa  UPPP_CHLT3 RecName: Full=Undecaprenyl-diphosphatase;       
   14::249     5e-14  27%  277 aa  UPPP_SYNJB RecName: Full=Undecaprenyl-diphosphatase;       
  107::260     5e-14  30%  277 aa  UPPP_METS3 RecName: Full=Undecaprenyl-diphosphatase;       
    3::255     5e-14  26%  272 aa  UPPP_GEOLS RecName: Full=Undecaprenyl-diphosphatase;       
    3::203     6e-14  27%  267 aa  UPPP_SILST RecName: Full=Undecaprenyl-diphosphatase;       
   20::263     6e-14  36%  274 aa  UPPP1_BACHD RecName: Full=Undecaprenyl-diphosphatase 1;       
    4::253     8e-14  27%  265 aa  UPPP_NITOC RecName: Full=Undecaprenyl-diphosphatase;       
    6::213     8e-14  30%  282 aa  UPPP_ACICJ RecName: Full=Undecaprenyl-diphosphatase;       
   42::75      1e-13  37%  343 aa  UPPP_SYNAS RecName: Full=Undecaprenyl-diphosphatase;       
    1::203     1e-13  26%  273 aa  UPPP_SACEN RecName: Full=Undecaprenyl-diphosphatase;       
    2::254     1e-13  23%  266 aa  UPPP_RUTMC RecName: Full=Undecaprenyl-diphosphatase;       
  120::206     1e-13  39%  262 aa  UPPP_KOSOT RecName: Full=Undecaprenyl-diphosphatase;       
    1::262     1e-13  28%  281 aa  UPPP_RHOSR RecName: Full=Undecaprenyl-diphosphatase;       
   31::233     1e-13  28%  299 aa  UPPP_PROMM RecName: Full=Undecaprenyl-diphosphatase;       
    2::220     1e-13  30%  276 aa  UPPP_MYCSS RecName: Full=Undecaprenyl-diphosphatase;       
    2::220     1e-13  30%  276 aa  UPPP_MYCSK RecName: Full=Undecaprenyl-diphosphatase;       
    2::220     1e-13  30%  276 aa  UPPP_MYCSJ RecName: Full=Undecaprenyl-diphosphatase;       
    2::236     2e-13  23%  297 aa  UPPP_MYXXD RecName: Full=Undecaprenyl-diphosphatase;       
    3::250     2e-13  28%  262 aa  UPPP_KORCO RecName: Full=Undecaprenyl-diphosphatase;       
    2::266     7e-13  27%  285 aa  UPPP_HYPNA RecName: Full=Undecaprenyl-diphosphatase;       
    7::249     7e-13  27%  276 aa  UPPP2_BURTA RecName: Full=Undecaprenyl-diphosphatase 2;       
  190::288     1e-12  39%  305 aa  UPPP_MYCPA RecName: Full=Undecaprenyl-diphosphatase;       
  190::288     1e-12  39%  305 aa  UPPP_MYCA1 RecName: Full=Undecaprenyl-diphosphatase;       
    5::260     1e-12  29%  278 aa  UPPP1_STRCO RecName: Full=Undecaprenyl-diphosphatase 1;       
    7::249     2e-12  28%  276 aa  UPPP2_BURCM RecName: Full=Undecaprenyl-diphosphatase 2;       
   16::266     2e-12  25%  283 aa  UPPP_SYNS3 RecName: Full=Undecaprenyl-diphosphatase;       
  103::249     2e-12  33%  276 aa  UPPP2_BURCH RecName: Full=Undecaprenyl-diphosphatase 2;       
  103::249     2e-12  33%  276 aa  UPPP2_BURCA RecName: Full=Undecaprenyl-diphosphatase 2;       
    7::249     3e-12  27%  276 aa  UPPP2_BURS3 RecName: Full=Undecaprenyl-diphosphatase 2;       
    7::249     3e-12  27%  276 aa  UPPP1_BURPS RecName: Full=Undecaprenyl-diphosphatase 1;       
    7::249     3e-12  27%  276 aa  UPPP1_BURP1 RecName: Full=Undecaprenyl-diphosphatase 1;       
    7::249     3e-12  27%  276 aa  UPPP1_BURP0 RecName: Full=Undecaprenyl-diphosphatase 1;       
  137::294     4e-12  33%  313 aa  UPPP_NOCFA RecName: Full=Undecaprenyl-diphosphatase;       
    5::33      6e-12  45%  278 aa  UPPP1_FRAAA RecName: Full=Undecaprenyl-diphosphatase 1;       
    7::249     8e-12  29%  276 aa  UPPP2_BURXL RecName: Full=Undecaprenyl-diphosphatase 2;       
    2::42      1e-11  39%  279 aa  UPPP_TROWT RecName: Full=Undecaprenyl-diphosphatase;       
    2::42      1e-11  39%  279 aa  UPPP_TROW8 RecName: Full=Undecaprenyl-diphosphatase;       
  162::263     1e-11  34%  275 aa  UPPP_OCEIH RecName: Full=Undecaprenyl-diphosphatase;       
   12::280     2e-11  27%  286 aa  UPPP_SYNPW RecName: Full=Undecaprenyl-diphosphatase;       
    7::70      2e-11  34%  290 aa  UPPP_GLOVI RecName: Full=Undecaprenyl-diphosphatase;       
  155::246     2e-11  46%  276 aa  UPPP2_CHRVO RecName: Full=Undecaprenyl-diphosphatase 2;       
    2::234     5e-11  29%  264 aa  UPPP_BORHD RecName: Full=Undecaprenyl-diphosphatase;       
  111::255     2e-10  28%  267 aa  UPPP_WIGBR RecName: Full=Undecaprenyl-diphosphatase;       
    3::205     2e-10  25%  264 aa  UPPP_CAMC5 RecName: Full=Undecaprenyl-diphosphatase;       
   44::85      3e-10  39%  320 aa  UPPP_ANAVT RecName: Full=Undecaprenyl-diphosphatase;       
    2::200     4e-10  27%  267 aa  UPPP_ROSDO RecName: Full=Undecaprenyl-diphosphatase;       
   13::50      9e-10  40%  276 aa  UPPP_SYNJA RecName: Full=Undecaprenyl-diphosphatase;       
    2::40      9e-10  46%  267 aa  UPPP_DINSH RecName: Full=Undecaprenyl-diphosphatase;       
    3::40      1e-09  39%  264 aa  UPPP_BORAP RecName: Full=Undecaprenyl-diphosphatase;       
   68::120     3e-09  47%  181 aa  UPPP_METTH RecName: Full=Undecaprenyl-diphosphatase;       
  228::272     5e-09  58%  343 aa  UPPP2_FRAAA RecName: Full=Undecaprenyl-diphosphatase 2;       
    3::40      6e-09  37%  266 aa  UPPP_BORGA RecName: Full=Undecaprenyl-diphosphatase;       
    1::29      6e-09  34%  264 aa  UPPP2_RHILO RecName: Full=Undecaprenyl-diphosphatase 2;       
  151::208     8e-09  45%  271 aa  UPPP2_OENOB RecName: Full=Undecaprenyl-diphosphatase 2;       
    2::69      1e-08  31%  278 aa  UPPP_THERP RecName: Full=Undecaprenyl-diphosphatase;       
  131::207     1e-08  38%  237 aa  UPPP_THEP1 RecName: Full=Undecaprenyl-diphosphatase;       
  131::207     1e-08  38%  237 aa  UPPP_THEMA RecName: Full=Undecaprenyl-diphosphatase;       
  131::207     1e-08  38%  237 aa  UPPP_THESQ RecName: Full=Undecaprenyl-diphosphatase;       
  118::249     1e-08  31%  269 aa  UPPP_METKA RecName: Full=Undecaprenyl-diphosphatase;       
    3::40      2e-08  36%  266 aa  UPPP_BORRA RecName: Full=Undecaprenyl-diphosphatase;       
    3::40      2e-08  36%  266 aa  UPPP_BORDL RecName: Full=Undecaprenyl-diphosphatase;       
   15::52      3e-08  42%  279 aa  UPPP_PROMT RecName: Full=Undecaprenyl-diphosphatase;       
   15::52      3e-08  42%  279 aa  UPPP_PROM1 RecName: Full=Undecaprenyl-diphosphatase;       
    2::43      3e-08  50%  282 aa  UPPP_CHLCH RecName: Full=Undecaprenyl-diphosphatase;       
  150::196     4e-08  45%  267 aa  UPPP1_MAGSA RecName: Full=Undecaprenyl-diphosphatase 1;       
  109::238     9e-08  29%  256 aa  UPPP_METTP RecName: Full=Undecaprenyl-diphosphatase;       
    7::255     1e-07  33%  273 aa  UPPP_THEEB RecName: Full=Undecaprenyl-diphosphatase;       
    2::208     1e-07  41%  292 aa  UPPP_ANADE RecName: Full=Undecaprenyl-diphosphatase;       
    2::208     2e-07  43%  292 aa  UPPP_ANASK RecName: Full=Undecaprenyl-diphosphatase;       
    2::208     2e-07  43%  292 aa  UPPP_ANAD2 RecName: Full=Undecaprenyl-diphosphatase;       
   18::270     6e-07  37%  287 aa  UPPP_SYNSC RecName: Full=Undecaprenyl-diphosphatase;       
    3::251     2e-06  25%  265 aa  UPPP_METBU RecName: Full=Undecaprenyl-diphosphatase;       
  155::200     4e-06  43%  270 aa  UPPP_HALMA RecName: Full=Undecaprenyl-diphosphatase;       
    7::258     4e-06  37%  285 aa  UPPP2_ACIAD RecName: Full=Undecaprenyl-diphosphatase 2;       
    2::34      5e-06  35%  265 aa  UPPP_SULIY RecName: Full=Undecaprenyl-diphosphatase;       
    2::34      5e-06  35%  265 aa  UPPP_SULIN RecName: Full=Undecaprenyl-diphosphatase;       
  256::354     5e-06  28%  371 aa  UPPP1_FRASC RecName: Full=Undecaprenyl-diphosphatase 1;       
  155::247     6e-06  33%  278 aa  UPPP_SULSO RecName: Full=Undecaprenyl-diphosphatase;       
  155::247     8e-06  33%  278 aa  UPPP_SULIM RecName: Full=Undecaprenyl-diphosphatase;       
  155::247     8e-06  33%  278 aa  UPPP_SULIK RecName: Full=Undecaprenyl-diphosphatase;       
    4::243     1e-05  21%  268 aa  UPPP_PYRIL RecName: Full=Undecaprenyl-diphosphatase;       
  154::204     1e-05  41%  266 aa  UPPP_PYRAE RecName: Full=Undecaprenyl-diphosphatase;       
  162::215     7e-05  39%  277 aa  UPPP_ACHLI RecName: Full=Undecaprenyl-diphosphatase;       
  190::264     2e-04  27%  282 aa  UPPP_PELLD RecName: Full=Undecaprenyl-diphosphatase;       
  168::208     3e-04  39%  282 aa  UPPP1_RHORT RecName: Full=Undecaprenyl-diphosphatase 1;       
    1::268

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MGDQSIISALLLGIIEGLTEFIPVSSTAHVLLAGHFLGFKSPGNTFXXXXXXXXXXXXXXVYFQKLVSIA
UPPP1_AGRT5     MGDQSIISALLLGIIEGLTEFIPVSSTAHVLLAGHFLGFKSPGNTFXXXXXXXXXXXXXXVYFQKLVSIA
UPPP_RHISN      MADQSIISALVLGLIEGLTEFIPVSSTAHVLLAGHFLGFKSPGNTFXXXXXXXXXXXXXXVYFQKLLSIA
UPPP_RHIME      MADQSIISALVLGLIEGLTEFIPVSSTAHVLLAGHFLGFKSPGNTFXXXXXXXXXXXXXXVYFQKLLAIA
UPPP_SINMW      MADQSIISALVLGLIEGLTEFIPVSSTAHVLLAGHFLGFRSPGNTFXXXXXXXXXXXXXXVYFQKLLSIA
UPPP_BRUSU      ----NLLEAAFLGLIEGLTEFIPVSSTXXXXXXXXXXXXESTGKTFEVLIQLGAILAILSVYSAKLARIA
UPPP_BRUSI      ----NLLEAAFLGLIEGLTEFIPVSSTXXXXXXXXXXXXESTGKTFEVLIQLGAILAILSVYSAKLARIA
UPPP_BRUO2      ----NLLEAAFLGLIEGLTEFIPVSSTXXXXXXXXXXXXESTGKTFEVLIQLGAILAILSVYSAKLARIA
UPPP_BRUME      ----NLLEAAFLGLIEGLTEFIPVSSTXXXXXXXXXXXXESTGKTFEVLIQLGAILAILSVYSAKLARIA
UPPP_BRUMB      ----NLLEAAFLGLIEGLTEFIPVSSTXXXXXXXXXXXXESTGKTFEVLIQLGAILAILSVYSAKLARIA
UPPP_BRUC2      ----NLLEAAFLGLIEGLTEFIPVSSTXXXXXXXXXXXXESTGKTFEVLIQLGAILAILSVYSAKLARIA
UPPP_BRUAB      ----NLLEAAFLGLIEGLTEFIPVSSTXXXXXXXXXXXXESTGKTFEVLIQLGAILAILSVYSAKLARIA
UPPP_BRUA2      ----NLLEAAFLGLIEGLTEFIPVSSTXXXXXXXXXXXXESTGKTFEVLIQLGAILAILSVYSAKLARIA
UPPP_BRUA1      ----NLLEAAFLGLIEGLTEFIPVSSTXXXXXXXXXXXXESTGKTFEVLIQLGAILAILSVYSAKLARIA
UPPP_OCHA4      ----NLLEAAFLGLIEGLTEFIPVSSTXXXXXXXXXXXXESTGKTFEVLIQLGAILAILTVYSAKLLKIL
UPPP1_RHILO     MESQTIVEAXXXXXXXXXTEFIPVSSTGHILLAGHFLGFNSTGKAFEXXXXXXXXXXXXSVYFRRLWQML
UPPP_MESSB      MAEQTIAQALMLGVLEGFTEFIPVSSTGHILLAGHFLGFQSTGKAFEILIQLGAILAVLSVYAGRLWKML
UPPP_PHEZH      ------VLAIILGVVEGLTEFIPVSSTGHIXXXXXXXXXXSTGKVFEVMIQLGAILAVISVYFGRLWSVA
UPPP_CAUCR      ------------------TEFIPVSSTXXXXXXXXXXXXXSPGNTFQVLIQLGAILAITGVYFGRLWGLL
UPPP_CAUCN      ------------------TEFIPVSSTXXXXXXXXXXXXXSPGNTFQVLIQLGAILAITGVYFGRLWGLL
UPPP_PARDP      ------------------TEFIPVSSTGHVLLAGHFLGFDSPGRAFEVLIQLGAIMAILGVYAGRLWRIF
UPPP_RHOP2      -----IIRAVILGVVEGVTEFLPVSSTGHLLLVGRFLGEGDFWKTFDVXXXXXXXXXXXXXYFAKLWRIA
UPPP_BRASO      ------LRAVLLGIVEGVTEFLPVSSTGHLLLAERFFGLGEDGKSFXXXXXXXXXXXXXXXYFFKLSRVA
UPPP_RHOPT      -----IIRAVILGIVEGVTEFLPVSSTGHLLLAERFLGEGNFWKSFAVXXXXXXXXXXXXXYFVKLWRIA
UPPP_RHOPS      -----IFRAVILGVVEGVTEFLPVSSTGHLLLVGRFLGEDSFWKSFAVLIQLGAILAILSIYFAKLWRIA
UPPP_RHOPA      -----IIRAVILGIVEGVTEFLPVSSTGHLLLAERFLGEGNFWKSFAVXXXXXXXXXXXXXYFVKLWRIA
UPPP_BRASB      ------LRAVLLGIIEGVTEFLPVSSTGHLLLAERFFGLGEDGKSFXXXXXXXXXXXXXXXYFFKLSRVA
UPPP_RHOP5      -----IIRAIILGVVEGVTEFLPVSSTGHLLLAERFLGEGPFWKSFAVXXXXXXXXXXXXXYFSKLWNIA
UPPP_BRAJA      ------IRAVILGIIEGVTEFLPVSSTGHLLLAERFLGEGAFWDSFTVLIQLGAILAIVGLYFKKLWDVV
UPPP_RHOPB      -----ILRAVILGIVEGVTEFLPVSSTGHLLLAERFLGDTNFWKSFTXXXXXXXXXXXXXXXXXXXWRIA
UPPP_NITWN      ------IRAVILGIIEGVTEFLPVSSTGHLLLAERFLGSGNFWDTFTVLIQPGAILAIVVIYFAKLWRVA
UPPP_NITHX      ------IRAVILGIVEGVTEFLPVSSTGHLLLAERFLGSGNFWNTFTVLIQLGAILAIVVIYFEKLWRIA
UPPP_RHOS4      --------------------FIPVSSTXXXXXXXXXXXXESAGRSFEVVIQLGAVLAVLTVYAAKLVSVI
UPPP_RHOS1      --------------------FIPVSSTXXXXXXXXXXXXESAGRSFEVVIQLGAVLAVLTVYAAKLVSVI
UPPP_OLICO      -----LFKALVLGIVEGVTEFLPVSSTGHILLAERIFDLDQDNKTFXXXXXXXXXXXXXXXYFQRLWRVA
UPPP_PARL1      MNDPNFLHAIILGIVEGVSEFLPISSTGHLIIVGELLGFSSPGKVFEVVIQLGAILAICVLYSGRLTRVL
UPPP_ACIAC      -----LAKAAVMGVVEGLTEFLPVSSTGHLILAGALLGFDDDAKVFDIAIQTGAIFAVVLVYWQKIRETL
UPPP_RHOFD      -----LIKAAIMGLVEGLTEFLPISSTGHLILAGTLLGFDNEGKVFDIAIQTGAIFAVILVYWQKIRDTL
UPPP_POLSJ      -----LIKAAIMGVVEGLTEFLPISSTGHLILAGALLGFDDDAKVFDIAIQTGAIFAVILVYWQKIRDTL
UPPP_NITMU      -----LLKGLILGIVEGLTEFLPISSTGHLILVSDLLNFNDEGKVFTIVIQLGAILAVCWEYRVKLRHVV
UPPP_ZYMMO      ---------------EGVTEFIPVSSTGHLILAERLLGAHGANSSFDIIIQLGAILAVIVFYWERFLNIA
UPPP_RHOS5      --------------------FIPVSSTXXXXXXXXXXXXESAGRSFEVVIQLGAVLAVLTVYASKLISVI
UPPP_DIAST      -----LLKAAIMGVVEGLTEFLPISSTGHLILAGSLLGFDAKAKVFDIAIQTGAIFAVILVYWQRIRATL
UPPP_ACISJ      -----LLKAAIMGVVEGLTEFLPISSTGHLILAGSLLGFDAKAKVFDIAIQTGAIFAVILVYWQRIRATL
UPPP3_ACIAD     MGNIEAFKALFLGFIEGLTEFLPISSTGHLILFGHLIDFHSDGRAFEVVIQLGAILAVCWLYRKKIIDLV
UPPP_PSEMY      --------ALILGIVEGLTEFLPISSTGHLIVVGDLLGFNGETATFKIIIQLGAILAVMWEFRARVLGVV
UPPP2_RHORT     -----LIKAAILGLVEGITEFLPISSTGHLIIAGSLLDFEQKRDVFVIVIQLGAILAVCWEYRRRLTDVV
UPPP_ERWT9      --------AAILGLVEGLTEFLPVSSTGHMILVGHLLGFENKAETFEVVIQLGSILAVVVMFWRRLFGLI
UPPP1_CHRVO     -----LFHSLIMGLVEGITEFLPISSTGHLILTGDLLGFKEKRDVYEIFIQLGAMLAVVWEYRRKIGHTV
UPPP_NEIMB      -----VLKALMMGLVEGFTEFLPISSTGHLIVFGNLIGFHSNHKVFEIAIQLGAVLAVVFEYRQRFSNVL
UPPP_NEIG1      -----VLKALMMGLVEGFTEFLPISSTGHLIVFGNLIGFHSNHKVFEIAIQLGAVLAVVFEYRQRFSNVL
UPPP_AERS4      ----ALFVAFVLGIVEGLTEFLPVSSTGHMIIVGHLLGFEGPAATFEVVIQMGSILAVVAVFWRRLFGLI
UPPP_AERHH      ----ALFVAFVLGIVEGLTEFLPVSSTGHMIIVGHLLGFDGPAATFEVVIQMGSILAVVAVFWRRLFGLI
UPPP_VEREI      -----LVKAAIMGVVEGLTEFLPISSTGHLILAGALLGFDAKAQVFDVAIQTGAILAVILVYWAKIRATL
UPPP_NEIG2      -----VLKALMMGLVEGFTEFLPISSTGHLIVFGNLIGFHSNHKVFEIAIQLGAVLAVVFEYRQRFSNVL
UPPP_THIDA      -----ILHALILGFVEGFTEFLPISSTGHLILAGQLLGFNGEAKVFMXXXXXXXXXXVVWEYRVRLRHVV
UPPP_PSEA7      --------AFILGVVEGLTEFLPISSTGHQIIVADLIGFGGEAKAFNXXXXXXXXXXVVWEFRGKIFQVV
UPPP_SPHWW      --EMSLLSIVLLGIVEGVTEFLPVSSTGHLILAGEVMKVPQGTETFDIVIQLGAILAVVVLYRERFAAVL
UPPP_NEIMF      -----VLKALMMGLVEGFTEFLPISSTGHLIVFGNLIDFHSNHKVFEITIQLGAVLAVVFEYRQRFSNVL
UPPP_NEIMA      -----VLKALMMGLVEGFTEFLPISSTGHLIVFGNLIDFHSNHKVFEITIQLGAVLAVVFEYRQRFSNVL
UPPP_NEIM0      -----VLKALMMGLVEGFTEFLPISSTGHLIVFGNLIGFHSNHKVFEIAIQLGAVLAVVFEYRQRFSNVL
UPPP_METFK      -----LLKAFILGIIEGATEFLPISSTGHLIIVGDLLDFNDDGKVFEIVIQLGAILAVCWEYRSRLISVA
UPPP_RALEJ      ------LKAVILGIVEGLTEFLPISSTGHLILAGQLLDFNDEGKIFEIVIQFGAILAVCWEFRRRIANVL
UPPP_KLEP7      ----SLLVAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDANTFEVVIQLGSILAVVVMFWRRLIGIH
UPPP_KLEP3      ----SLLVAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDANTFEVVIQLGSILAVVVMFWRRLIGIH
UPPP_CAUSK      --------AIVLGLVEGLTEFIPVSSTGHLLLTKIALGLTDPADTFIVLIQLGAVLGVVALYFQRLWAVV
UPPP_AZOSE      ------VIALILGIVEGLTEFLPISSTGHLIIIGDLLGYNATSKVFKIVIQFAAILAVCWDYRERLARVA
UPPP_PSYA2      -----LIQAVIMGIVEGITEFLPISSTGYLILSADLMGFKEKVDLFVVVVQFGAILAVIYDYWDRLWQAL
UPPP_RALME      ------LKAVILGIVEGLTEFLPISSTGHLILAGQLLDFNDEGKIFEIVIQFGAILAVCWEFRQRIGTVI
UPPP_ENT38      ----SLLVAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGEAKTFEVVIQLGSILAVVVMFWRRLIGIH
UPPP1_BACHK     -----IITAFILGIVEGLAEFLPISSTGHLILVGHLLGFEGEAKTFEXXXXXXXXXXXXXXYHKRLVSLC
UPPP_VARPS      -----LVKAAVMGIVEGLTEFLPISSTGHLILAGSLLGFDDDAKVFDIAIQTGAIFAVILVYWQKIHSTV
UPPP1_BACAN     -----IITAFILGIVEGLAEFLPISSTGHLILVGHLLGFEGEAKTFEXXXXXXXXXXXXXXYHKRLVSLC
UPPP_NOVAD      ----TIVTAILLGIVEGLTEFLPVSSTGHLILATELFGYDAQWAMFNVVIQLGAILAVVVQYWRTFWAVG
UPPP_PSYCK      -----LIQAVIMGIVEGITEFLPISSTGYLILSADLMGFKEKVDLFVVVVQFGAILAVIYDYWGRLWQAL
UPPP1_BACAH     -----IIIAFILGIVEGLAEFLPISSTGHLILVGHLLGFEGEAKTFEXXXXXXXXXXXXXXYHKRLVSLC
UPPP1_BACCZ     -----IIIAFILGIVEGLAEFLPISSTGHLILVGHLLGFEGEAKTFEXXXXXXXXXXXXXXYHKRLVSLC
UPPP_POLNA      -----LIKAAIMGIVEGLTEFLPISSTGHLILAGALLGFDDDAKVFDIAIQTGAIFAVILVYWQKIRSTL
UPPP_RALEH      ------LKAVILGIVEGLTEFLPISSTGHLILAGQLLDFNDEGKIFEIVIQFGAILAVCWEFRARIGNVV
UPPP_WOLSU      -----IFHAIILGIVEGLTEFLPVSSTGHLILVSELLGIKQDDKTFEISIQLGSILAVLALFRERLFSLA
UPPP_POLNS      -----LLKAVILGVVEGLTEFLPISSTGHLILVGDLLDFNDDGKAFEVIIQFGAILAVCWEFREKLIKVT
UPPP_ERWCT      ----SLLIAFILGVVEGLTEFLPVSSTGHMIIVGHWLGFDEKAKTFEVIIQLGSILAVVVMFWRRLFGLI
UPPP2_MAGSA     ------------------TEFLPISSTAHLMLIGDMLGFEGPGKTYEIVVQLGAILAVCVVFRQRLWGVA
UPPP_DESMR      ------LAAVVLGIVEGATEFLPVSSTGHLILVGHLIGFTGEADSFDVIIQLGAILAVVCLYWRRFWWLV
UPPP_HERAR      ------LKVIIMGIVEGLTEFLPISSTGHLILAGSLLEFTGPKKVFEIAIQTGAMLAVVWEYRVKIAAVL
UPPP1_PSEU5     ------IQALILGVVEGITEFLPVSSTGHQIIVADLIGFGGEALAFNIIIQLGAILAVIWEYRRKIIDVV
UPPP_THETN      -----LIKAFIMGIVEGLTEFLPISSTGHLIIVGSFIKFTGKFATMFEIVIQLGAILAVVYYFKKILSSL
UPPP_NITEC      -----LIKAFLLGIVEGLTEFLPISSTGHLILAGDLLDFNDDAQVFTVAIQLGAILSVCWEYRARLINVA
UPPP_PECCP      ----SLLIAFILGVVEGLTEFLPVSSTGHMIIVGHWLGFDEKAKTFEVIIQLGSILAVVVMFWRRLFGLI
UPPP_NITEU      ------------------TEFLPISSTGHLILAGDLLNFNDDAKVFTVAIQLGAILAVCWEYRERLVNII
UPPP_PSEA8      --------AFILGVVEGLTEFLPISSTGHQIIVADLIGFGGEAKAFNXXXXXXXXXXVVWEFRGKIFQVV
UPPP_PSEAB      --------AFILGVVEGLTEFLPISSTGHQIIVADLIGFGGEAKAFNXXXXXXXXXXVVWEFRGKIFQVV
UPPP_JANMA      ------LKAIIMGIVEGFTEFLPISSTGHLILAGSLLDFTGPKKVFEIAIQTGAMLAVVWEYRAKIAAVL
UPPP_PSEAE      --------AFILGVVEGLTEFLPISSTGHQIIVADLIGFGGEAKAFNXXXXXXXXXXVVWEFRGKIFQVV
UPPP_FLAJ1      ------LQAIVLAVIEGITEFLPVSSTGHMIIASSFFGIAHEDFTFTIVIQLGAILSVVVLYFKRFFQTL
UPPP_YERE8      ----SLFVAFVLGVVEGLTEFLPVSSTGHMIIVGELLGFTGDAKTFEVIIQLGSILAVVVVFWRRLFGLI
UPPP_DESAD      ----SLFTAAILGIVEGLTEFLPVSSTGHLIITGHLLGFTGEAASFEVAIQLGAILAVVVLYWSRFWGLL
UPPP1_BURCH     -----ICKALILGVVEGLTEFLPVSSTGHLIVAGSFLNFNSHAKTFDVVIQFGAILAVCWEYRQRIVSVV
UPPP1_BURCA     -----ICKALILGVVEGLTEFLPVSSTGHLIVAGSFLNFNSHAKTFDVVIQFGAILAVCWEYRQRIVSVV
UPPP_PSEU2      --------ALILGVVEGLTEFLPISSTGHQIIVADLIDFGGEAMAFNIIIQLGAILAVVWEFRRKILDVV
UPPP_YERPY      ----SLFVAFILGVVEGLTEFLPVSSTGHMIIVGELLGFTGDAKTFEVIIQLGSILAVVVVFWRRLFGLA
UPPP_YERPS      ----SLFVAFILGVVEGLTEFLPVSSTGHMIIVGELLGFTGDAKTFEVIIQLGSILAVVVVFWRRLFGLA
UPPP_YERPP      ----SLFVAFILGVVEGLTEFLPVSSTGHMIIVGELLGFTGDAKTFEVIIQLGSILAVVVVFWRRLFGLA
UPPP_YERPN      ----SLFVAFILGVVEGLTEFLPVSSTGHMIIVGELLGFTGDAKTFEVIIQLGSILAVVVVFWRRLFGLA
UPPP_YERPG      ----SLFVAFILGVVEGLTEFLPVSSTGHMIIVGELLGFTGDAKTFEVIIQLGSILAVVVVFWRRLFGLA
UPPP_YERPE      ----SLFVAFILGVVEGLTEFLPVSSTGHMIIVGELLGFTGDAKTFEVIIQLGSILAVVVVFWRRLFGLA
UPPP_YERPB      ----SLFVAFILGVVEGLTEFLPVSSTGHMIIVGELLGFTGDAKTFEVIIQLGSILAVVVVFWRRLFGLA
UPPP_YERPA      ----SLFVAFILGVVEGLTEFLPVSSTGHMIIVGELLGFTGDAKTFEVIIQLGSILAVVVVFWRRLFGLA
UPPP_YERP3      ----SLFVAFILGVVEGLTEFLPVSSTGHMIIVGELLGFTGDAKTFEVIIQLGSILAVVVVFWRRLFGLA
UPPP_SHISS      ----SLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDAKTFEVVIQLGSILAVVVMFWRRLIGIH
UPPP_PSEF5      --------ALILGIVEGLTEFLPISSTGHQIIVADLLDFGGEAMAFNIIIQLGAILAVVWEFRRKILDVV
UPPP_AZOSB      ------------GIVEGLTEFLPVSSTGHLIILGDLLGYNDEASVFKIVIQLAAILAVCWDYRERLIKVA
UPPP2_BACC1     ---------IIMGAVEGLTEFLPVSSTGHMILTGHLLGFDDEAKVFEVVIQLGSILAVVVIFWKRLWSLV
UPPP_METPP      -----LVKAAIMGIVEGLTEFLPISSTGHLILTASLLNFTGEVKVFDIAIQTGAMFAVIWEYRVRLRATV
UPPP_SHIFL      ----SLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDAKTFEVVIQLGSILAVVVMFWRRLIGIH
UPPP_SHIF8      ----SLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDAKTFEVVIQLGSILAVVVMFWRRLIGIH
UPPP_SHIBS      ----SLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDAKTFEVVIQLGSILAVVVMFWRRLIGIH
UPPP_SHIB3      ----SLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDAKTFEVVIQLGSILAVVVMFWRRLIGIH
UPPP_ECOUT      ----SLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDAKTFEVVIQLGSILAVVVMFWRRLIGIH
UPPP_ECOSE      ----SLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDAKTFEVVIQLGSILAVVVMFWRRLIGIH
UPPP_ECOLU      ----SLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDAKTFEVVIQLGSILAVVVMFWRRLIGIH
UPPP_ECOLI      ----SLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDAKTFEVVIQLGSILAVVVMFWRRLIGIH
UPPP_ECOLC      ----SLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDAKTFEVVIQLGSILAVVVMFWRRLIGIH
UPPP_ECOL6      ----SLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDAKTFEVVIQLGSILAVVVMFWRRLIGIH
UPPP_ECOL5      ----SLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDAKTFEVVIQLGSILAVVVMFWRRLIGIH
UPPP_ECOK1      ----SLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDAKTFEVVIQLGSILAVVVMFWRRLIGIH
UPPP_ECOHS      ----SLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDAKTFEVVIQLGSILAVVVMFWRRLIGIH
UPPP_ECODH      ----SLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDAKTFEVVIQLGSILAVVVMFWRRLIGIH
UPPP_ECOBW      ----SLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDAKTFEVVIQLGSILAVVVMFWRRLIGIH
UPPP_ECO8A      ----SLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDAKTFEVVIQLGSILAVVVMFWRRLIGIH
UPPP_ECO81      ----SLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDAKTFEVVIQLGSILAVVVMFWRRLIGIH
UPPP_ECO5E      ----SLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDAKTFEVVIQLGSILAVVVMFWRRLIGIH
UPPP_ECO57      ----SLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDAKTFEVVIQLGSILAVVVMFWRRLIGIH
UPPP_ECO55      ----SLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDAKTFEVVIQLGSILAVVVMFWRRLIGIH
UPPP_ECO45      ----SLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDAKTFEVVIQLGSILAVVVMFWRRLIGIH
UPPP_ECO27      ----SLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDAKTFEVVIQLGSILAVVVMFWRRLIGIH
UPPP_ECO24      ----SLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDAKTFEVVIQLGSILAVVVMFWRRLIGIH
UPPP3_BACHK     ---------IIMGAVEGLTEFLPVSSTGHMILTGHLIGFDDDAKVFEVVIQLGSILAVVVIFWKRLWSLV
UPPP2_SHEON     ------IKAFFLGVIEGITEFLPISSTGHLILIGDWINFSSEEKVFEVVIQLGGILAVCWLFRDKIININ
UPPP_SPHAL      --------------------FLPVSSTGHLILASEMLGFTGEGSAFKIAIQLGAILAVLVAYRARFWGVG
UPPP_PSESM      --------ALILGIVEGLTEFLPISSTGHQIIVADLIDFGGEAMAFNIIIQLGAILAVVWEFRRKILDVV
UPPP_ESCF3      ----SLLVAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDAKTFEVVIQLGSILAVVVMFWRRLIGIH
UPPP_ECO7I      ----SLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDAKTFEVVIQLGSILAVVVMFWRRLIGIH
UPPP_CITK8      ----SLLVAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDAETFEVVIQLGSILAVVVMFWRRLFGLI
UPPP_PSE14      --------ALILGVVEGLTEFLPISSTGHQIIVADLIDFGGEAMAFNIIIQLGAILAVVWEFRRKILDVV
UPPP_CELJU      -----VIKAIIMGIVEGITELLPISSTGHLILAADVMNFLSHDKVFEIFIQMGAMLAIVWEYRVKIFSSL
UPPP_PSEPW      --------AIILGVVEGLTEFLPISSTGHQIIVADLIGFGGEAMAFNXXXXXXXXXXVVWEFRRKILDVV
UPPP_DECAR      -----LLKALILGIVEGLTEFLPISSTGHLILAGDLLNFNDDGKLFEIVIQSGAILAVVWEYRERLLKVA
UPPP1_BURCM     -----ICKALILGVVEGLTEFLPVSSTGHLIVAGSFLNFNDAAKTFDVVIQFGAILAVCWEYRQRIVSIV
UPPP_PSEPG      --------AIILGVVEGLTEFLPISSTGHQIIVADLIGFGGEAMAFNXXXXXXXXXXVVWEFRGKILEVV
UPPP_ACIBY      MENFEVIKALFLGFVEGLTEFLPISSTGHLILFGHIIDFHSDGGVFEVVIQLGAILAVCWLYRQKIINLI
UPPP_ACIBT      MENFEVIKALFLGFVEGLTEFLPISSTGHLILFGHIIDFHSDGGVFEVVIQLGAILAVCWLYRQKIINLI
UPPP_ACIBS      MENFEVIKALFLGFVEGLTEFLPISSTGHLILFGHIIDFHSDGGVFEVVIQLGAILAVCWLYRQKIINLI
UPPP_ACIBC      MENFEVIKALFLGFVEGLTEFLPISSTGHLILFGHIIDFHSDGGVFEVVIQLGAILAVCWLYRQKIINLI
UPPP_ACIB5      MENFEVIKALFLGFVEGLTEFLPISSTGHLILFGHIIDFHSDGGVFEVVIQLGAILAVCWLYRQKIINLI
UPPP_ACIB3      MENFEVIKALFLGFVEGLTEFLPISSTGHLILFGHIIDFHSDGGVFEVVIQLGAILAVCWLYRQKIINLI
UPPP3_BACCZ     -----------MGAVEGLTEFLPVSSTGHMILTGHLIGFDDDAKVFEVVIQLGSILAVVVIFWKRLWSLV
UPPP3_BACAH     -----------MGAVEGLTEFLPVSSTGHMILTGHLIGFDDDAKVFEVVIQLGSILAVVVIFWKRLWSLV
UPPP2_BACAN     -----------MGAVEGLTEFLPVSSTGHMILTGHLIGFDDDAKVFEVVIQLGSILAVVVIFWKRLWSLV
UPPP_PSEE4      ----SALQAIILGVVEGLTEFLPISSTGHQIIVADLINFGGEAMAFNIIIQLGAILAVVWEFRRKIFDVV
UPPP_LACF3      -----ILKAVILGIVEGITEFLPISSTGHLVLVDEFIKLNEPKDMFNVVIQLGAIMAVVVLYFHKLNSPK
UPPP1_BURS3     -----ICKALILGVVEGLTEFLPVSSTGHLIVAGSFLNFNSHAKTFDVVIQFGAILAVCWEYRQRIASIV
UPPP1_PSEPF     ------LQALILGVVEGLTEFLPISSTGHQIIVADLLDFGGEAMAFNIIIQLGAILAVVWEFRRKILDVV
UPPP_SULSY      ------LEAVILGIVEGLTEFLPISSTGHLILVSNLLGIQQTEQAFEVSIQLGSILAVVFLYFKKFLDLI
UPPP_PHOLL      ----TLFHAAILGVVEGLTEFLPVSSTGHMIIVGHMLGFTGDAETFEVIIQLGSILAVVVVFWRRLFGLI
UPPP_SALPC      ----SLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDAKTFEVVIQLGSILAVVVMFWRRLIGIH
UPPP_SODGM      ------VIAFILGGVEGLTEFLPVSSTGHMILVGSLLGFTDDAKTFEVIIQLGSILAVVVVFWRRLFGLI
UPPP_BURMS      -----ICKALALGIVEGLTEFLPVSSTGHLIVAGSFLRFHEQAKTFDVVIQFGAILAVCWEYRRRIIDVV
UPPP_BURMA      -----ICKALALGIVEGLTEFLPVSSTGHLIVAGSFLRFHEQAKTFDVVIQFGAILAVCWEYRRRIIDVV
UPPP_BURM9      -----ICKALALGIVEGLTEFLPVSSTGHLIVAGSFLRFHEQAKTFDVVIQFGAILAVCWEYRRRIIDVV
UPPP_BURM7      -----ICKALALGIVEGLTEFLPVSSTGHLIVAGSFLRFHEQAKTFDVVIQFGAILAVCWEYRRRIIDVV
UPPP2_BURPS     -----ICKALALGIVEGLTEFLPVSSTGHLIVAGSFLRFHEQAKTFDVVIQFGAILAVCWEYRRRIIDVV
UPPP2_BURP1     -----ICKALALGIVEGLTEFLPVSSTGHLIVAGSFLRFHEQAKTFDVVIQFGAILAVCWEYRRRIIDVV
UPPP2_BURP0     -----ICKALALGIVEGLTEFLPVSSTGHLIVAGSFLRFHEQAKTFDVVIQFGAILAVCWEYRRRIIDVV
UPPP_PERMH      -----IIESIILGIVEGLTEFLPVSSTGHLILVSKLLGLEQTDKAFEVAIQSGAILAVVFLYREKLTHII
UPPP_LACPL      -----IFKAVILGIVEGITEFLPISSTGHLVLVDEFIKMQQSTDMFNVVIQLGAIMAVVVLYFHKLNPLS
UPPP_AZOBR      ------LDAALLGLIEGLTEFLPVSSTGHLIIFDTLLGFEGPGKVFEVVIQLGAILAICTVYFARLWKVV
UPPP_RALPJ      ------------GIVEGLTEFLPISSTGHLILAGQLLDFNDEGKIFEIVIQFGAILAVCWEFRHKIIDVI
UPPP_PSYWF      -----ILKAVIMGIVEGITEFLPISSTGYLILSADLMSFKEKADLFIVVIQLGAILAVIYEYWGRLWHAL
UPPP2_PSEPF     ----TLFKVLILGAVEGLTEFLPISSTGHQIIVADLLEFGGEAMAFNIIIQLGAILAVVWEFRPKIFEIV
UPPP1_BURTA     -----ICKALALGIVEGLTEFLPVSSTGHLIVAGSFLRFHEQAKTFDVVIQFGAILAVCWEYRRRIVDVV
UPPP1_ACIAD     -----LLKAAIMGIVEGITEFLPISSTGHLILASELMNFKEKSAVFVVAIQMGAIAAVIYEYWSRLWGAA
UPPP_ENTS8      ----SLLVAAILGIVEGLTEFLPVSSTGHMIIVGHLLGFEGDAKTFEVVIQLGSILAVVVMFWRRLIGIH
UPPP_RALSO      ------------GIVEGLTEFLPISSTGHLILAGQLLDFNDEGKIFEIVIQFGAILAVCWEFRHKIIDVI
UPPP_DESVH      -----MITAAILGLVEGLTEFLPVSSTGHLIITGELLGFTGPATTFEVAIQLGAILAVVVLYWDRFWGLL
UPPP_DESVV      -----MITAAILGLVEGLTEFLPVSSTGHLIITGELLGFTGPAATFEVAIQLGAILAVVVLYWDRFWGLL
UPPP_DESDA      ----NLLTALILSIVEGLTEFLPVSSSGHLILAGDLLGFVGEAATFDVVIQLGAIMAVVVLYWKRFWGLV
UPPP_LACDB      -----IFKAIILGIIEGVTEFLPISSTGHLYLADYIIKLDQPTNMFMVVIQLGAILSVIVIYFNKLNPFA
UPPP_LACDA      -----IFKAIILGIIEGVTEFLPISSTGHLYLADYIIKLDQPTNMFMVVIQLGAILSVIVIYFNKLNPFA
UPPP_LACC3      -----IIKAVIIGIVEGLTEFLPISSTGHIDLVNHVIKLSQSQNMFEYVIQFGAILAVILLYFNKLNPFS
UPPP1_BURXL     --------ALILGVVEGLTEFLPVSSTGHLIVAGSLLNFTDEAKTFDVVIQLGAILAVCWEYRRRIGSVV
UPPP_CAMFF      ------LNAVILGIVEGLTEFLPVSSTGHMILSAKLLGLEQTSKCFEVVIQLGSILAVVFMFFDRLIKLA
UPPP_LACCB      -----IIKAVIIGIVEGLTEFLPISSTGHIDLVNHVIKLSQSQDMFEYVIQFGAILAVVLLYFNKLNPFS
UPPP_CLOPH      -----LLKVIFLGIVEGITEWLPISSTGHLLLVDEFLKVKDFMSMFNVVIQLGAILAVVVLFFKKLWPFS
UPPP_BDEBA      ----SYLHAIILGIVEGITEFLPISSTGHMIIASSMMGIEDSSFT---------KAFEVIIQFGAIMSVL
UPPP_METCA      ------LNALILGLVEGLTEFLPVSSTGHLILVGELLKFNDDGKLFEVVIQSGAILAVCWEYRRKLVELL
UPPP_PSEPK      --------AIILGVVEGLTEFLPISSTGHQIIVADLIGFGGEAMAFNXXXXXXXXXXVVWEFRSKIFEVV
UPPP_FLAPJ      ------------------TEFLPVSSTGHMIIASSFFGIAHEDFTFTIVIQLGAILSVVVLYFKRFFQTL
UPPP2_ENTFA     -----ILKVIFLGIVEGITEWLPISSTGHMLLVDEFITLNMSEEMFFVVIQLGAILAVVVMFWNKMFPFQ
UPPP2_BACLD     -----IIVAIILGIVEGLTEYAPVSSTGHMIIVDDVLLTPEAANTFKVVIQLGSILAVAFVFKDRILNLL
UPPP_SALAR      ----SLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDAKTFEVVIQLGSILAVVVMFWRRLIGIH
UPPP_PSEP1      --------AIILGVVEGLTEFLPISSTGHQIIVADLIGFGGEAMAFNXXXXXXXXXXVVWEFRSKIFEVV
UPPP_AQUAE      --------AVVLGIVEGISEFLPISSTGHLILTAHILGIKHTDKSFEISIQLGSILAVVVLYFNRLIRIA
UPPP_SALDC      ----SLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDAKTFEVVIQLGSILAVVVMFWRRLIGIH
UPPP_THEPX      -----LIKAFIMGIVEGLTEFLPISSTGHLIIVGKFIHFTGNFATMFEIVIQLGAILAVVFYYRKKIFAS
UPPP_GEOTN      -----LLKAVILGMVEGLTEFAPVSSTGHMIIVDEFLG-KYAANTFKVVIQLGSILAAVVVFFLELLGIR
UPPP_CYTH3      ------LESIILAIVEGVTEFLPVSSTGHMIITSALMGIKSDPFTFEVAIQFGAILSVVVLYFKRFFKFV
UPPP_SALTY      ----SLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDAKTFEVVIQLGSILAVVVMFWRRLIGIH
UPPP_SALTI      ----SLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDAKTFEVVIQLGSILAVVVMFWRRLIGIH
UPPP_SALSV      ----SLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDAKTFEVVIQLGSILAVVVMFWRRLIGIH
UPPP_SALNS      ----SLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDAKTFEVVIQLGSILAVVVMFWRRLIGIH
UPPP_SALHS      ----SLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDAKTFEVVIQLGSILAVVVMFWRRLIGIH
UPPP_SALA4      ----SLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDAKTFEVVIQLGSILAVVVMFWRRLIGIH
UPPP_LACSS      ----NVIKAIILGIVEGFTEWLPISSTGHLVLVGSVLKMKAFMDMFNYVIQFGAILAVVVLYFHKLFSPQ
UPPP2_BACCR     ---------LIMGAVEGLTEFLPVSSTGHMILTGHLIGFDDEAKVFEVVIQLGSILAVVVIFWKRLWSLV
UPPP_SALPK      ----SLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDAKTFEVVIQLGSILAVVVMFWRQLIGIH
UPPP_SALPA      ----SLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDAKTFEVVIQLGSILAVVVMFWRQLIGIH
UPPP_SALCH      ----SLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDAKTFEVVIQLGSILAVVVMFWRQLIGIH
UPPP_AZOVD      --------AFILGVVEGLTEFLPISSTGHQIIIADLIGFGGDAKAFNIIIQLGAILAVVWEFREKVFGVI
UPPP_STRTD      -----LLKAVFLGIVEGITEWLPISSTGHLILVNEFLNLRQSKDMFNIVIQLGAILAVMVIYFKRLNPFQ
UPPP_GEOSW      -----IIKAIILGMVEGLTEFAPVSSTGHMIIVDEFLG-KYAANTFKVVIQLGSILAVVVVFKDRFIDLL
UPPP_THEP3      -----LIKAFIMGIVEGLTEFLPISSTGHLIIVGKFIHFTGNFATMFEIVIQLGAILAVVFHYRKKIFAS
UPPP_DESDG      -----LLTAAVLGLVEGLTEFLPVSSTGHLIITGYLLEYTGPAESFQVAIQLGAILAVVFLYKERFAAL-
UPPP_DEIGD      --------AIIYGIVEGITEFLPISSTGHLIVAGNLMGVKEIRDTFEVVIQGGAILAVLAYYWRDFAGQA
UPPP_SERP5      ----SLFIAFVLGVVEGLTEFLPVSSTGHMIIVGEWLGFTGDAKTFEVIIQLGSILAVVVMFWRRLFGLI
UPPP1_CLOD6     -----IFKAVILGIVQGITEWLPVSSTGHMILVDEFIKLNFSNSTFLVVIQFGSILAVLVIFFRKLFDSA
UPPP_STRT2      -----LLKAVFLGIVEGITEWLPISSTGHLILVNEFLNLRQSKDMFNIVIQLGAILAVMVIYFKRLNPFQ
UPPP_STRT1      -----LLKAVFLGIVEGITEWLPISSTGHLILVNEFLNLRQSKDMFNIVMHLGAILAVMVIYFKRLNPFQ
UPPP_PORGI      ----TILQAIVLAIVEGLTEFLPVSSTGHMIIAEGIMGVESTSRAFTVMIQFGAILSVLVLYRKRFFCFP
UPPP_PORG3      ----TILQAIVLAIVEGLTEFLPVSSTGHMIIAEGIMGVESTSRAFTVMIQFGAILSVLVLYRKRFFCFP
UPPP_DESHD      -----IFKAILLGIVEGITEWLPISSTGHMILVDEFIKLNMSAEMFFVVIQLGAILAVVLLYWKKLNPFT
UPPP_CAMJE      --------ALILGIIEGLTEFLPISSTGHMILGTTILGIDIDEKSFLIIIQLGSILAVIFVFWRKLLKLA
UPPP_LAWIP      ---------VILGLVQGITEFLPVSSTGHLIIVAKFLHFTSKASVFEVAVQLGSIMAVVVIYWNRFIGIR
UPPP_DEIRA      --------SLIYGIVEGITEFLPISSTGHLILTGNLLHVPWPKDTFEVVIQGGAILAVLVYYWRDFLKIR
UPPP1_CLOAB     -----ILKAIFLGIVEGITEWLPISSTGHMILVNEFIRLEAFKQVFLVVIQLGAILSVVLLYFNKLIPFS
UPPP_RENSM      ------IQAAILGIVQGLTEFLPISSSAHIFIVGKLMGLGDPGAAFTAVSQLGTEAAVIVFFWRDIVSIA
UPPP_FUSNN      ---------VILAIVEGITEFLPISSTGHMILVNKLIGGEYLSPTFFLIIIQLGAIFSVVVYFWKDISPF
UPPP_LEUCK      ------IKSIIIGIVEGLTEFLPVSSTGHIILAGGMVWTKSFTAVFDYAIQLGAIFAVIQLYFHKLFSPR
UPPP_EXIS2      -----LLKALLLGFIEGMTEFAPVSSTGHMIIVDDFLG-KYSANTFKIVIQLGSILAVIVVFWKRLFSIE
UPPP_STRSY      -----LLKAIFLGIIEGVTEWLPVSSTGHLILVQEFVKLNQSKNMFNIVIQLGAILAVMTIYFKKL----
UPPP_STRS2      -----LLKAIFLGIIEGVTEWLPVSSTGHLILVQEFVKLNQSKNMFNIVIQLGAILAVMTIYFKKL----
UPPP_CAMHC      ----SIIDAVILGIVEGLTEFLPVSSTGHLILTAGLLNLEQTDTLFEVVIQLGSILAVVFTFFERLIKLI
UPPP_CLOTH      -----LIKAIFLGIVEGITEWLPISSTGHMILVEEFINMNLSDEMFRVVIQLGAIMAVVVLYWNKLFSFE
UPPP_CAMJ8      ------LNALILGIIEGLTEFLPVSSTGHMILGTTILGIDIDEKSFLIIIQLGSILAVIFVFWRKLFQ--
UPPP_META3      -----IIQVIVLSIIEGITEFLPISSTGHLIIVSNLMNLAQNA-----------VQTNFEITIQLASIFA
UPPP1_OENOB     -----ILKAIILGIVEGITEFLPISSTGHLIIVDQFVKISSNKTTFEYVIQLGAIIAVVLLYWKRLWPFG
UPPP_CAMJR      --------ALILGIIEGLTEFLPISSTGHMILGTTILGIDIDEKSFLIIIQLGSILAVIFVFWRKLLKLA
UPPP_CAMJJ      --------ALILGIIEGLTEFLPISSTGHMILGTTILGIDIDEKSFLIIIQLGSILAVIFVFWRKLLKLA
UPPP_STRGC      -----IIKSVIFGIIEGITEWLPISSTGHLILVQEFIHYQKQNEMFNVVIQLGAILAVVFIYFDKLNPFK
UPPP_SORC5      --------AVLLGVLEGLTEFLPVSSTGHLILLGAWLGHQSEAAKTLDIVIQLGAVLAVVVYFRERLSTT
UPPP_THEFY      ----SIIEAIILGLVQGLTEFLPISSSGHLRIVAAFSGWPDPGAAFTAVSQIGTELAVL-IYFRKDVNIL
UPPP_SHEFN      ---------ILLALIQGLTEFLPISSSAHLILPSQILGWADQGLSFDVAVNTGSLFAVVIYFRHEIVVLA
UPPP_CAMJD      --------ALILGIIEGLTEFLPVSSTGHMILGTTILGIDIDEKSFLIIIQLGSILAVIFVFWRKLFQ--
UPPP_SHESH      ---------IILALIQGLTEFLPISSSAHLILPSQLLGWEDQGLSFDVAVNTGSLLAVVMYFRHELWSMF
UPPP_LACLA      ------IRAIILGVIEGITEWLPISSTGHLIIADEFIRLNQSAEMFDVVIQLGAILSVVVLYFHKLNPFN
UPPP_STRZT      -----ILKSIFFGIVEGITEWLPISSTGHLILAEEFIQYQNQNEAFMSMFNVVIQLGAILIYFNKLNPFK
UPPP_STRZP      -----ILKSIFFGIVEGITEWLPISSTGHLILAEEFIQYQNQNEAFMSMFNVVIQLGAILIYFNKLNPFK
UPPP_STRZJ      -----ILKSIFFGIVEGITEWLPISSTGHLILAEEFIQYQNQNEAFMSMFNVVIQLGAILIYFNKLNPFK
UPPP_STRR6      -----ILKSIFFGIVEGITEWLPISSTGHLILAEEFIQYQNQNEAFMSMFNVVIQLGAILIYFNKLNPFK
UPPP_STRPS      -----ILKSIFFGIVEGITEWLPISSTGHLILAEEFIQYQNQNEAFMSMFNVVIQLGAILIYFNKLNPFK
UPPP_STRPN      -----ILKSIFFGIVEGITEWLPISSTGHLILAEEFIQYQNQNEAFMSMFNVVIQLGAILIYFNKLNPFK
UPPP_STRPJ      -----ILKSIFFGIVEGITEWLPISSTGHLILAEEFIQYQNQNEAFMSMFNVVIQLGAILIYFNKLNPFK
UPPP_STRPI      -----ILKSIFFGIVEGITEWLPISSTGHLILAEEFIQYQNQNEAFMSMFNVVIQLGAILIYFNKLNPFK
UPPP_STRP7      -----ILKSIFFGIVEGITEWLPISSTGHLILAEEFIQYQNQNEAFMSMFNVVIQLGAILIYFNKLNPFK
UPPP_STRP4      -----ILKSIFFGIVEGITEWLPISSTGHLILAEEFIQYQNQNEAFMSMFNVVIQLGAILIYFNKLNPFK
UPPP_STRP2      -----ILKSIFFGIVEGITEWLPISSTGHLILAEEFIQYQNQNEAFMSMFNVVIQLGAILIYFNKLNPFK
UPPP2_PSEHT     -----IFNAIILGIIEGITEFLPISSTGHIIVAAQWLGIEATATNFGXXXXXXXXXXXXXNYKDKFIKVA
UPPP_STRPZ      -----LLKAIFFGIIEGITEWLPVSSTGHLILVQEFIRLKAFIEMFNIIIQLGAIIAVMLIYFERLNPFQ
UPPP_STRPF      -----LLKAIFFGIIEGITEWLPVSSTGHLILVQEFIRLKAFIEMFNIVIQLGAIIAVMLIYFERLNPFQ
UPPP_STRPD      -----LLKAIFFGIIEGITEWLPVSSTGHLILVQEFIRLKAFIEMFNIVIQLGAIIAVMLIYFERLNPFQ
UPPP_BORPD      -----LIKAFFLGIIEGLTEFIPVSSTGHLILIGDWINFSSSGKVFEVVIQFGSILAVMWIFRARLWQLI
UPPP_NAUPA      ----SIFDSIILGIVEGITEFLPISSTAHMIIVSTLLGLKQSVQNFEVIIQLGATLAIVLIYLEKI----
UPPP_STRPG      -----LLKAIFFGIIEGITEWLPVSSTGHLILVQEFIRLKAFIEMFNIVIQLGAIIAVMLIYFERLNPFQ
UPPP_STRPM      -----LLKAIFFGIIEGITEWLPVSSTGHLILVQEFIRLKAFIEMFNIVIQLGAIIAVMLIYFERLNPFQ
UPPP_STRP8      -----LLKAIFFGIIEGITEWLPVSSTGHLILVQEFIRLKAFIEMFNIVIQLGAIIAVMLIYFERLNPFQ
UPPP_STRP6      -----LLKAIFFGIIEGITEWLPVSSTGHLILVQEFIRLKAFIEMFNIVIQLGAIIAVMLIYFERLNPFQ
UPPP_STRP3      -----LLKAIFFGIIEGITEWLPVSSTGHLILVQEFIRLKAFIEMFNIVIQLGAIIAVMLIYFERLNPFQ
UPPP_STRP1      -----LLKAIFFGIIEGITEWLPVSSTGHLILVQEFIRLKAFIEMFNIVIQLGAIIAVMLIYFERLNPFQ
UPPP_ARTS2      --------AALLGLVQGLTEFLPISSSAHLRIVGSFLNAADPGAAFTAITQLGTETAVIVYFWRDIVRIV
UPPP_STRPC      -----LLKAIFFGIIEGITEWLPVSSTGHLILVQEFIRLKAFIEMFNIVIQLGAIIAVMLIYFERLNPFQ
UPPP_STRPB      -----LLKAIFFGIIEGITEWLPVSSTGHLILVQEFIRLKAFIEMFNIVIQLGAIIAVMLIYFERLNPFQ
UPPP1_ENTFA     --------AIILGIIEGITEWLPISSTGHLILVDEFIKLKDFMEMFNVVIQLGAIMAVVILYFHKLNPFS
UPPP_SHEWM      ---------IILALIQGLTEFLPISSSAHLILPSQILGWEDQGLAFDVAVHIGSLLAVVLYFRKEVVSLL
UPPP_STAAN      -----LIKGIILGVVEGLTEFAPVSSTGHMILSSEFLGSQS-AFTFKIVIQLGSVFAAAWVFRERFLEIL
UPPP_STAAM      -----LIKGIILGVVEGLTEFAPVSSTGHMILSSEFLGSQS-AFTFKIVIQLGSVFAAAWVFRERFLEIL
UPPP_STAAB      -----LIKGIILGVVEGLTEFAPVSSTGHMILSSEFLGSQS-AFTFKIVIQLGSVFAAAWVFRERFLEIL
UPPP_STAA9      -----LIKGIILGVVEGLTEFAPVSSTGHMILSSEFLGSQS-AFTFKIVIQLGSVFAAAWVFRERFLEIL
UPPP_STAA2      -----LIKGIILGVVEGLTEFAPVSSTGHMILSSEFLGSQS-AFTFKIVIQLGSVFAAAWVFRERFLEIL
UPPP_STAA1      -----LIKGIILGVVEGLTEFAPVSSTGHMILSSEFLGSQS-AFTFKIVIQLGSVFAAAWVFRERFLEIL
UPPP_GEOKA      --------AIILGMVEGLTEFAPVSSTGHMIMVDEFLG-KYAANTFKVVIQLGSILAAVVVFKDRFLDLV
UPPP_DEIDV      ------VYAIVYGIVEGITEFLPISSTGHLILTGNLMGVKEVKDAFEVVIQGGAILSVLVYYWRDFLKIR
UPPP_ANOFW      -----LIKALILGLVEGATEFAPVSSTGHMIISSEFLG-KYGANTFKVVIQLGSVLAAVVVFKDKFFELL
UPPP_STAAW      -----LIKGIILGVVEGLTEFAPVSSTGHMILSSEFLGSQS-AFTFKIVIQLGSVFAAAWVFRERFLEIL
UPPP_STAAS      -----LIKGIILGVVEGLTEFAPVSSTGHMILSSEFLGSQS-AFTFKIVIQLGSVFAAAWVFRERFLEIL
UPPP_SHEHH      ---------IILALIQGLTEFLPISSSAHLILPAQLLGWEDQGLSFDVAVNTGSLLAVVMYFRRELLSMF
UPPP_SHEDO      ---------ILLALIQGLTEFLPISSSAHLILPSQLLGWKDQGFSFDVAVNTGSLLAVVIYFRHDLWTMA
UPPP_ARTCA      ----------LLGLVQGLTEFLPISSSAHLRIVGQFLNAEDPGAAFTAITQLGTETAVVVYFWRDIVRIV
UPPP_ARTAT      ------IEAALLGLVQGLTEFLPISSSAHLRIVGSFLNAADPGAAFTAITQLGTETAVIVYFWRDIVRIV
UPPP_STAAT      -----LIKGIILGVVEGLTEFAPVSSTGHMILSSEFLGSQS-AFTFKIVIQLGSVFAAAWVFRERFLEIL
UPPP_STAAE      -----LIKGIILGVVEGLTEFAPVSSTGHMILSSEFLGSQS-AFTFKIVIQLGSVFAAAWVFRERFLEIL
UPPP_STAA8      -----LIKGIILGVVEGLTEFAPVSSTGHMILSSEFLGSQS-AFTFKIVIQLGSVFAAAWVFRERFLEIL
UPPP_STAA3      -----LIKGIILGVVEGLTEFAPVSSTGHMILSSEFLGSQS-AFTFKIVIQLGSVFAAAWVFRERFLEIL
UPPP_STRA5      -----LLKALFLGVVEGVTEWLPVSSTGHLILVQEFMKLKSFVEMFNIVIQLGAIMAVIVIYFKRLNPFQ
UPPP_STRA3      -----LLKALFLGVVEGVTEWLPVSSTGHLILVQEFMKLKSFVEMFNIVIQLGAIMAVIVIYFKRLNPFQ
UPPP_BACSU      --------AAILGIVEGLTEYAPVSSTGHMIIVDDILMSEEAANSFKVVIQLGSILAVAIVFKDRILNLL
UPPP_BACA2      -----MFTAAVLGIVEGLTEYAPVSSTGHMIIADDILMNPEAANSFKVVIQLGSILAVAIVFKDRILHLL
UPPP_STRA1      -----LLKALFLGVVEGVTEWLPVSSTGHLILVQEFMKLKSFVEMFNIVIQLGAIMAVIVIYFKRLNPFQ
UPPP2_STRAW     ----SWFESLILGLVQGLTEFLPVSSSAHLRLTAAFAGWEDPGAAFTAITQIGTEAAVLIYFRKDIARII
UPPP_STAAU      -----LIKGIILGVVEGLTEFAPVSSTGHMILSSEFLGSQS-AFTFKIVIQLGSVFAAAWVFRERFLEIL
UPPP_STAAC      -----LIKGIILGVVEGLTEFAPVSSTGHMILSSEFLGSQS-AFTFKIVIQLGSVFAAAWVFRERFLEIL
UPPP_SHESW      ---------IILALIQGLTEFLPISSSAHLILPAELLGWEDQGLSFDVAVNTGSLLAVVIYFRHELWNMF
UPPP_SHEPC      ---------IILALIQGLTEFLPISSSAHLILPAELLGWEDQGLSFDVAVNTGSLLAVVIYFRHELWNMF
UPPP_SHEPA      ---------IILALIQGLTEFLPISSSAHLILPAQLLGWEDQGLSFDVAVNTGSLLAVVMYFRREILSMF
UPPP_THEYD      -----LFKAIILGIIQGITEFLPISSTAHLVITPWIFGWSGIVNSLSFDIAVHVGTLISLLYWKDWINIF
UPPP_STAHJ      ------IKGLILGIVEGLTEFAPVSSTGHMILVDEFLGPHS-AFTFKVVIQLGSVFAAAWVYFEMLHSSI
UPPP_LEUMM      ---------------EGLTEFLPVSSTGHIILAEALMKIKAFSSVFDYSIQLGAIFAVIQLYFDKLNPFS
UPPP_XANAC      -----LISALLLGILEGLTEFLPISSTGHLLIAEQWLGRRS--DFFNIVIQAGAILAICLALRQRLWSLA
UPPP_SHEPW      ---------IILALIQGLTEFLPISSSAHLILPAQLLDWQDQGLSFDVAVNTGSLLAVVMYFRKELYSMS
UPPP2_STRCO     ----SWFESLVLGLVQGLTEFLPVSSSAHLRLTAAFSGWHDPGAAFTAITQIGTEAAVL-IYFRKDIGII
UPPP_STRSV      ------------------TEWLPISSTGHLILIQDFIQFKNQSEMFNVVIQLGAILAVVVIYFDKLNPFK
UPPP_SHEB9      ---------IILALIQGLTEFLPISSSAHLILPAQLLGWEDQGLSFDVAVNTGSLFAVVIYFRHELWTMF
UPPP_SHEB8      ---------IILALIQGLTEFLPISSSAHLILPAQLLGWEDQGLSFDVAVNTGSLFAVVIYFRHELWTMF
UPPP_SHEB5      ---------IILALIQGLTEFLPISSSAHLILPAQLLGWEDQGLSFDVAVNTGSLFAVVIYFRHELWTMF
UPPP_SHEB2      ---------IILALIQGLTEFLPISSSAHLILPAQLLGWEDQGLSFDVAVNTGSLFAVVIYFRHELWTMF
UPPP_THICR      -----IFQAAILGIIEGLTEFLPISSTGHLIVVSDWLGIEQTKQN---------------TAFEVIIQVA
UPPP_SHESR      ---------IILALIQGLTEFLPISSSAHLILPAQLLGWEDQGLSFDVAVNTGSLFAVVIYFRNELWAMF
UPPP_SHESM      ---------IILALIQGLTEFLPISSSAHLILPAQLLGWEDQGLSFDVAVNTGSLFAVVIYFRNELWAMF
UPPP_BORPE      -----LLKAFFLGIVEGLTEFIPVSSTGHLIVIGDWINFSSSGKVFEVVIQFGSILAVMWIFRARLWQLI
UPPP_XANC5      -----LISALLLGILEGLTEFLPISSTGHLLIAEQWLGRRS--DFFNIVIQAGAILAICLALRQRLWSLA
UPPP_SHESA      ---------IILALIQGLTEFLPISSSAHLILPAQLLGWEDQGLSFDVAVNTGSLFAVVIYFRNELWAMF
UPPP_BORPA      -----LLKAFFLGIVEGLTEFIPVSSTGHLIVIGDWINFSSSGKVFEVVIQFGSILAVMWIFRARLWQLI
UPPP_BORBR      -----LLKAFFLGIVEGLTEFIPVSSTGHLIVIGDWINFSSSGKVFEVVIQFGSILAVMWIFRARLWQLI
UPPP_XANOR      -----LISALLLGILEGLTEFLPISSTGHLLIAEQWLGRRS--DFFNIVIQAGAILAICLALRQRLWTLA
UPPP_XANOP      -----LISALLLGILEGLTEFLPISSTGHLLIAEQWLGRRS--DFFNIVIQAGAILAICLALRQRLWTLA
UPPP_XANOM      -----LISALLLGILEGLTEFLPISSTGHLLIAEQWLGRRS--DFFNIVIQAGAILAICLALRQRLWTLA
UPPP_PELPD      ----NLLHALILGALQGVTEVLPISSSAHLILVPWLLGWPESGLTFDVALHLGTFLALVVYFRRDIVDMA
UPPP_LEPIN      ------LNAFLRSIIEAITEFLPVSSTGHLFLFSSFFPFYGENDLFDIFIQSGAILSVLFLYREKFKSQI
UPPP_LEPIC      ------LNAFLRSIIEAITEFLPVSSTGHLFLFSSFFPFYGENDLFDIFIQSGAILSVLFLYREKFKSQI
UPPP_CLOTE      --------------VEGLTEFVPVSSTGHLILVSDVINFKGDANLFNVVIQLGAILAVVVVYWDKLLSVK
UPPP_CHLTE      ----NLFQAIILGIIQGLTEFLPISSSAHLRIVPALMGWGDPGAAFTAIIQIGTLAAVLIYFAKDIVSIS
UPPP1_SHEON     ---------IILALIQGLTEFLPISSSAHLILPAQLLGWEDQGLSFDVAVNTGSLFAVVIYFRHELWAMF
UPPP1_PSEHT     ----SIIEIIVLALIQGFTEFLPISSSAHLILPSQILGWEDQGLAFDVAVHVGTLIAVV-IYFRKEVSSI
UPPP_SHEAM      ------LQVIILALIQGLTEFLPISSSAHLILPAQLFGWEDQGLSFDVAVHIGSLAAVVIYFRNEILAML
UPPP_XANCP      -----LISALLLGILEGLTEFLPISSTGHLLIAEQWLGRRS--DFFNIVIQAGAILAICLALRQKLWTLA
UPPP_XANC8      -----LISALLLGILEGLTEFLPISSTGHLLIAEQWLGRRS--DFFNIVIQAGAILAICLALRQKLWTLA
UPPP_PSEA6      ----TLTEIIILAIIQGITEFLPISSSAHLILPSVLLGWENQGLAFDVAVHVGSLLAVMIYFRGDIGRML
UPPP_BAUCH      -----LVVALILGIVEGLTEFLPVSSTGHMILVSYMLGFNN-----------------------------
UPPP_MACCJ      -----LVKALILGIVEGLTEFAPVSSTGHQILVDYVLNSQESANTFKIVIQLGSIFAAAWIFRHRFLEVL
UPPP_RUBXD      -----LLQAVLLGAVQGLTEFLPVSSSGHLLLGQYFLGLDQDGLSFDVALHLGTLVAVVVFFRRDLLRMA
UPPP_LARHH      -----LAKAAIMGIVEGLTEFFPISSTGHLIVVGDLINFDDRGNVFEVVIQLGAILAVCWEYRARLWQVA
UPPP_HALOH      -----IFKVIFLGIIQGLTEFLPISSSGHLVLFQELLGINTDQITLDVFLHFGTVIPVLIIFWDDVRDII
UPPP_ALKMQ      --------AILLGIVQGLTEFLPVSSSGHLAVTQHLLGV--PEDRILFLTILLHVGTLFSVFFKEFILMI
UPPP_XYLFT      -----LFTALMLGILEGITEFLPVSSTGHLLIAEHWLG--SRSDFFNIVIQAGAILAITFVFRKKVWSLA
UPPP_ALCBS      --------ALVLALIQGLTEFLPISSSAHLILPSQILGWPDQGLAFDVAVHLGTLLAVMMYYRRDLIALA
UPPP_VIBHB      ----SYFEAFILALIQGLTEFLPISSSAHLILPSAILGWEDQGLAFDVAVHVGTLMAVVIYFRQEVITLF
UPPP_TERTT      -----LIHVVVLALIQGITEFLPISSSAHLILPKEILGWPDQGLAFDVAVHVGTLTAVAVYFRNDIGKII
UPPP4_BACAH     ------LEAFILGIIQGLTEFLPISSTGHLYLGRHLFQLDEAG-LFLDTMLHIGTLLAVFIYYKKEFIYL
UPPP2_BACSK     ------VVAAILGLVEGLTEYAPVSSTGHMIIVDD-LWLKSSAYVFKIVIQLGSILAVALLFKDRLLQLA
UPPP4_BACCZ     ------LEAFILGIIQGLTEFLPISSTGHLYLGRHLFQLDEAG-LFLDTMLHIGTLLAVFIYYKKEFIYL
UPPP_ALKOO      -----LLKVIFLGIVEGITEWLPISSTGHMILVEEFIQLNASAEMFFVVVQLGAIMAVVLLYFNKLNPFA
UPPP3_BACCR     ------LEAFILGIIQGLTEFLPISSTGHLYLGRHLFRLDEAG-LFLDTMLHIGTLLAVFIYYKKEFIYL
UPPP_VIBVY      ----SYFEAFVLALIQGLTEFLPISSSAHLILPSAILGWEDQGLAFDVAVHVGTLAAVVIYFRKEVITLF
UPPP_VIBVU      ----SYFEAFVLALIQGLTEFLPISSSAHLILPSAILGWEDQGLAFDVAVHVGTLAAVVIYFRKEVITLF
UPPP_STRMU      -----IIKAIIFGIVEGITEWLPISSTGHLILVEEFIXXXXXXXXXXVVIQLGAILAVVVIYFDRLNPFK
UPPP_STREM      -----LLKAIFFGVIEGVTEWLPISSTGHLILVQEFIRLKAFMEMFNIVIQLGAIIAVIVIYFERLNPFQ
UPPP_STACT      ------------GIVEGLTEFAPVSSTGHMILVDEFLGSQS-AFTFKIVIQLGSVFAAAWVFYFEMLYIG
UPPP_GEOSF      -----LFQATILGIVQGLTEVLPISSSAHLILIPTFLKWPESGITFDVALHLGTFIALCLYFWRDLIELA
UPPP_CHLPB      ----TLFEAIILGIVQGLTEFLPISSTAHLRIVPALAGWQDPGAAFSAIVQIGTLAAVLIYFYKDIHSIT
UPPP2_AGRT5     ------MEAGFLGLLQGLTEFLPVSSSAHLRIAGEFLSGADPGAAFTAITQIGTEMAVLVYFWSDIMRIA
UPPP1_BACSK     ----SLLEAVILGLVQGITEFLPISSSAHLILVQALFGMTFAGFSFEILLHLASVLAVILYYRHDLIEII
UPPP_RHIL3      ------INAAILGVIEGITEFLPISSTGHLIIAEQWLGHRS--DMFNIVIQAGAILAVTIIYWRRLVDLV
UPPP3_BACC1     ------LEAFILGIIQGLTEFLPISSTGHLYLGRHLFQLDEAG-LFLDTMLHIGTLLAVFIYYKKEFIYL
UPPP_RHILW      ------INAALLGVIEGITEFLPISSTGHLIIAEQWLGHRS--DMFNIVIQAGAILAVTIIYWRRLLDLV
UPPP_METI4      ---------ILLGIIEGLSEFLPISSTGHLLVAEHWLGERS--ETFNIFIQLGAVLAVCLIYKERLSSFL
UPPP_LACLS      ------------------TEWLPISSTGHLIIADEFIRLNQSAEMFDVVIQLGAILSVVVLYFHKLNPFN
UPPP4_BACHK     ------LEAFILGIIQGLTEFLPISSTGHLYLGRHLFQLDEAG-LFLDTMLHIGTLLAVFIYYKKEFIYL
UPPP_STRE4      -----LLKAIFFGVIEGVTEWLPISSTGHLILVQEFIRLKAFMEMFNIVIQLGAIIAVIVIYFERLNPFQ
UPPP_RHIEC      ------INAAILGVIEGITEFLPISSTGHLIIAEQWLGHRS--DMFNIVIQAGAILAVTIIYWRRLLDLV
UPPP_STRS7      -----LLKAIFFGVIEGVTEWLPISSTGHLILVQEFIRLKAFMEMFNIVIQLGAIIAVIVIYFERLNPFQ
UPPP_PARD8      ----SWFEALILGIVQGLTEYLPVSSSGHLAIGSALFGIEGEENLAFTIVVHVATVFSTLVVLWKEIDWI
UPPP_LACLM      ------------------TEWLPISSTGHLIIADEFIRLNQSAEMFDVVIQLGAILSVVVLYFHKLNPFN
UPPP_VIBSL      ----SYFEAFMLALVQGFTEFLPISSSAHLILPSAVLGWEDQGLAFDVAVHVGTLAAVVIYFRKEVVSLL
UPPP_CLOCE      -----VLKSIVLGIVEGVTEFLPISSTGHLIIFENIMGFKSASKMYTYVIQLGAIMAVVLLYWKKIKETV
UPPP_CHLL2      ----NLFEAVILGIVQGLTEFLPISSTAHLRIIPALAGWKDPGAAFTAIVQIGTLAAVLIYFFRDITAIV
UPPP_PROM5      ---------IFYGIIQGLTEFIPVSSTAHLKIISQLFGVKDPGSSLSAIIQIGSVLAIFW-YFRKYISNS
UPPP_DESOH      ------IQGVVLGIIQGLTEFLPVSSSGHLVLVQHLFGITEPALFFDVSLHMGTLLAVLIVFRKDLGMMA
UPPP_CLAM3      ----SYLEAIILGLVQGLTEFLPISSSAHLRIAGLFMG-GDPGATFTAITQLGTELAVV-VFFRKRISLR
UPPP2_CLOD6     -----ILKSVIIAIVEGLTEFIPVSSTGHMILVGNLIDFKGQAEMFEVVIQLGAILAVVVLYWKKIKDSV
UPPP_CARHZ      --------ALILGLVQGLTEYLPVSSSGHLVLLQKIFGLKENVLLFDILVHLGTLVPLLIIFRDEILAII
UPPP_RHIE6      ------INAALLGVIEGITEFLPISSTGHLIIAEQWLGHRS--DMFNIVIQAGAILAVTIIYWRRLLDLV
UPPP_BLOPB      -----LVFSLILGIVEGLTEFLPISSTGHMILVENIL---------------------------------
UPPP_STRGG      ----SWFESFVLGLVQGLTEFLPISSSAHLRLTAAFAGWHDPGAAFTAISQIGTEAAVLIYFRKDIARIL
UPPP_STAAR      ------------------TEFAPVSSTGHMILSSEFLGSQS-AFTFKIVIQLGSVFAAAWVFRERFLEIL
UPPP_PROM2      ---------ILYGLIQGLTEFLPISSTAHLKIISIFLGIDDPGSSLSATIQLGSVLAIVW-YFQSSKNIL
UPPP_PROMP      ---------IFYGIIQGLTEFIPISSTAHLKIISLLFGMDDPGSSVSAIIQIGSVFAIFW-YFRKSIS--
UPPP_PROA2      ----SLFEAIILGIAQGLTEFLPISSTAHLRIVPALAGWQDPGAAFTAIVQIGTLIAVLIYFFRDIVTIS
UPPP_CLOPS      --------------VEGLTEFVPVSSTGHMILVGDLIHFNTQSGGFPEMYEVVIQLGAILLYWRKISSSV
UPPP_CLOPE      --------------VEGLTEFVPVSSTGHMILVGDLIHFNTQSGGFPEMYEVVIQLGAILLYWRKISSSV
UPPP_CLOP1      --------------VEGLTEFVPVSSTGHMILVGDLIHFNTQSGGFPEMYEVVIQLGAILLYWRKISSSV
UPPP_VIBF1      --------AFFLALLQGFTEFLPISSSAHLILPSAILGWSDQGLAFDVAVHVGTLAAVVIYFRKEVVTLL
UPPP_VIBFM      --------AFFLALLQGFTEFLPISSSAHLILPSAILGWPDQGLAFDVAVHVGTLAAVVIYFRKEVVTLL
UPPP_VIBCM      ----SYFESFILALIQGFTEFLPISSSAHLILPSAILGWEDQGLAFDVAVHVGTLAAVVLYFRKEVVSLL
UPPP_VIBCH      ----SYFESFILALIQGFTEFLPISSSAHLILPSAILGWEDQGLAFDVAVHVGTLAAVVLYFRKEVVSLL
UPPP_VIBC3      ----SYFESFILALIQGFTEFLPISSSAHLILPSAILGWEDQGLAFDVAVHVGTLAAVVLYFRKEVVSLL
UPPP_METVS      ---------ILLGIVQGLTEFLPVSSSGHLAIFTAIFNKTPDVGYFAFLHLATFLAVVIFVKKEIFEIIN
UPPP_ALISL      --------AFFLALLQGFTEFLPISSSAHLILPSEVLGWSDQGLAFDVAVHVGTLAAVVMYFRKEVVTLL
UPPP_VIBPA      ----SYFEAFILALIQGLTEFLPISSSAHLILPSAIFGWADQGLAFDVAVHVGTLMAVVIYFRHEVITLF
UPPP_SACD2      -----ILHAVFLALIQGITEFLPISSSAHLILPKELFGWEDQGLAFDVAVHVGTLSAVILYFRKDIVNLI
UPPP_LEPBP      ------LNAFLRGIIEAATEFLPVSSTGHLFLFSYFFPFQNLSDLFDIFIQTGAILSVVVLYYKTLWSHA
UPPP_LEPBL      ----------------------------------------------------------------------
UPPP_LEPBJ      ----------------------------------------------------------------------
UPPP_LEPBA      ------LNAFLRGIIEAATEFLPVSSTGHLFLFSYFFPFQNLSDLFDIFIQTGAILSVVVLYYKTLWSHA
UPPP_STAS1      ----------------------------------------------------------------------
UPPP_BACTN      ----SWLEAMILGLIQGLTEYLPVSSSGHLAIGSALFGIQGEENLAFTIVVHVATVCSTLVILWKEIDWI
UPPP_SHELP      -----IFQVIVLALIQGLTEFLPISSSAHLILPAQLLGWQDQGLTFDVAVNTGSLLAVVIYFRRELFSMF
UPPP_PELTS      ----TVFQALVLGIIQGLGEFLPISSSAHLVLVPWLFGWQYAGLTFDVALHLGTLISIAAFFWKEIVLIG
UPPP_CLONN      ------------------TEFLPVSSTGHMIIVEDLINFKEPASAFTMIIQLGAILAIVVLYWDKIKNFA
UPPP_BUCBP      ----NIFNAIILGIVEGITEFFPISSSGHLLIFTNILEMKNNEIKILNTIIQTGAALSILLHFKELEQIF
UPPP_BACFR      --------ALILGLIQGLTEYLPVSSSGHLAIGSALFGIEGEENLAFTIVVHVATVFSTLVILWKEIDWI
UPPP_BACFN      --------ALILGLIQGLTEYLPVSSSGHLAIGSALFGIEGEENLAFTIVVHVATVFSTLVILWKEIDWI
UPPP_STAES      ------------------TEFAPVSSTGHMILVDNFLGSQS-AFTFKVVIQLGSVFAAAWVFFLEILHIG
UPPP_STAEQ      ------------------TEFAPVSSTGHMILVDNFLGSQS-AFTFKVVIQLGSVFAAAWVFFLEILHIG
UPPP_COREF      --NMSWTQTLVLSVVQGLTEFLPISSSGHLRIISELFWGADAGASFTAVVQLGTEAAVLVYFAREIWQIL
UPPP_CALS8      ----STFQAIFLGILQGLGEFLPISSSAHLIIFPWLFGWKEHSLVFDVALHLGTLLAVLVYFWRDYIEII
UPPP_RHOBA      ---QELIRVVILAIVQGIAEFLPISSSGHLVILGSMLGELGESVTLEIILHAGTLGSILVVFWQRIWALL
UPPP_MICLC      ------IEAIILGLVQGLTEFLPISSSAHIRIVGEFLSATDPGAAFTAITQLGTELAVLIYFWRDITRIA
UPPP_GEOMG      ------LHATVLGAIQGLTEVLPVSSSAHLILIPWLFGWPESGITFDVALHLGTLIALA-LYFRRDIAEL
UPPP_GEMAT      ----TVWQAIVLGIVQGLTEPLPVSSSAHLALTPYFLGWSDPGLAFDVALHFGTLLALIW-YFRRLEMIA
UPPP_BORA1      ------VKAFFLGIIEGLTEFIPVSSTGHLILFGDWINFES-----------------------------
UPPP_SYMTH      ----TVLQAVILGIVQGLAEFLPISSSAHLILVPWFLGWSPSGLAFDLALHVGTLIAVTIYFWRDLLNLA
UPPP_PSYIN      ----SELQIVVLALIQGLTEFLPISSSAHLILPSQLLGWQDQGLAFDLILNIGTLSAVLIYFRMEVINMS
UPPP_METMP      ---------LILGIVQGLTEFLPISSSGHLAIFTALFNSTPDVGYFAFLHLATFLAVLIFVKAEVFEIIT
UPPP2_CORJK     --DMTWAQTIILSLIQGLTEFLPVSSSGHLRIFSTLLWGEDAGASFTAVIQLGTELAVLVFFAKDIWNIA
UPPP_CHLPD      ----TLFESIVLGVVQGLTEFLPVSSTAHLRIIPALAGWEDPGAAFTAVVQLGTLAAVLIYFYKDIYAIL
UPPP_ALTMD      ----TLFEIIILAIIQGVTEFLPISSSGHLLLPAELLGWVSQGLAFDVAVHVGSLLAVMIYFRQEIGQMT
UPPP_CORGL      ------VQTIVLSIVQGLTEFLPISSSGHLRIISELFWGADAGASFTAVVQLGTEAAVLVFFAKEIWQII
UPPP_SYNWW      ----TLFQAFILGAVQGLTEFLPVSSSGHLVIFQHIFAIEEPPLTFDVLVHLGTLIAVFVAFWDDIWGIL
UPPP_MOOTA      ----TVLQAIVLGLVQGVGEFLPISSSAHLILTPWFFRWPDPGLTFDVALHLGTLIAVVAYFWRDIIELV
UPPP_KOCRD      ------IEAIILGLVQGLTEFLPVSSSAHLRIVGEFLPHGDPGAAFTAITQLGTETAVILFFWRDIVRII
UPPP_DESAP      ---------IVMGIVQGLTEFLPVSSSAHLVLVPWLFGFETPGLVFDVALHLGTLVAVLVYFWRDWLRLV
UPPP_METM5      ---------LILGIVQGLTEFLPISSSGHLAIFTAIFNSTPDVGYFAFLHLATFLAVLIFVKSEVFEIVN
UPPP_CORGB      ------VQTIVLSIVQGLTEFLPISSSGHLRIISELFWGADAGASFTAVVQLGTEAAVLVFFAKEIWQII
UPPP_MAGSM      -----LFNAAILALIQGITEFLPISSSGHLILTPYLLGWQDQGLVFDIAANSGSLAAVM-LYFRRLLCAP
UPPP_CORST      ----SWVQVIVLSIVQGLTEFLPVSSSGHLRIVSQLFWGEDAGASFTAVIQLGTELAVLVFFAKDIWRIL
UPPP_CORDI      ---------IVLSIVQGLTEFLPISSSGHLRIVSELFWGKDAGASFTAVVQLGTEAAVL-VYFAKDIAKI
UPPP_CHRSD      ------LHVVALAVIQGLTEFLPISSSAHLILPSQLLGWPDQGLAFDVAVHVGSLAAVVLAFHREVAHIG
UPPP2_FRASC     ----------VLGLVQGLTEFLPVSSSAHLRIAAALAGWEDPGAAFTAVTQIGTETAVLIYFRRDIARIV
UPPP_PROVI      ----TLFEAIMLGIVQGLTEFLPISSTAHLKIVPALLGWSDPGAAFTAIIQIGTLAAVLMYFWRDIITIV
UPPP_PHOPR      ----SHFEAFMLALIQGLTEFLPVSSSAHLILPSEILGWPDQGLAFDVAVHVGTLAAVILYFRKEVVTLL
UPPP_DESAA      ------LEVVLLGVIQGLTEFLPVSSSGHLVLFQXXXXXXXXXXXXDICLHVGTLAAVLWVFFAQILEAA
UPPP_ANATD      --------AIFLGILQGLGEFLPISSSAHLIIFPWLFGWKEHSLVF-DVALHLGTLLAVLVYFWKIVVQG
UPPP1_CORJK     ----SWVQVIVLSVVQGLTEFLPVSSSGHLRIVSQLFWGEDAGASFTAVIQLGTELAVLVFFAKDIWRIL
UPPP_PROAC      ------LHAIILGIVEGITEFLPVSSTGHLRIVEKLLGYDIQGTAFTXXXXXXXXXXXXLYFWSDIVRIV
UPPP_DESAH      -----LYQGVVLGVLQGLTEFLPVSSSGHLVLGQNFFGITEPALSFDISVHLGTLFAVALVFFKEIKAMV
UPPP_PROM0      ---------VLYGLIQGLTEFIPVSSTAHLKVISLFLGIDDPGASLSATIQLGSVIAIAYYFRNDIFNFR
UPPP_BACV8      --------ALILGVLQGLTEYLPVSSSGHLAIGSALFGIQGEDNTFTIAVHVATVLSTLVILWKEIGWIG
UPPP1_BACCR     -----VLKYLILGLFQGLTEPIPISSSGHLVLAQHLLGLKIEGFSFEXXXXXXXXXXXXXIYRNDLIRLT
UPPP_METM7      ---------LILGIVQGLTEFLPISSSGHLAIFTAIFNSTPDVGYFAFLHLATFLAVLIFVKSEVFEIIN
UPPP_CAMC1      -----ISHVIVLALVQGISEFLPISSSAHLILVPKLLGWPDQGLAFDVAVHVGTLSAILFYFKDTIFKLS
UPPP_BIFLO      ----NFFQAIILGIVQALTEYLPVSSSAHIRIFGDLMLGSDPGAAFTAIIQIGTELAVILYFRHDIINIL
UPPP_BIFLD      ----NFFQAIILGIVQALTEYLPVSSSAHIRIFGDLMLGSDPGAAFTAIIQIGTELAVILYFRHDIINIL
UPPP3_BACAN     -----ILKYLILGLFQGLTEPIPISSSGHLVLAQHLLGLKIEGFSFEXXXXXXXXXXXXXIYRNDLIRLT
UPPP2_BACHK     -----ILKYLILGLFQGLTEPIPISSSGHLVLAQHLLGLKIEGFSFEXXXXXXXXXXXXXIYRNDLIRLT
UPPP2_BACCZ     -----ILKYLILGLFQGLTEPIPISSSGHLVLAQHLLGLKIEGFSFEXXXXXXXXXXXXXIYRNDLIRLT
UPPP2_BACAH     -----ILKYLILGLFQGLTEPIPISSSGHLVLAQHLLGLKIEGFSFEXXXXXXXXXXXXXIYRNDLIRLT
UPPP1_BACC1     -----ILKYLILGLFQGLTEPIPISSSGHLVLAQHLLGLKIEGFSFEXXXXXXXXXXXXXIYRNDLIRLT
UPPP_ACIBL      ------------------TEFLPVSSTAHLRICEALLHIDL-GDGFWKMFSIVIQLGAILIYFRARISEF
UPPP_METM6      ---------LILGVVQGLTEFLPISSSGHLAIFTAIFNATPDVGYFAFLHLATFLAVLIFVKSEVFEIVN
UPPP_HALHL      --------AVLLGVVQGIFMFLPVSSTAHMVLLEHWLIGRD--HPMPAPESAEMILFNLVVHVGTLVSIV
UPPP_FERNB      -----------LGIIQGLTEFLPVSSSGHLALFSKIISFPSDLALFAFFHIATFFAVFILL-FNDIWNIL
UPPP_DESPS      ----------------------------------------------------------------------
UPPP_TREDE      ----SIFQAIILGAVQGLAEFLPISSSGHLAIVEYFFKQEDLPILFDILLHVATLAAVCTVFAKRIAGIR
UPPP_SALRD      --------ALLLGLIQGLTEFIPVSSSGHLVLGQYLLGLEAADVTFEVFVHFGTVLSILTVYWDDVAELV
UPPP_ELUMP      ------VNAVLLGLVQAAGEFLPISSSAHLVLMPWLLGMEYQGLTYDIFLHLATLIAVL-IYFRKIIKDG
UPPP_ACIC1      ------VSAVVLGVIEGVTEFLPVSSTAHLTIAEALMGMKTPAVTAFTAVIQMGAILAAIVYFRRDIRTV
UPPP1_STRAW     --------AVVLGAVEGVTEFLPVSSTGHLKITEGLMGIPVDDNAFSAVIQVGAIAAVLVYFFKDIVRIV
UPPP_PROM9      ----------LYGLIQGLTEFFPVSSTAHLKVISVFFGIDDPGPSLSAIIQLGSVLALVCYFRNDFFKLK
UPPP_BUCAP      ------------------TEFFPVSSTGHMIIFIDWLDIKNKDTKILEIFVQLGSTISVFLFFYKKIIQI
UPPP_HAHCH      ------LEIVVLALIQGLTEFLPISSSAHLILPSEVWGWQDQGLAFDVAVHVGTLLAVM-VYFRNLLNGW
UPPP_BUCAT      ------------------TEFLPISSTGHMIIASHWLKIDNE-NTKILEIFIEFGSALSILYFKKILRIL
UPPP_BUCAI      ------------------TEFLPISSTGHMIIASHWLKIDNE-NTKILEIFIEFGSALSILYFKKILRIL
UPPP_BUCA5      ------------------TEFLPISSTGHMIIASHWLKIDNE-NTKILEIFIEFGSALSILYFKKILRIL
UPPP_ANASP      ----NILQAIVLGFVQGMTEFLPISSTAHLKVVPVALGWGDPGVAFTAIIQLGSIAAVLWYFWGDLTRI-
UPPP3_FRASC     ----NVLEAVFLGAVEGLTEFLPVSSTGHLTILEKLLGIDDPDITAFTAIIQVGAVFATLLYFRRLLAAG
UPPP_PELPB      ----TLFEAIVLGIVQGLTEFLPISSTAHLRIIPALAGWEDPGAAFTAIVQIGTLVAVL-LYFWKDIFII
UPPP_METST      -----ILSAIILGAVQGISEFLPISSSGHLVLVPALLGIET-GLAFDTILHIGTLVAIFTFFWKDIINLI
UPPP_COLP3      ----STLEIIILALLQGLTEFLPISSSAHLILPSQVLGWQDQGLAFDVAVHVGTLLAVMMYFRKELGVMA
UPPP_SYNS9      ----SLLEALVLGIVQGLTEFLPISSTAHLRVVPALLGWDDPGVSVTAAIQLGSVAAVIAYFRRDLTQVL
UPPP_PROMS      ----------LYGLIQGFTEFIPVSSTAHLKVISLFLGIDDPGASLSATIQLGSVLAIAWYFSQSSKKLI
UPPP_PROM3      ---------LVLGVVQGLTEFLPISSTAHLKVVPMLVGWGDPGVS-ATAVIQLGSILAVIVYFKRLKGIA
UPPP_SYNY3      ----NLFQAFVLGFIQGATEFLPISSTAHLKAVPMALGWGDPGVAFTAVIQLGSIGAVFWYFWEDLTGIA
UPPP_GRAFK      -----IFDAIVLGIIQGLTEFLPVSSSGHLELGKAILG--------------------------------
UPPP_GLUOX      ----TLLQALILAIVQGITEPFPVSSLGHAVLLPALLHWDLDEHAFLTMLHVGTLVALAGVFWRDWMAIL
UPPP_BIFAA      ----NFFQAIFLGLVQALTEYLPVSSSAHIRIIGDLMLGSDPGAAFTAIIQIGTELAVILYFRHDIIRIL
UPPP_XYLFA      -----LFTALMLGILEGITEFLPVSSTGHLLIAEHWLGSRS-----------------------------
UPPP_MARMM      ----SLIYLVVLALVQGITEFLPISSSAHLILAPQVLGQADQGPLIDVMAHAGSLLAVLVYFRSDIVSVA
UPPP_THISH      -----LFQTLVLALVQGLTEFLPISSAAHLILVPELTDWDDQGLAFDVATHVGSLAAVVIYFRHELRRMT
UPPP_GEOSL      -----IMHAAVLGILQGLTEILPISSSAHLILVPWLLGWPESGLTF------------------------
UPPP_ERYLH      ----TFLQLLIIAVVQGITEFLPISSSGHLILIPNFTEFPDQGPLIDVAVHVGSLLAIIVYFFKDVLTLA
UPPP_THET2      MGRVSAWEALLLGVVEGLTEFLPV----------------------------------------------
UPPP_SULNB      ---------------EGFTEFLPISSTGHMIVASKFLGVAETDLTYEVIIQFAAILAVMLIYREKITFKK
UPPP_IDILO      ------------------TEFLPISSSAHLILMPILTGWDDQGVGFDLAVHVGTLLAVI-LYFRKDVSES
UPPP_THET8      MGRVSAWEALLLGVVEGLTEFLPV----------------------------------------------
UPPP_DICNV      --------AFILSLIQGITEFLPISSSGHLVITRELLHWQDAGVAFDAFTGLGTLTAVLFYYRKDVCSIL
UPPP2_PSEU5     -----LIQIIVLAIVQGLTEFLPVSSSAHLILFPHLVGWDDQGLAFDVAVHLGTLAAVVWYFRQEVFGMS
UPPP_SYNFM      ------------------TEFLPISSTAHLTLAGKWMGVVSAEHTAFIAVIQLGTMAAVLIYFARVLDIS
UPPP_MARAV      ------------------TEFLPISSSAHLILTPAFFGWEDQGVGFDLSVHVGTLLAVV-LYFRRDVFIS
UPPP_BORBZ      ----NILSAIILGIIQGITEFLPISSSGHLLLFRHFINLKL--SIIFDIYLHLATVLVIIIYYRKLTFIR
UPPP_BORBU      ----NILSAIILGIIQGITEFLPISSSGHLLLFRHFINLKL--SIIFDIYLHLATVLVIIIYYRKLTFIR
UPPP_BIFLI      ----NFFQAIILGIVQALTEYLPVSSSAHIRIFGDLMLGSDPGAAFTAIIQIGTELAVILYFRHDIINIL
UPPP2_BACHD     ------------------TEFLPISSTAHIVITQFLFDYTFPGFGFEIFLHIASILAVILYFRKDLLQVI
UPPP_PELCD      ----------------------PVSSSGHLAIAQHFLGFSQPGVLFDVLLHAGTMAAVL-VYFRRHLALA
UPPP_JANSC      ----SLFTLFLLALVQGITEFLPISSSGHLILLPNLLGIEDQGQAIDVAVHVGTLGAVI-LYFWRDVKAA
UPPP_VESOH      -----VSQTIVLALIQGLSEFLPISSSAHLILVPKLTNWTDQGLIFDVVVHMGTLSAVIFYYQAMIRSLS
UPPP_SOLUE      -----ILQVIVLAVVQGLTEFLPISSTAHLYLTSWLLGWQIEGLDFDIALHIGTLLAVLIFFARDWLQIG
UPPP_THEAB      ---------IVLGLIQGLTEFLPISSSGHLTLFSYLFNIEPNISNFAFLHLATLAAIIVFVW-KEIVEIL
UPPP_PELUB      ----------------------------------------------------------------------
UPPP1_BACLD     ---------------QGFTEPIPVSSSGHLVLAQHFLGLNIEGFSFELLMNAGSLIAVLLVYKNDIFRLA
UPPP_SULDN      ----TILDSIILGAIEGFTEFLPISSTGHLIVASEFLGLE------------------------------
UPPP_BIFA0      ----NFFQAIFLGLVQALTEYLPVSSSAHVRIVGDLMLGGDPGAAFTAIIQIGTELAVLLYFRRDIWNIA
UPPP_CHLP8      ----NLFQAIILGIVQGLTEFLPISSSAHLRIVPALAGWDDPGAAFTAIVQIGTLAAVLIYFMKDIISIV
UPPP_ACAM1      ----TLLQAIILGIVQGLTEFLPVSSSGHLVLASYYLGWWEKLPLYVDIATNTGTFFAVLVVLRKDVWQA
UPPP_THEM4      ---------IILGIVQGLTEFLPISSSGHLSVFSKLFNLKPDLSVFALLHLATLAAIVIFVGKELTEIIK
UPPP_SYNR3      ---------VVLGIVQGLTEFLPISSTAHLKVVPVLAGWGDPGVAVTAVIQLGSIAAVIGYFRSDLLQVC
UPPP_PROMA      ---------LFLGIIQGLTEFFPISSTAHLKVIPLLLSWDDPG-VAVTASLQLGSIIALIAYFWNDLAFL
UPPP_ALHEH      --------AALLGVIQGIFMFLPVSSTAHMVLTEHWLIAR--GETLPPPESAEMILFALVVHVGTLVSIA
UPPP_MYCVP      ------------------TEFLPVSSSGHLAIASRVFFEDDAGASFTAVSQLGTEVAVLVYFARDIVRIV
UPPP_GRABC      ----------------------------------------------------------------------
UPPP_GLUDA      ----TLIQAIVIAILQGATELFPVSSLGHAVIVPALLGFDPHGEIFLPFLVMLHLGTAIAVYFRNDWAAI
UPPP3_FRAAA     ----------VLGLVQGLTEFLPVSSSAHLRITAALAGWDDPGAAF------------------------
UPPP_SILPO      ----SLFHLILVALIQGITEFLPVSSSGHLILLPALTGLEDQGQVIDVAVHVGTLGAVVLYFWRDVRDGL
UPPP_NOCSJ      ------LQALVLGLIQGLTEFLPISSSAHLRIYPELFGWGDPGAAF------------------------
UPPP_KINRD      -----IVEGAFLGLVQGLTEFLPISSSGHLAVVGTLLG-SDPGAAFTAICQLGTEAAVIG-YFRKDISLV
UPPP2_CLOAB     -----------------VTEFLPVSSTGHMIILGSIIGFK------------------------------
UPPP_SYNPX      ---------LVLGIVQGLTEFLPISSTAHLKVVPVLLDWGDPGVSVTAAIQLGSIVAVIAYFRRDLAQVM
UPPP_STRMK      ----------------------------------------------------------------------
UPPP_MYCTU      ---------IVLAAAQGLTEFLPVSSSGHLAIVSRIFFSGDAGASFTAVSQLGTEAAVVIYFARDIVRIL
UPPP_MYCTA      ---------IVLAAAQGLTEFLPVSSSGHLAIVSRIFFSGDAGASFTAVSQLGTEAAVVIYFARDIVRIL
UPPP_MYCS2      ----SWLQVIVLSIVQGLTEFLPVSSSGHLAITSQVFFDDDAGASFTAVTQLGTEFAVL-IYFAKDIGLG
UPPP_MYCBT      ---------IVLAAAQGLTEFLPVSSSGHLAIVSRIFFSGDAGASFTAVSQLGTEAAVVIYFARDIVRIL
UPPP_MYCBP      ---------IVLAAAQGLTEFLPVSSSGHLAIVSRIFFSGDAGASFTAVSQLGTEAAVVIYFARDIVRIL
UPPP_MYCBO      ---------IVLAAAQGLTEFLPVSSSGHLAIVSRIFFSGDAGASFTAVSQLGTEAAVVIYFARDIVRIL
UPPP_TRIEI      ----TIFQAVILGMVQGVTECIPVSSTAHLKIIPVALGWGDPGVAFTAVIQLGSIVSIVWYFWNDLTKIT
UPPP_SYNP6      --------AIVLGFVQGATEFLPISSTAHLKVVPVVLGWGDPGVAFTAVIQLGSIVAVLSYFRQDLTYVL
UPPP_SYNE7      --------AIVLGFVQGATEFLPISSTAHLKVVPVVLGWGDPGVAFTAVIQLGSIVAVLSYFRQDLTYVL
UPPP_PARUW      ----TIWEAFFLGLIQGVTEFLPISSSGHLELAQYFLGFE------------------------------
UPPP_MYCUA      -----------LAVVQGLTEFLPVSSSGHLAVVSRVFFSDDAGASFTAVTQLGTEAAVLVYFARDIVRIL
UPPP_MYCGI      ------------------TEFLPVSSSGHLAIASRVFFEDDAGASFTAVCQLGTEAAVLVYFARDIARIL
UPPP_ANADF      ----SLLAAVFLGVLQAATEFLPVSSTAHLLVFGELLG--------------------------------
UPPP_MYCMM      -----------LAVVQGLTEFLPVSSSGHLAVVSRVFFSDDAGASFTAVTQLGTEAAVLVYFARDIVRIL
UPPP_STRM5      ----------------------------------------------------------------------
UPPP_MYCLE      ---------IVLAVVQGLTEFLPVSSSGHLAIVSRILFTGDAGASFTAVSQLGTEVAVLVYFGRDIVRIL
UPPP_MYCLB      ---------IVLAVVQGLTEFLPVSSSGHLAIVSRILFTGDAGASFTAVSQLGTEVAVLVYFGRDIVRIL
UPPP_CHLT3      -----IIQAIVLGIIQGLTEFLPISSSAHLRIFPALLGWDDPGAAFTAIIQIGTLAAVLIYFYQDILRIT
UPPP_SYNJB      --------ALILGMVQGITEFLPISSTAHLRVFPALVGWPDAGASFTAVIQLGSLGAVL-IYFASDLRQL
UPPP_METS3      ----------------------------------------------------------------------
UPPP_GEOLS      -----LLHAALLGLIQGATEVLPISSSGHLILIPRLLGWPDSGLTFDVALHFGTFLAIF-VYFRKDVVSL
UPPP_SILST      -----LLQLILVALIQGVTEFLPVSSSGHLILLPRLTGLEDQGQAIDVAVHVGTLAAVVLFFWRDVRAGL
UPPP1_BACHD     ---------------QGFTEPIPVSSSGHLVLLQHFLGIEIEGLSFEVMVNFASLFAVIAIYRFDLLKLV
UPPP_NITOC      ------IHILALAILQGLTEFLPISSSAHLILLPVLAGWTDQGLAFDVAVHLGTLVAVISYFRLELARMA
UPPP_ACICJ      --------AVLFAILQGATELFPVSSLGHVVIVPALLHWPSPSFLPFVVMLHVGTATALLLYFWRWAMLA
UPPP_SYNAS      ----AVWEAAILGVVEGITEYLPISSTGHLILASHALG--------------------------------
UPPP_SACEN      ------MQAMVLAVVQGLTEFLPISSSGHLSIVSKLFFGSDAGASFTAVTQIGTELAVVIYFAGDIVRLV
UPPP_RUTMC      ----NIFQTIVLALVQGLSEFLPISSSAHLILVPELTNWTDQSLAFDVVVHMGTLSAVIF-YYQAMIKCS
UPPP_KOSOT      ----------------------------------------------------------------------
UPPP_RHOSR      MGEMSWLQAIVLGTVQGLTEFLPISSSGHLRIVSEVFFGDDAGASFTAVTQLGTEAAVL-IYFARDIGRI
UPPP_PROMM      ---------LVLGVVQGLTEFLPISSTAHLKVVPMLVGWGDPGVS-ATAVIQLGSILAVIAYFKRLKGIA
UPPP_MYCSS      ----SWLQVIVLAVVQGLTEFLPVSSSGHLAIVSRVFFDDDAGASFTAVTQLGTEVAVLVYFARDIGRIA
UPPP_MYCSK      ----SWLQVIVLAVVQGLTEFLPVSSSGHLAIVSRVFFDDDAGASFTAVTQLGTEVAVLVYFARDIGRIA
UPPP_MYCSJ      ----SWLQVIVLAVVQGLTEFLPVSSSGHLAIVSRVFFDDDAGASFTAVTQLGTEVAVLVYFARDIGRIA
UPPP_MYXXD      ----SLLEAIVLGLVQGLTEFLPISSTAHLRIAPELFGWRDPGAAYSAVIQLGTVAAVLIYFRKDIVSLV
UPPP_KORCO      -----IAQALILGIVQGLTEWLPISSSGHLVLSAAFIALVHAGTLLAVIVAFRRDVFNVIKSF--LEGIS
UPPP_HYPNA      ----SILQLVLIALMQGITEWLPISSSAHVMLVSDVVGLAGRDELLINAASNAGTLLAMLLYFRKDVAAA
UPPP2_BURTA     ---------VFLSVLQGVTELFPVSSLGHTLLVPALFGMHIDKHAFLVALHLGTAFALLWYFRERWIALI
UPPP_MYCPA      ----------------------------------------------------------------------
UPPP_MYCA1      ----------------------------------------------------------------------
UPPP1_STRCO     ----SIGQAVVLGAVEGVTEFLPVSSTGHLKIVEGLMGIPVDDDAVIGFSAVIQVGAIAAVYFSKDIMRI
UPPP2_BURCM     ---------VFLSVLQGVTELFPVSSLGHTLLVPALFGMKHAPQLLPFLVALHLGTALALLWYFRARWIA
UPPP_SYNS3      ----------VLGVVQGLTEFLPISSTAHLKVVPVLAGWGDPGLSVTAVIQLGSIVAVIAYFRADLAGVL
UPPP2_BURCH     ----------------------------------------------------------------------
UPPP2_BURCA     ----------------------------------------------------------------------
UPPP2_BURS3     ---------VFLSVLQGVTELFPVSSLGHTLLVPALFGMHIDKHAFLVALHLGTALALLWYFRARWVALA
UPPP1_BURPS     ---------VFLSVLQGVTELFPVSSLGHTLLVPALFGMHIDKHAFLVALHLGTALALLWYFRERWIALI
UPPP1_BURP1     ---------VFLSVLQGVTELFPVSSLGHTLLVPALFGMHIDKHAFLVALHLGTALALLWYFRERWIALI
UPPP1_BURP0     ---------VFLSVLQGVTELFPVSSLGHTLLVPALFGMHIDKHAFLVALHLGTALALLWYFRERWIALI
UPPP_NOCFA      ----------------------------------------------------------------------
UPPP1_FRAAA     ----SVGQAIILGVVEGLTEFLPISSTGHLKIA-------------------------------------
UPPP2_BURXL     ---------IFLSVLQGVTELFPVSSLGHTLLVPALFGMHAPQLLPFLVALHLGTAFALLWYFRKRWCAL
UPPP_TROWT      -----VLEAVLLGIVQGITEFLPISSTAHMYILAKLLNLHVPGRFF------------------------
UPPP_TROW8      -----VLEAVLLGIVQGITEFLPISSTAHMYILAKLLNLHVPGRFF------------------------
UPPP_OCEIH      ----------------------------------------------------------------------
UPPP_SYNPW      ---EAIWRDFVLGVVQGLTEFLPISSTAHLKIVPVLAGWGDPGVSVTAVIQLGSIVAVI-AYFRADLAAV
UPPP_GLOVI      -----IFEAIVLGFVQGITEYFPISSTAHLRVVPALLGWADPGTAYSAVIQLGSLLAVLTYFYKDLVEI-
UPPP2_CHRVO     ----------------------------------------------------------------------
UPPP_BORHD      ---ENVLRVVILGFIQGIAEFLPISSSGHLLLLKKFMHIDLP-IVFDIYLHLATVLVVMIYYCRRLVAVL
UPPP_WIGBR      ----------------------------------------------------------------------
UPPP_CAMC5      -----IVHIIVLSLVQGITEFLPISSSAHLVLVPKLLGWPDQGLAFDVAVHIGTLTAIVFYFKDSIFGLV
UPPP_ANAVT      ----NILQAIVLGFVQGMTEFLPISSTAHLKVVPVALGWGDPGVAF------------------------
UPPP_ROSDO      ----TLFHLILVAAIQGLTEFLPVSSSGHLVLLPALTGQPDQGLAIDVAVHVGSLLAVI-LYFWSDVRIA
UPPP_SYNJA      --------ALVLGMVQGITEFLPISSTAHLRVFPALLGWPDAGASF------------------------
UPPP_DINSH      ----TLFHLILVAVIQGLTEFLPVSSSGHLILLPELSGMADQG---------------------------
UPPP_BORAP      ----NILNAIILGIVQGITEFLPVSSSGHLLLFRHFIHLKLP----------------------------
UPPP_METTH      ----------------------------------------------------------------------
UPPP2_FRAAA     ----------------------------------------------------------------------
UPPP_BORGA      ----NILNAIILGIVQGITEFLPISSSGHLLLFRHFMHLKLP----------------------------
UPPP2_RHILO     --------------MQGITELLPISSTAHMRIVPALLGWQDPG---------------------------
UPPP2_OENOB     ----------------------------------------------------------------------
UPPP_THERP      ----NVWQAAVLGIVQGTTEFLPISSSAHLIVLPWLFDWPEPGLAFNVALHLGTLSAVLAYFWRDLIQIG
UPPP_THEP1      ----------------------------------------------------------------------
UPPP_THEMA      ----------------------------------------------------------------------
UPPP_THESQ      ----------------------------------------------------------------------
UPPP_METKA      ----------------------------------------------------------------------
UPPP_BORRA      ----NILRVIILGFVQGISEFLPISSSGHLLLLKKFMNIDLP----------------------------
UPPP_BORDL      ----NILRVIILGFVQGISEFLPISSSGHLLLLKKFMNIDLP----------------------------
UPPP_PROMT      --------SIFLGIIQGFTEFLPISSTAHLKVVPYLFGWNDLGVSF------------------------
UPPP_PROM1      --------SFFLGIIQGFTEFLPISSTAHLKVVPYLFGWNDLGVSF------------------------
UPPP_CHLCH      ----SLFEALILGIVQGLTEFLPISSTAHLRIIPALAGWNDPGAAF------------------------
UPPP1_MAGSA     ----------------------------------------------------------------------
UPPP_METTP      ----------------------------------------------------------------------
UPPP_THEEB      ------LQAVILGLVQGMTEFLPISSTAHLILFSDLLGWKS-----------------------------
UPPP_ANADE      ----SLVSAALFGLVQALTEFLPVSSTAHLLVFGELLG--------------------------------
UPPP_ANASK      ----SLVSAALFGLLQALTEFLPVSSTAHLLVFGELLG--------------------------------
UPPP_ANAD2      ----SLVSAALFGLLQALTEFLPVSSTAHLLVFGELLG--------------------------------
UPPP_SYNSC      ---------LVLGVVQGLTEFLPISSTAHLKVVPELLGWGDPG---------------------------
UPPP_METBU      ----SLSEAIILGIVQGLAEWLPISSEGMTLVMVTFFGRSLSEAIPISIWLHLGTLLAAIVYFREDVKVL
UPPP_HALMA      ----------------------------------------------------------------------
UPPP2_ACIAD     -----LLHVFILAVIQGLAELLPVSSSAHVILAEKLMGFSAPNMTFLLVMLHTGTMFAVIVYF-------
UPPP_SULIY      ----NFLVSILLGIIQGISEWLPISSKTQELIASHYL---------------------------------
UPPP_SULIN      ----NFLVSILLGIIQGISEWLPISSKTQELIASHYL---------------------------------
UPPP1_FRASC     ----------------------------------------------------------------------
UPPP_SULSO      ----------------------------------------------------------------------
UPPP_SULIM      ----------------------------------------------------------------------
UPPP_SULIK      ----------------------------------------------------------------------
UPPP_PYRIL      ------LTAIVLGVVQGVSEWLPISSKTQVMFVSQLLLSATPELAYSLGLFLEAASVLAALIYFRLVYLK
UPPP_PYRAE      ----------------------------------------------------------------------
UPPP_ACHLI      ----------------------------------------------------------------------
UPPP_PELLD      ----------------------------------------------------------------------
UPPP1_RHORT     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VAMPTSXXXXXXXXXXXXXXXXXXXIGALAHDFIKTVLFETPMLICVVLIIGGFILLAVDRMPLKPKYTD
UPPP1_AGRT5     VAMPTSXXXXXXXXXXXXXXXXXXXIGALAHDFIKTVLFETPMLICVVLIIGGFILLAVDRMPLKPKYTD
UPPP_RHISN      LALPTSVKARRFVFSVXXXXXXXXXXXXXXXXXXKAVLFETPMLICXXXXXXXXXXYAIDRLPLQPRYTD
UPPP_RHIME      LALPTSVKARRFVFSVXXXXXXXXXXXXXXHGFIKSVLFETPMXXXXXXXXXXXXXYAIDRLPLTPRYTD
UPPP_SINMW      LALPTSVRARRFVLSVXXXXXXXXXXXXXXHGFIKSVLFETPMXXXXXXXXXXXXXXXXDRLPLTPRYTD
UPPP_BRUSU      TDFPRDARTRRFVLGVLVAFLPAAVIGALAHGFIKGVLFETPMLVCIMLIVGGFILLWVDQLNLRPRYHN
UPPP_BRUSI      TDFPRDARTRRFVLGVLVAFLPAAVIGALAHGFIKGVLFETPMLVCIMLIVGGFILLWVDQLNLRPRYHN
UPPP_BRUO2      TDFPRDARTRRFVLGVLVAFLPAAVIGALAHGFIKGVLFETPMLVCIMLIVGGFILLWVDQLNLRPRYHN
UPPP_BRUME      TDFPRDARTRRFVLGVLVAFLPAAVIGALAHGFIKGVLFETPMLVCIMLIVGGFILLWVDQLNLRPRYHN
UPPP_BRUMB      TDFPRDARTRRFVLGVLVAFLPAAVIGALAHGFIKGVLFETPMLVCIMLIVGGFILLWVDQLNLRPRYHN
UPPP_BRUC2      TDFPRDARTRRFVLGVLVAFLPAAVIGALAHGFIKGVLFETPMLVCIMLIVGGFILLWVDQLNLRPRYHN
UPPP_BRUAB      TDFPRDARTRRFVLGVLVAFLPAAVIGALAHGFIKGVLFETPMLVCIMLIVGGFILLWVDQLNLRPRYHN
UPPP_BRUA2      TDFPRDARTRRFVLGVLVAFLPAAVIGALAHGFIKGVLFETPMLVCIMLIVGGFILLWVDQLNLRPRYHN
UPPP_BRUA1      TDFPRDARTRRFVLGVLVAFLPAAVIGALAHGFIKGVLFETPMLVCIMLIVGGFILLWVDQLNLRPRYHN
UPPP_OCHA4      TDFPRDARTRRFVFGILVAFLPAAVIGALAHGFIKSVLFETPMLVCIMLIIGGFILLWVDQLNLRPRYHD
UPPP1_RHILO     LDLPHDRLTRHFVIGILIAFLPAAIIGALAHDFIKTVLFESPRLICTMLIIGGVILLAVDRMNLKPVYRD
UPPP_MESSB      IELPHEPATRRFVLGILIAFLPAAIIGVVAYQIIKTVLFETPLLICTMLILGGIVLLWVDRWAKKPLYRD
UPPP_PHEZH      THLHTDPAARRFVASIVLAFLPAGFAGFLLHDYIKAVLFETPAVICVSLILGGFALLAVDRIQREPVYTD
UPPP_CAUCR      TTLPTEPGSRRFVIGILLAFLPAVFVGVAAHDFIKTVLYETPALVCSTLIIGGFILLALDRMKLEPRYTD
UPPP_CAUCN      TTLPTEPGSRRFVIGILLAFLPAVFVGVAAHDFIKTVLYETPALVCSTLIIGGFILLALDRMKLEPRYTD
UPPP_PARDP      SSAPQDPRARRFIXXXXXXXXXXXXIGVLAHRIIKEVLFETPTLIAVMLIVGGVVLLFVDRMANRPRHFS
UPPP_RHOP2      LGMFSDPAAQRFIIGVLVAFLPAAVIGAAAGSYIKLFLFN-PWVVCFSLIVGGAVLLWVDQLDLKPRHHD
UPPP_BRASO      IGALTNPDDRRFIIGVLIAFLPAVIIGLIAGKYIKALLFD-PWVVCFSLIVGGAILLWVDQIDLKPREHD
UPPP_RHOPT      LGMFTDANARRFVIGVLVAFLPAAVIGAAFGGYIKHYLFN-PWVVCFSLIVGGAILLWVDQLDLKPRYHD
UPPP_RHOPS      LGMFSDPAARRFVIGVLVAFLPAAMIGAVAGSYIKLYLFN-PWVVCFSLIVGGAILLWVDQLDLNPQQHD
UPPP_RHOPA      LGMFTDANARRFVIGVLVAFLPAAVIGAAFGGYIKHYLFN-PWVVCFSLIVGGAILLWVDQLDLKPRYHD
UPPP_BRASB      IGALSNADDRRFIIGVLIAFLPAVIIGLIAGKYIKALLFD-PWVVCFSLIVGGAILLWVDQIDLKPREHD
UPPP_RHOP5      RGMFSDPAAQRFVIGVLVAFLPAAVIGAASGGLIKEYLFN-PWVVCFTLILGGGILLWVDQLELKPVHHE
UPPP_BRAJA      IGFFTGDTYSRRFVIGVLVAFLPAVVGLVAGKYIKSVLFN-PWVVCFTLIVGGAILLWVDKLDLKPREHD
UPPP_RHOPB      LGMFSDPAAQRFVIGVLVAFLPAAVIGALAGGYIKSYLFN-PWVVCFSLIVGGAILLWVDQLDLQPTQDE
UPPP_NITWN      LGMFSNPADRRFVIGVLAAFLPAVIVGLIAGKYIKELLFN-PWVVCFSLIVGGAVLMWVDQLDHRPREHD
UPPP_NITHX      LGMFSNDADRRFVIGVLAAFLPAVVVGLIAGKYIKELLFN-PWVVCFSLIVGGAVLMWVDQLDHKPHEHD
UPPP_RHOS4      RAAPHDPXXXXXXXXXXXXXXPAVVIGVLAHGFIKAVLFETPILIATMLILGGIVLLFVDRMAPEPRYDD
UPPP_RHOS1      RAAPHDPXXXXXXXXXXXXXXPAVVIGVLAHGFIKAVLFETPILIATMLILGGIVLLFVDRMAPEPRYDD
UPPP_OLICO      THMFTDPAARRFVIGVLVAFLPAVILGLIFGTFIKEVLFN-PWVVCFSLIAGGAVLLWVDQQDVNPRHHD
UPPP_PARL1      RDAPRDAGARNFIGAIFVALIPAGLLGVLYHDFILEVLF-TPYVVCAALITGGIAIVVVERLHLEPRITS
UPPP_ACIAC      VALPTQPRARRFALNVLIGFLPAVVLALIFGKAIKAHLF-TPVVVASTFILGGFVILAERRAPGAVRVDS
UPPP_RHOFD      VALPTEKQAQRFSLNVLIAFVPAVVLGLLFGKAIKAHLF-TPVVVASTFIIGGFIILWAERRPAAVRIHD
UPPP_POLSJ      VALPTEKQAQQFALNVLVAFVPAVVLGLLFGKAIQAHLF-TPVVVASTFVIGGFIILWAERNPAVARIHE
UPPP_NITMU      TDIGSRQDANRFVLNLLIAFLPAAILGLLFIKTIKQYLFH-PVPVALAFIVGGLLILWAERRPHVVDVER
UPPP_ZYMMO      KGLQHSTSSWHFVRNILCGFIPTVIVGAIAYHAVKALL-EKPMVVAIALFVGGIAMLIIDRESSHPENTS
UPPP_RHOS5      RAAPRDPQXXXXXXXXXXXXXXXXXXGVMAHGFIKTVLFETPXXXXXXXXXXXXXXXFVDRMAPAPRYND
UPPP_DIAST      VALPTERQARRFALNVXXXXXXXXXXXXXXXXXXXXXXF-TPVVVASTFILGGFVILAERRQQAAVRIHA
UPPP_ACISJ      VALPTERQARRFALNVXXXXXXXXXXXXXXXXXXXXXXF-TPVVVASTFILGGFVILAERRQQAAVRIHA
UPPP3_ACIAD     QGFFSGDQEARHFTFSVLMAFFPAVIGVLAVDFIKSVLF-SPXXXXXXXXXXXXXXFWVESRDFKPSTTE
UPPP_PSEMY      LGLRSEPRAQRFTFNLLLAFIPAVVFGLAFADLIEHWLFN-PITVATALIVGGIIMLWAEKREHAIQAES
UPPP2_RHORT     AGLGSDPQSWKFVTNLLIAFLPAVVLGLTFGKAIKAHLF-SPVPVATAFIVGGLVILWAERRPIRVREVD
UPPP_ERWT9      VPHEGSGQGRLTLIHILLGMVPAVVIGLLLHDQIKTLF--NPVNVMYALVVGGVLLIAAELLPKRPKSPG
UPPP1_CHRVO     AGAVRPGGERNLLLGIVIAFIPAAVAGLLFSKQIKAVLFN-PVCVAIAFIVGGLIILWAEKREHKVAVET
UPPP_NEIMB      HGLGKDRKANRFVLNLAIAFIPAAVMGLLFGKQIKEYLFN-PLSVAVMLVLGGFFILWVEKRQSRPKIAD
UPPP_NEIG1      HGVGKDRKANRFVLNLAIAFIPAAVMGLLFDKQIKEYLFN-PLSVAVMLVLGGFFILWVEKRQSRPKIAD
UPPP_AERS4      GIKPPQDHATLSLVHIILGMLPAVIIGLGIHSWIKANLFG-PETVMYALVAGGILLIIAEKFRPTVRSET
UPPP_AERHH      GIKPAQGHATLSLVHIILGMLPAVIIGLAIHSWIKAHLFG-PQTVMYALVAGGILLIIAEKFRPAVRSET
UPPP_VEREI      HALPSERQAQRLAFNLAIGFFPAVLLGLLFGKAIKAHLF-TPVVVASTFIIGGLVILAERRAPAATRILD
UPPP_NEIG2      HGVGKDRKANRFVLNLAIAFIPAAVMGLLFDKQIKEYLFN-PLSVAVMLVLGGFFILWVEKRQSRPKIAD
UPPP_THIDA      STVHTEPASRRLVVNLMAGFLPAAVLGFLFYKEIKGYLFN-PIVVASALVIGGVLILWAERRKHVVSTPT
UPPP_PSEA7      RDLPSQHQAQRFTVNLLIAFFPAVILGVLFADLIHEWLFN-PITVALALVVGGVIMLWAERRQIRAEHVD
UPPP_SPHWW      AGLGRDPAAIRFTRNVLVGFLPSAVIGAVAYGAIKAML-NTPXXXXXXXXXXXXXXXXXERLVRSPTCDS
UPPP_NEIMF      HGVGKDRKANRFVLNLAIAFIPAAVMGLLFGKQIKEYLFN-PLSVAVMLVLGGFFILWVEKRQSRPKIVD
UPPP_NEIMA      HGVGKDRKANRFVLNLAIAFIPAAVMGLLFGKQIKEYLFN-PLSVAVMLVLGGFFILWVEKRQSRPKIVD
UPPP_NEIM0      HGVGKDRKANRFVLNLAIAFIPAAVMGLLFGKQIKEHLFN-PLSVAVMLVLGGLFILWVEKRQAEPKIAD
UPPP_METFK      TTLHTNTSQRFILNLFVAFLPAAI-FGLLLHGFIKEHLFSSITVACA-LIVGGFAILLVDKAPAA-KASN
UPPP_RALEJ      SGLTTDPKAQRFAINVIVATVPAIVLALVFGKWIKAHLFN-PITVALAFIIGGVVILLAERRDARPRIES
UPPP_KLEP7      FGKPPAHEGQGSGRLSLIHILLGMIMGLIFHDTIKSLF--NPVNVMYALIVGGVLLIAAEVLPKQPRAVG
UPPP_KLEP3      FGRPPEHEGKGSGRLSLIHILLGMILGLIFHDTIKSLF--NPVNVMYALIVGGVLLIAAEVLPKQPRAVG
UPPP_CAUSK      VGLPTQPEARRFALTVLIGCIPAFAAGLALHGVIKH-FFENPYLXXXXXXXXXXXXXXXDKKAPPPREMD
UPPP_AZOSE      AGVGSEPAAQRFVGLLFIGFLPAAVLGLMFHSTIKSLLFN-PLTVATALVVGGVLILWLERRAYHPRINA
UPPP_PSYA2      MGLLTGKAEGMSNPRQLGLSLIVATIGFTFADEIKAYLFD-PIVVAIMLIIGGLLIFYVENRPKPIIAQE
UPPP_RALME      SGLASDVKSQRFAVNVIVATIPAIVLALVFGKWIKAHLFN-PITVATAFIIGGVVILLAEWREARPRIES
UPPP_ENT38      FGRPPQHEGEGKGRLTLIHILLGMVLGLIFHDAIKSLF--NPINVMYALVVGGVLLIAAELLPKEPKAPG
UPPP1_BACHK     NIKPLLRKEKKFNAFHVFLGVFPAVVGLLLHDIIKTYLFQ-PYTVVIGLVAGAILMIFAEVKKQEATSYS
UPPP_VARPS      VALPRQAKARRLALNVVIGFLPAVVLGLLFGKMIKAHLF-IPVVVASTFIIGGFIILAEKRPPGSVRIEH
UPPP1_BACAN     NLKPLLRKEKKFNAFHVFLGVFPAVVGLLLHDVIKTYLFQ-PYTVVIGLVAGAILMIFAEVKKQEATSYS
UPPP_NOVAD      MGLLRLEPISLRFLRNLLAAFIPSAILGLALKKYIDVLLGSPSVVCWXXXXXXXXXXVIEKHAKQGEPSG
UPPP_PSYCK      MGLLTGKAEGMSNPRQLGLSLIVATIGFTFADEIKAYLFN-PIVVAIMLIIGGLLIFYVENRPKAIIAEE
UPPP1_BACAH     NIKPLLRKEKKFNAFHVFLGVFPAVVGLLLHDVIKTYLFQ-PYTVVIGLVAGAILMIFAEVKKQEATSYS
UPPP1_BACCZ     NIKPLLRKEKKFNAFHVFLGVFPAVVGLLLHDVIKTYLFQ-PYTVVIGLVAGAILMILAEVKKQEATACS
UPPP_POLNA      IALPNEKQAQQFALNVLVAFVPAVVLGLLFGKAIKAHLF-TPVVVASAFIVGGFIILWAERNPATIRIHD
UPPP_RALEH      RGLRAEPLAQRFAANVVIASVPAIVLAFIFGKWIKAHLFN-PISVALAFIVGGVVILLAEWRDARPRIES
UPPP_WOLSU      VAIPTGA------------------LGFLLYKHVKALF--APSTVAYALILGGIVFLVLEWLHKDKEYVE
UPPP_POLNS      SSFASSPNARRFVLNLFIASIPAMGLGFLFGKHIKAVLF-SPIPVASAFIVGTLIIFWAERVDVSSYIKS
UPPP_ERWCT      VPHEGKTSGRLKLTHILLAMIPAVVLGLIFHDVIKSLFY--PQNVMYSLVIGGFLLLAAEWFPKEPRAVG
UPPP2_MAGSA     TTI-TQPRSFAFARNVMVAFLPAAVIGATLYKYIKQML-ESPXXXXXXXXXXXXXXXXXERLVKRARIHD
UPPP_DESMR      SPKPHAFSGIRGLWMLFLTSLPAGLIGLVARKSIKAYLFN-PWSVALALSVGAVMIFLVEQRKTRDRYYS
UPPP_HERAR      GGLFTERRAQKFAVNIVVAFLPAALLGLVFAGAIKEKLF-APVPVAIAFIVGGFVILWVERRNKQQVHAE
UPPP1_PSEU5     VGLPEERQAQKFTVNLLIAFMPAVVLGVAFADLIHEYLFN-PITVAAALVIGGIVMLWAERRDHAIRAET
UPPP_THETN      KALKPGEWGFNLWYKTFIAFLPAAIIGILTHHYIEEHLF-SPFTVAIALIVGAIMMIVIEDIFGKKYKID
UPPP_NITEC      RGWGTRRANRFVLNLCVAFLPAAI-LGLLFIKTIKYYLFH-PLPVAIALVTGGVLILWAERREHRIEVEN
UPPP_PECCP      VPHEGHTAGRLKLTHILLAMIPAVVLGLVFHDVIKSLFY--PQNVMYXXXXXXXXXXXXEWLPKKPRAVG
UPPP_NITEU      RNLGTRQANRFVINLFIAFLPAAI-LGLLFIKTIKHYLFH-PMPVAIALVTGGILILWAERREHRIEAET
UPPP_PSEA8      RDLPSQRQAQRFTANLLIAFFPAVVLGVLFADLIHEWLFN-PITXXXXXXXXXXXMLWAERRKIHAEHVD
UPPP_PSEAB      RDLPSQRQAQRFTANLLIAFFPAVVLGVLFADLIHEWLFN-PITXXXXXXXXXXXMLWAERRKIHAEHVD
UPPP_JANMA      GGLLTERKAQKFALNIIIAFLPAALLGLVFASKIKEKLF-APVPVAIAFIVGGFIILWIEKRNRNTDFVA
UPPP_PSEAE      RDLPSQRQAQRFTANLLIAFFPAVVLGVLFADLIHEWLFN-PITXXXXXXXXXXXMLWAERRKIRAEHVD
UPPP_FLAJ1      ----------DFYFKLLVAFIPAVVLGLLLSDFIDGLL-ENPVTVAVSLLIGGLILLKVDEWFNNPNAAE
UPPP_YERE8      VPHEGKTNGHLTLGHILLAMIPAVGLGLAFHDVIKS-LFNPQSVMYXXXXXXXXXXXXEWFKPKNPKATG
UPPP_DESAD      FPKPGQQFSGIRGLYLLFLTSLPASVGLLAHDFIKQHLFN-PYTVAWALGVGAIMILIVEKKETTPSCFT
UPPP1_BURCH     SGLPSRPDAQRFTLNVVIATIPAIALGLLFEKKIKAVLF-SPVPVAFALVVGGAIILWAEARQREPRVMS
UPPP1_BURCA     SGLPSRPDAQRFTLNVVIATIPAIALGLLFEKKIKAVLF-SPVPVAFALVVGGAIILWAEARQREPRVMS
UPPP_PSEU2      VGLPKQQQAQRFTLNLLIAFMPAVVLGVIFADTIHHYLFNA-ITVATALVIGGVIMLWAERREHTVRTET
UPPP_YERPY      VPHEGKTNGHLTLGHILLAMIPAVILGLAFHDVIKA-LFDPKSVMYXXXXXXXXXXXXEWLKPKNPKAVG
UPPP_YERPS      VPHEGKTNGHLTLGHILLAMIPAVILGLAFHDVIKA-LFDPKSVMYXXXXXXXXXXXXEWLKPKNPKAVG
UPPP_YERPP      VPHEGKTNGHLTLGHILLAMIPAVILGLAFHDVIKA-LFDPKSVMYXXXXXXXXXXXXEWLKPKNPKAVG
UPPP_YERPN      VPHEGKTNGHLTLGHILLAMIPAVILGLAFHDVIKA-LFDPKSVMYXXXXXXXXXXXXEWLKPKNPKAVG
UPPP_YERPG      VPHEGKTNGHLTLGHILLAMIPAVILGLAFHDVIKA-LFDPKSVMYXXXXXXXXXXXXEWLKPKNPKAVG
UPPP_YERPE      VPHEGKTNGHLTLGHILLAMIPAVILGLAFHDVIKA-LFDPKSVMYXXXXXXXXXXXXEWLKPKNPKAVG
UPPP_YERPB      VPHEGKTNGHLTLGHILLAMIPAVILGLAFHDVIKA-LFDPKSVMYXXXXXXXXXXXXEWLKPKNPKAVG
UPPP_YERPA      VPHEGKTNGHLTLGHILLAMIPAVILGLAFHDVIKA-LFDPKSVMYXXXXXXXXXXXXEWLKPKNPKAVG
UPPP_YERP3      VPHEGKTNGHLTLGHILLAMIPAVILGLAFHDVIKA-LFDPKSVMYXXXXXXXXXXXXEWLKPKNPKAVG
UPPP_SHISS      FGRPLQHEGESKGRLTLIHILLGMILGLLFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLPKEPRAPG
UPPP_PSEF5      IGLPTQPKAQRFTINLLIAFLPAVVLGVIFADLIHAYLFN-PITVATALVVGGLIMLWAERRQHQVHAET
UPPP_AZOSB      VGVPSDRSAQRXXXXXXXXXXXXXXXXXXXHSTIKNVLFN-PXXXXXXXXXXXXIILYVEKRAYHPRVTS
UPPP2_BACC1     GIGKVTDGPSLNLLHIIIGMIPAGVLGVLFHSAIKEVLFG-PGPVVISLVAGGILMIVAEKFSKPSTART
UPPP_METPP      AGITHEAVAQRFVRNLLIAFVPAVISGLALGGLIKEHLFH-PVPVATAFVVGGLIILWVERRHRAARVET
UPPP_SHIFL      FGRPLQHEGESKGRLTLIHILLGMILGLLFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLPKEPRAPG
UPPP_SHIF8      FGRPLQHEGESKGRLTLIHILLGMILGLLFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLPKEPRAPG
UPPP_SHIBS      FGRPLQHEGESKGRLTLIHILLGMILGLLFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLPKEPRAPG
UPPP_SHIB3      FGRPLQHEGESKGRLTLIHILLGMILGLLFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLPKEPRAPG
UPPP_ECOUT      FGRPLQHEGESKGRLTLIHILLGMILGLLFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLPKEPRAPG
UPPP_ECOSE      FGRPLQHEGESKGRLTLIHILLGMILGLLFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLPKEPRAPG
UPPP_ECOLU      FGRPLQHEGESKGRLTLIHILLGMILGLLFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLPKEPRAPG
UPPP_ECOLI      FGRPLQHEGESKGRLTLIHILLGMILGLLFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLPKEPRAPG
UPPP_ECOLC      FGRPLQHEGESKGRLTLIHILLGMILGLLFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLPKEPRAPG
UPPP_ECOL6      FGRPLQHEGESKGRLTLIHILLGMILGLLFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLPKEPRAPG
UPPP_ECOL5      FGRPLQHEGESKGRLTLIHILLGMILGLLFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLPKEPRAPG
UPPP_ECOK1      FGRPLQHEGESKGRLTLIHILLGMILGLLFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLPKEPRAPG
UPPP_ECOHS      FGRPLQHEGESKGRLTLIHILLGMILGLLFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLPKEPRAPG
UPPP_ECODH      FGRPLQHEGESKGRLTLIHILLGMILGLLFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLPKEPRAPG
UPPP_ECOBW      FGRPLQHEGESKGRLTLIHILLGMILGLLFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLPKEPRAPG
UPPP_ECO8A      FGRPLQHEGESKGRLTLIHILLGMILGLLFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLPKEPRAPG
UPPP_ECO81      FGRPLQHEGESKGRLTLIHILLGMILGLLFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLPKEPRAPG
UPPP_ECO5E      FGRPLQHEGESKGRLTLIHILLGMILGLLFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLPKEPRAPG
UPPP_ECO57      FGRPLQHEGESKGRLTLIHILLGMILGLLFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLPKEPRAPG
UPPP_ECO55      FGRPLQHEGESKGRLTLIHILLGMILGLLFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLPKEPRAPG
UPPP_ECO45      FGRPLQHEGESKGRLTLIHILLGMILGLLFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLPKEPRAPG
UPPP_ECO27      FGRPLQHEGENKGRLTLIHILLGMILGLLFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLPKEPRAPG
UPPP_ECO24      FGRPLQHEGESKGRLTLIHILLGMILGLLFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLPKEPRAPG
UPPP3_BACHK     GIGKVTDGPSLNLLHIIIGMIPAGVLGVLFHSAIKEVLFG-PGPVVISLVAGGILMIVAEKFSKPSTART
UPPP2_SHEON     GVLKSDPVAQRFAVIVMISFLPSAIIGALFIHDIKNVLFNTTV-VATALIVGGLIILWVENRKDSEKFK-
UPPP_SPHAL      MGLRADPAAVAFTRNILIGFLPAMLVGAVAYEGVRALL-ESPATVAVALLVGGIAILAIERMVKVVKVES
UPPP_PSESM      VGLPKQQEAQRFTLNLLIAFMPAVVLGVIFADTIHHYLFNA-ITVATALVVGGVIMLWAERRVHTVRTET
UPPP_ESCF3      FGRPLQHEGESKGRLTLIHILLGMILGLLFHDAIKSLF--NPINVMYAXXXXXXXXIAAECLPKEPRAPG
UPPP_ECO7I      FGRPLQHEGESKGRLTLIHILLGMILGLLFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLPKEPRAPG
UPPP_CITK8      QPHEGTGKGRLTLGHIVLGMIPAVVLGLVFHDTIKS-LFNPVNVMYAXXXXXXXXIAAECLKPKEPRAPG
UPPP_PSE14      TGLPKQQQAQRFTLNLLIAFMPAVVLGVIFADTIHHYLFNA-ITVATALVVGGVIMLWAERREHTVRTET
UPPP_CELJU      AGAVRPGIERNLFINVAIAFFPAALVGFLFSDFIRTVLF-SPYXXXXXXXXXXXXXMWVEKYAYAPRLDD
UPPP_PSEPW      FGLKSQPAARRFTANLLLAFMPAVVLGVLFADLIHEYLFN-PITVATALVIGGVIMLWAERRTHSVAVDH
UPPP_DECAR      RGAFSEPAAQKFILNLFVAFLPLAILGLAFGRAIKAHLFN-PVTVASTFILGAFVILWAERREHKIRIQT
UPPP1_BURCM     TGLPSRPDAQRFTLNVVIATIPAIALGLLFEKKIKAVLF-SPVPVAFALVVGGAIILXXXXXXXXXXVQS
UPPP_PSEPG      FGLTSQPKARRFTGNLLLAFMPAVVLGVLFADLIHEYLFN-PITVATALVVGGVIMLWAERREHRVQVDH
UPPP_ACIBY      KGFFSGDVESRHFAISVLIAFSPAVIGVLAVDFIKSVLF-SPXXXXXXXXXXXXXXFWVESKQFEHKTDD
UPPP_ACIBT      KGFFSGDVESRHFAISVLIAFFPAVIGVLAVDFIKSVLF-SPXXXXXXXXXXXXXXFWVESKQFEHKTDD
UPPP_ACIBS      KGFFSGDVESRHFAISVLIAFFPAVIGVLAVDFIKSVLF-SPXXXXXXXXXXXXXXFWVESKQFEHKTDD
UPPP_ACIBC      KGFFSGDVESRHFAISVLIAFFPAVIGVLAVDFIKSVLF-SPXXXXXXXXXXXXXXFWVESKQFEHKTDD
UPPP_ACIB5      KGFFSGDVESRHFAISVLIAFSPAVIGVLAVDFIKSVLF-SPXXXXXXXXXXXXXXFWVESKQFEHKTDD
UPPP_ACIB3      KGFFSGDVESRHFAISVLIAFSPAVIGVLAVDFIKSVLF-SPXXXXXXXXXXXXXXFWVESKQFEHKTDD
UPPP3_BACCZ     GIGKVTDGPSLNLLHIIIGMIPAGVLGVLFHSAIKEVLFG-PGPVVISLVAGGILMIVAEKFSKPSTART
UPPP3_BACAH     GIGKVTDGPSLNLLHIIIGMIPAGVLGVLFHSAIKEVLFG-PGPVVISLVAGGILMIVAEKFSKPSTART
UPPP2_BACAN     GIGKVTDGPSLNLLHIIIGMIPAGVLGVLFHSAIKEVLFG-PGPVVISLVAGGILMIVAEKFSKPSTART
UPPP_PSEE4      LGLPTQAPARRFTANLLIAFFPAVVLGVLFADLIHEYLFN-PITVAAALVVGGVIMLWAERRQHRIEVDH
UPPP_LACF3      KSRLERSQTWTLWKKVIIAVIPSVIIGLPLNDWMDAHLMNW-LVVSIALIVYGVLFIVIENQNLRPRFDS
UPPP1_BURS3     SGLPSRPDARRFTLNVVIATIPAIALGLLFEKKIKAVLF-SPVPVAFALVVGGAIILXXXXXXXXXXVMS
UPPP1_PSEPF     IGLPTQPSARRFTANLLIAFLPAVVLGVIFADLIHHYLFN-PITVAAALVVGGIVMLWAEQRQHEVHAET
UPPP_SULSY      AFIPTGI------------------LGFVLYKIIKSLFNPYXXXXXXXXXXXXXXXXXXYHKNKSYDINS
UPPP_PHOLL      VPHEGKTNGKLKLSHIILAMLPAVTLGLMFHDVIKSLF--NPQSVMYALVIGGVLLITAEILPKTPKAEG
UPPP_SALPC      FGRPLQREGESKGRLTLIHILLGMILGLVFHDTIKSLF--NPINVMYTLVVGGLLLIAAECLPKEPRAPG
UPPP_SODGM      VPHEGIGSGRLRLGHILLGMIPAVVLGLVFHEQIKAIF--APIYVMYXXXXXXXXXXXXEWLPKVPRAAG
UPPP_BURMS      TGLPAQREARRFTMNVVIATVPAVALALLFEKTIKSXXXXXXXXXXXXXXXXXXILWVEGRQPARVQSID
UPPP_BURMA      TGLPAQREARRFTMNVVIATVPAVALALLFEKTIKSXXXXXXXXXXXXXXXXXXILWVEGRQPARVQSID
UPPP_BURM9      TGLPAQREARRFTMNVVIATVPAVALALLFEKTIKSXXXXXXXXXXXXXXXXXXILWVEGRQPARVQSID
UPPP_BURM7      TGLPAQREARRFTMNVVIATVPAVALALLFEKTIKSXXXXXXXXXXXXXXXXXXILWVEGRQPARVQSID
UPPP2_BURPS     TGLPAQREARRFTMNVVIATVPAVALALLFEKTIKSXXXXXXXXXXXXXXXXXXILWVEGRQPARVQSID
UPPP2_BURP1     TGLPAQREARRFTMNVVIATVPAVALALLFEKTIKSXXXXXXXXXXXXXXXXXXILWVEGRQPARVQSID
UPPP2_BURP0     TGLPAQREARRFTMNVVIATVPAVALALLFEKTIKSXXXXXXXXXXXXXXXXXXILWVEGRQPARVQSID
UPPP_PERMH      AFIPTGI------------------LGFLLYKIIKGLF--SPYIVSIMLIVGGLVFIAVEFFYKKSEHQD
UPPP_LACPL      PRKDTTEKRNTWVLWSKVLLAVIPSVGLPLNDWMDEHLMNWAVVSATLIIYGVFIVIENHNKRLTPRFAN
UPPP_AZOBR      TGLKDDPGARHFAMAVILAFLPAMVLGAALHGVIKAVLFN-PTVVSIALILGGVAILMAERLVPAPRYHQ
UPPP_RALPJ      KGLPNDPRQQRFAINVIVATIPAITLALIFGKAIKAHLFN-PIVVASAFILGGFVILWAEXXXXXPRIET
UPPP_PSYWF      MGLITGKSEGPNALKNPRQLGLSLIVGFTLADQIKEYLFN-PYTVAIMLILGGLLIFYVERKQIPVIAEE
UPPP2_PSEPF     KGLPTQSNAQRFTRNLLIAFFPAVILGVLFADTIHEYLFN-PITVAVALVVGGIVMLWAEQRXXXXXXXX
UPPP1_BURTA     TGLPAQREARRFTMNVVXXXXXXXXXXXXFEKTIKSXXXXXXXXXXXXXXXXXXILWVEGRQRERGKPSR
UPPP1_ACIAD     TGMVTGEEKGRHXXXXXXXXXXXXXXXGLSFQTVKDLLFNDXXXXXXXXXXXXXXMW-IEKNPPKVNAVE
UPPP_ENTS8      FGHPPHEGVGKGRLSLIHILLGMVPLGLVFHDFIKSLF--NPINVMYALVVGGVLLIIAEVLPKEPKAPG
UPPP_RALSO      KGLPNDPRQQRFALNVIVATIPAITLALIFGKAIKAHLFN-PIVVASAFIIGGLVILWAEWRERHPRVET
UPPP_DESVH      RPQPVRFAGLRGIMXXXXXXXXXXXXXXAAHSTIKAHLF-TPSTVAIALAVGAIFMLLVERRTERPRYMT
UPPP_DESVV      RPQPVRFAGLRGIMXXXXXXXXXXXXXXAAHSTIKAHLF-TPSTVAIALAVGAIFMLLVERRTERPRYMT
UPPP_DESDA      RPQPYARFAGRRGIVLLMLTSLPACIGLLLHAYIKEYLFR-PATVLIALVVGAICMILVEKRKFKPTCIS
UPPP_LACDB      PSKSKKGQTWQIWFKVIAAVLPSIIIGLPLNDWLEENMTSW-QVISATLIIYGILFIVLENYYAKPSLTD
UPPP_LACDA      PSKSKKGQTWQIWFKVIAAVLPSIIIGLPLNDWLEENMTSW-QVISATLIIYGILFIVLENYYAKPSLTD
UPPP_LACC3      KPTAKARNATWQLWAKVIIAVLPSVVVGLPLNNWMDEHLHTPLVVATTLIIYGVLFIILENY-LKNKITT
UPPP1_BURXL     SGLPSRPDARRFTLNVIIATIPAIVLGLLFEKTIKAALF-SPVPVAFALVAGGVVILWAERGETVARVQN
UPPP_CAMFF      IGVPTAI------------------IGFLAYKHIKT--FFEPSTVAYMLIIGGIVFIVVELWHKKINYEG
UPPP_LACCB      KPTAKARNATWQLWAKVIIAVLPSAVVGLPLNSWMDEHLHTPIVVATTLIVYGILFIILENY-LKNKITT
UPPP_CLOPH      KEEKNFIKKDTFTLWFKIVVACIPGIVMIPFDSKIEDLFFNPQTIATTLILYGILFIIIENRNAQPKVAK
UPPP_BDEBA      VLYKRFLPHWGFYRKLFVAFLPTAIIGFVVKDVVEH-LMGSVQVVAWSLIIGGVILIWADKLTMMGRKTD
UPPP_METCA      FGLGHSRQARRFVLNLIIAFLPAGIVGFLAGKAIKAHLFNSTT-VTTTFILGGLIILWVERRQRPPRVES
UPPP_PSEPK      FGLTNQPKARRFTGNLLLAFMPAVVLGVLFADLIHEYLFN-PXXXXXXXXXXXXIMLWAERREHRVEVDH
UPPP_FLAPJ      ----------DFYFKLLVAFIPAVVLGLLFSKKIDALL-ESPVTVAVSLLVGGIILLKVDDWFNNSSETE
UPPP2_ENTFA     FKNKSQSIIKKDTFSLWFKVAVACVMGILFDDYLDAHL-HTPVVIAIMLILYGVLFIVIENRNKKRTATT
UPPP2_BACLD     ITEEQKSGNRLSIAQIAVGLVPAAVLGFLFEDYIDQYLFSV-RTVAVGLIAGAVLMLAADWINRRKDTTD
UPPP_SALAR      FGRPLQREGESKGQLTLIHILLGMILGLVFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLPKEPRAPG
UPPP_PSEP1      FGLTHQPKARRFTGNLLLAFMPAVVLGVLFADLIHEYLFN-PXXXXXXXXXXXXIMLWAERRKHRVEVDH
UPPP_AQUAE      AFIPTGI------------------IGFLLYKLIKGFLIGNDXXXXXXXXXXXXXXXFADTYCEKFCYLD
UPPP_SALDC      FGRPLQREGESKGRLTLIHILLGMILGLVFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLPKEPRASG
UPPP_THEPX      LKLKPGSWGFNLWFKIFIAFIPAAVIGLLTHKYIEEHLFSPFTXXXXXXXXXXXXXXXEDTFGKRYKIDN
UPPP_GEOTN      GRHP-GGKPRLTLLHVIIGLLPAGVLGVLFEDYIDEHLFSTKTVL-IGLVLGALLMIVADRFAKKAARAQ
UPPP_CYTH3      AFIPTAI------------------VGLLLKKHIDTWL-ENVWVVASTLLVGGIVLLFVDKWFQKNETEG
UPPP_SALTY      FGRPLQREGESKGRLTLIHILLGMILGLVFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLPKEPRAPG
UPPP_SALTI      FGRPLQREGESKGRLTLIHILLGMILGLVFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLPKEPRAPG
UPPP_SALSV      FGRPLQREGESKGRLTLIHILLGMILGLVFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLPKEPRAPG
UPPP_SALNS      FGRPLQREGESKGRLTLIHILLGMILGLVFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLPKEPRAPG
UPPP_SALHS      FGRPLQREGESKGRLTLIHILLGMILGLVFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLPKEPRAPG
UPPP_SALA4      FGRPLQREGESKGRLTLIHILLGMILGLVFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLPKEPRAPG
UPPP_LACSS      KNQLEQKQTWTLWFKVILAVIPSVIIGFPLNDWMDEHLMQN-WVVASMLILYGILFIVIENRNKQPKFAD
UPPP2_BACCR     GIGKVTDGPSLNLLHIIIGMIPAGVLGVLFHSTIKEGLFG-PGPVVISLVAGGILMIVAEKFSKPSTART
UPPP_SALPK      FGRPLQREGESKGRLTLIHILLGMILGLVFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLPKEPRAPG
UPPP_SALPA      FGRPLQREGESKGRLTLIHILLGMILGLVFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLPKEPRAPG
UPPP_SALCH      FGRPLQREGESKGRLTLIHILLGMILGLVFHDTIKSLF--NPINVMYAXXXXXXXXIAAECLPKEPRAPG
UPPP_AZOVD      LGLPREPQAQRFTVNLLIAFLPAVVLGVAFADLIEHWLFN-PITVASALVVGGLVMLWAERRQIEVHAVD
UPPP_STRTD      PGKTAREVQLTWQLWLKVVIACIPSFGLLLDDWMEAHLSNF-FVVAIMLVVYGFIWIEDRNRRVEPKVTD
UPPP_GEOSW      GGRHRDGKPRLKLMQVIVGLIPAGVLGVLFEDYIDEHLFSTATVL-IGLVLGALLMIAADVFAKKPKAQT
UPPP_THEP3      LKLKPGSWGFNLWFKIFIAFIPAAVIGLLTHKYIEEHLFSPFTXXXXXXXXXXXXXXXEDTFGKRYKIDN
UPPP_DESDG      FRFGTGHGRFSGLRGWYLLALTSAPLGLLTHSFIKEHLFG-PVTVAWALAAGALYILAVEHKGEGTRYET
UPPP_DEIGD      RVIGHDRPTQRLWLGVIVGVIPAVVLGVLFGDVIKAHLFR-PSVVAWALIVGGVLMWVIENRKAPPVVHD
UPPP_SERP5      VEHEGKTTGHLKLGHILLAMIPAVVLGLLFHDVIKS-LFAPKNVMYXXXXXXXXXXXXEWLKPKKPSAEG
UPPP1_CLOD6     KNIKQKKETVRLWLKVIIAVIPSGVIGILFEDDIDRLFFNSTV-VAIALIVYGIIMIGLEKRNKRPKYKD
UPPP_STRT2      PGKTAREVQLTWKLWLKVVIACIPSFGLLLDDWMEAHLSNF-FVVAIMLVVYGFIWIEDRNRRVDPKVTD
UPPP_STRT1      PGKTAREVQLTWKLWLKVVIACIPSFGLLLDDWMEAHLSNF-FVVAIMLVVYGFIWIEDRNRRVDPKVTD
UPPP_PORGI      VA-PRALGQGKGKEFMSRFDLYWKLLIALVPAVILGFLFESVWVVAVVLFLGGIFMLFVDKLFASSDRGE
UPPP_PORG3      VA-PRALGQGKGKEFMSRFDLYWKLLIALVPAVILGFLFESVWVVAVVLFLGGIFMLFVDKLFASSDRGE
UPPP_DESHD      FDRGVSVKQETIEMWFKIIVSCIPAVIGLLWDDVFNALFYNYQTVAVMLIIFGILFIVIENYNKRPRVNH
UPPP_CAMJE      VGFPTGV------------------IGLFVAKYLNALF--NGWVVVGMLIFGGVVFILIELAHKNKQYNS
UPPP_LAWIP      PEKNKKFTGLYGIWLLFLTTLPPGIIGFLFHSYIKT-LFTIPSVIAA-LTTGSIFMLISEQLNISQRIVT
UPPP_DEIRA      -HIGHDRGQQRLWLGVVLACIPAVILGVLFGDTIKAYLFR-PSVVAWALIVGGVLMWLLESRKATPDTHD
UPPP1_CLOAB     LGFYLKKDVVSMWIKIIISCIPATIVGIPFDDKIDA-LFYNYQTVSITLISFGFIMIENHNKGKHPRITS
UPPP_RENSM      GKIPRNDPDARMGWLVVAGSIPIIVVGLFFQNAIE-VTFRNLWIVATTLIVFGVILAVADAVGKHERKLE
UPPP_FUSNN      VKTKKEVLKFRLWLKIIVGVLPAMVIGLLLDDIIDKYFLDNVLIVAITLIAYGVIFIGIEVVNIKPKVKR
UPPP_LEUCK      KTSREQFQTWRLWIKVIVGVLPAMVFGLLLNNFMDAHLL-NPWVVSATLIIYGFIVIENRQKNIAPVVTE
UPPP_EXIS2      GEHDASGTHKLKLRHVLIGLLPAAVLGLLFEDFIDENLFSIDTVXXXXXXXXXXXXXXDKLGPKEPKTTS
UPPP_STRSY      --NPFQPGKTKRDIQLTWQLWAKVVIACIPSILIAVPLFMVPIAIALIVYGIAFIWIENRNRGIEPQVTD
UPPP_STRS2      --NPFQPGKTKRDIQLTWQLWAKVVIACIPSILIAVPLFMVPIAIALIVYGIAFIWIENRNRGIEPQVTD
UPPP_CAMHC      IGLPTAA------------------IGYLLYSHIKSLFSQN--VVVYMLIIWGVIFIVVELLRKKPPENE
UPPP_CLOTH      DRIQIKKDTFSLWIKVLAATLPAALIGVPFDDKIDE-LFYNYITVAITLIVYGVLFIIMENRN-KSKIPA
UPPP_CAMJ8      --------GLDIWLKLAAGFFPTGVIGLFVAKYLNALF--NGWVVVGMLIFGGVVFILIELAHKNKQYNS
UPPP_META3      VCYEYREKFYNNLELWKKIIISFIPVGIMGLLFHKIVLF-TVQIVATAFIVGGIIFLIVEKYYKEKEHND
UPPP1_OENOB     GGKTEKQRFNIWATWXXXXXXXXXXXGFLLNDWMDKHLMNW-LVVSIALIVYGFIFIENYQKNRRPRVRT
UPPP_CAMJR      VGFPTGV------------------IGLFVAKYLNALF--NGWVVVGMLIFGGVVFILIELAHKNKQYNS
UPPP_CAMJJ      VGFPTGV------------------IGLFVAKYLNALF--NGWVVVGMLIFGGVVFILIELAHKNKQYNS
UPPP_STRGC      PKTPRQVQKTWQLWAKVVVASLPAVIIGIPLDNWFEKNFHNFVSVAIMLIIYGIAFILIERQEVEPTVTN
UPPP_SORC5      VRVRRDPDSLRXXXXXXXXXXXXXXXXXXXHKAIKAHLFG-PGPVAAALIVGGFLMIGVESLRRRPRVED
UPPP_THEFY      ATWFRSLGNKELRRHIDARMGWYVIIGSIPIG-VAGLLFEEQILTALTLIVFGVLLGMVDRY--SRKHRE
UPPP_SHEFN      KAWFTSLASKQQTQESKLAWWIILAVGFTAKDFIETH-FRNTLVIAITTIVFGLLLWAADRMS-KAQLTE
UPPP_CAMJD      --------GLDIWLKLSVGFFPTGVIGFFVAKYLNALF--NGWVVVGMLIFGGFILIEFAHKNKQYRINS
UPPP_SHESH      KAWTDSIITRKQTDESKLSWWIILAVGFTAKDFIETYLRNTAV-IATTTIVFGLLLWWADRM-FRPGFTE
UPPP_LACLA      KLNPADKQKTPREIQLTWRLWLKVXXXXXXNDWLDKHFYHF-VPVAFMLIIYGVAFIVIERRWVPNHEFS
UPPP_STRZT      PTKDKQEVRKTWRLWLKVLIATLPLLGVFKFDDWFDTHFHNMVSVALMLIIYGVAFIYLEKRAIEPSVTE
UPPP_STRZP      PTKDKQEVRKTWRLWLKVLIATLPLLGVFKFDDWFDTHFHNMVSVALMLIIYGVAFIYLEKRAIEPSVTE
UPPP_STRZJ      PTKDKQEVRKTWRLWLKVLIATLPLLGVFKFDDWFDTHFHNMVSVALMLIIYGVAFIYLEKRAIEPSVTE
UPPP_STRR6      PTKDKQEVRKTWRLWLKVLIATLPLLGVFKFDDWFDTHFHNMVSVALMLIIYGVAFIYLEKRAIEPSVTE
UPPP_STRPS      PTKDKQEVRKTWRLWLKVLIATLPLLGVFKFDDWFDTHFHNMVSVALMLIIYGVAFIYLEKRAIEPSVTE
UPPP_STRPN      PTKDKQEVRKTWRLWLKVLIATLPLLGVFKFDDWFDTHFHNMVSVALMLIIYGVAFIYLEKRAIEPSVTE
UPPP_STRPJ      PTKDKQEVRKTWRLWLKVLIATLPLLGVFKFDDWFDTHFHNMVSVALMLIIYGVAFIYLEKRAIEPSVTE
UPPP_STRPI      PTKDKQEVRKTWRLWLKVLIATLPLLGVFKFDDWFDTHFHNMVSVALMLIIYGVAFIYLEKRAIEPSVTE
UPPP_STRP7      PTKDKQEVRKTWRLWLKVLIATLPLLGVFKFDDWFDTHFHNMVSVALMLIIYGVAFIYLEKRAIEPSVTE
UPPP_STRP4      PTKDKQEVRKTWRLWLKVLIATLPLLGVFKFDDWFDTHFHNMVSVALMLIIYGVAFIYLEKRAIEPSVTE
UPPP_STRP2      PTKDKQEVRKTWRLWLKVLIATLPLLGVFKFDDWFDTHFHNMVSVALMLIIYGVAFIYLEKRAIEPSVTE
UPPP2_PSEHT     IAF-----------------IPLGIIAFIFSDVIKALFNXXXXXXXXXXXXXXXLLLERNYKEQNCTTTD
UPPP_STRPZ      TAREVQLTWQLWLKVVIACIPSILIAVPLDNWFEAHFYFMVPIAIALIVYGIAFIWIEKQNAQQEPAVTD
UPPP_STRPF      TAREVQLTWQLWLKVVIACIPSILIAVPLDNWFEAHFYFMVPIAIALIVYGIAFIWIEKQNAQQEPAVTD
UPPP_STRPD      TAREVQLTWQLWLKVVIACIPSILIAVPLDNWFEAHFYFMVPIAIALIVYGIAFIWIEKQNAQQEPAVTD
UPPP_BORPD      RGTLTGVPAETAFTRNLLLAFLPAAVGAI---FIKTIVFYHPXXXXXXXXXXXXIMLWVERKTHRASAHT
UPPP_NAUPA      -----NFKEINLWKKVLIAFMPLAVIGFLLRHQIKALF--TIQTVAWMXXXXXXXXXXXEKIEEKVKIRD
UPPP_STRPG      TAREVQLTWQLWLKVVIACIPSILIAVPLDNWFEAHFYFMVPIAIALIVYGIAFIWIEKRNAQQEPAVTE
UPPP_STRPM      TAREVQLTWQLWLKVVIACIPSILIAVPLDNWFEAHFYFMVPIAIALIVYGIAFIWIEKRNAQQEPAVTE
UPPP_STRP8      TAREVQLTWQLWLKVVIACIPSILIAVPLDNWFEAHFYFMVPIAIALIVYGIAFIWIEKRNAQQEPAVTE
UPPP_STRP6      TAREVQLTWQLWLKVVIACIPSILIAVPLDNWFEAHFYFMVPIAIALIVYGIAFIWIEKRNAQQEPAVTE
UPPP_STRP3      TAREVQLTWQLWLKVVIACIPSILIAVPLDNWFEAHFYFMVPIAIALIVYGIAFIWIEKRNAQQEPAVTE
UPPP_STRP1      TAREVQLTWQLWLKVVIACIPSILIAVPLDNWFEAHFYFMVPIAIALIVYGIAFIWIEKRNAQQEPAVTE
UPPP_ARTS2      KAVPTDDPDARMGWLVILGSLPIIVLGLIFQDQIESVL-RSLWIVATMLIVFGLILAVADAVGRQERELT
UPPP_STRPC      TAREVQLTWQLWLKVVIACIPSILIAVPLDNWFEAHFYFMVPIAIALIVYGIAFIWIEKQNAQQEPAVTD
UPPP_STRPB      TAREVQLTWQLWLKVVIACIPSILIAVPLDNWFEAHFYFMVPIAIALIVYGIAFIWIEKQNAQQEPAVTD
UPPP1_ENTFA     PKKEEKKDTWILWSKVLVACLPAAVIGLKFDDYLDAHFYNF-LTVSIMLIVYGFIIIEKRNKNVAPKCTN
UPPP_SHEWM      TSWLASIFKGQKSDDSKLAWWIILALGFALKDMIEVYL-RGPGVIAITTVLFGLLLWWADRM----SRCE
UPPP_STAAN      HIQRRSKPRRLNLLHVLVGMVPAGILGLLFDDFIEEHLFSVPTVM-IGLFVGAIYMIIADKYSVKPQTVD
UPPP_STAAM      HIQRRSKPRRLNLLHVLVGMVPAGILGLLFDDFIEEHLFSVPTVM-IGLFVGAIYMIIADKYSVKPQTVD
UPPP_STAAB      HIQRRSKPRRLNLLHVLVGMVPAGILGLLFDDFIEEHLFSVPTVM-IGLFVGAIYMIIADKYSVKPQTVD
UPPP_STAA9      HIQRRSKPRRLNLLHVLVGMVPAGILGLLFDDFIEEHLFSVPTVM-IGLFVGAIYMIIADKYSVKPQTVD
UPPP_STAA2      HIQRRSKPRRLNLLHVLVGMVPAGILGLLFDDFIEEHLFSVPTVM-IGLFVGAIYMIIADKYSVKPQTVD
UPPP_STAA1      HIQRRSKPRRLNLLHVLVGMVPAGILGLLFDDFIEEHLFSVPTVM-IGLFVGAIYMIIADKYSVKPQTVD
UPPP_GEOKA      XXXXXXXXXXLNLIHVIIGLLPAGVLGVLFEDYIDEHLFSTKTVL-IGLVLGALLMIAADKFAKKAARTQ
UPPP_DEIDV      -HLGHDRSQQTLWTGVLVATIPAVVLGLAFGDQIQAVLFK-PSVVAWALIVGGVLMWLIESRRVQPQVHA
UPPP_ANOFW      YLRKGEVRKGPRLTLMHIFXXXXXXXXXXXEDYIDEHLFSTKTVL-IGLVLGALLMIAADRFGKRTVAQT
UPPP_STAAW      HIQRRSKPRRLNLLHVLVGMVPAGILGLLFDDFIEEHLFSVPTVM-IGLFVGAIYMIIADKYSAKPQTVD
UPPP_STAAS      HIQRRSKPRRLNLLHVLVGMVPAGILGLLFDDFIEEHLFSVPTVM-IGLFVGAIYMIIADKYSAKPQTVD
UPPP_SHEHH      TAWTSSIVTGKQTQESKLSWWIILAVGFSAKGFIETH-FRSIEVIAATTIIFGLLLWWADKMQREGFNEF
UPPP_SHEDO      KAWVLSLVKGEQSNESKLAWWIILAFGFAAKDFIATHLRNTTVIASTTIIFG-LLLWWADRM----SRSE
UPPP_ARTCA      KAWAGSLAGKVSRQDPDARMGWLVILGSLPQDQIESVL-RSMWIVATMLIVFGLILAVADAVGKQERDLT
UPPP_ARTAT      QAWFGSLTGKVERNNPDARMGWLVILGSLPQDQIESVL-RSMWIVATMLIVFGMILAVADAVGRQERDLT
UPPP_STAAT      HIQRRSKPRRLNLLHVLVGMVPAGILGLLFDDFIEEHLFSVPTVM-IGLFVGAIYMIIADKYSAKVKNPQ
UPPP_STAAE      HIQRRSKPRRLNLLHVLVGMVPAGILGLLFDDFIEEHLFSVPTVM-IGLFVGAIYMIIADKYSAKVKNPQ
UPPP_STAA8      HIQRRSKPRRLNLLHVLVGMVPAGILGLLFDDFIEEHLFSVPTVM-IGLFVGAIYMIIADKYSAKVKNPQ
UPPP_STAA3      HIQRRSKPRRLNLLHVLVGMVPAGILGLLFDDFIEEHLFSVPTVM-IGLFVGAIYMIIADKYSAKVKNPQ
UPPP_STRA5      PGKSAREIRLTWQLWLKVVIACIPSILALPFDNWFEAHFNFMIPIAIALIFYGFVFIWVEKRNLKPQVTE
UPPP_STRA3      PGKSAREIRLTWQLWLKVVIACIPSILALPFDNWFEAHFNFMIPIAIALIFYGFVFIWVEKRNLKPQVTE
UPPP_BACSU      ITSDQEQGHKLSIAQIAVGLVPAAVLGFLFEDYIDEYLFSVKT-VAIGLIAGAILMLFADWVNKRKTATD
UPPP_BACA2      VTRDQQKGYRLTIAQIAVGLVPAAVLGFLFEDFIDRYLFSV-RTVAYGLIAGAVLMLIADWINKRKETID
UPPP_STRA1      PGKSAREIRLTWQLWLKVVIACIPSILALPFDNWFEAHFNFMIPIAIALIFYGFVFIWVEKRNLKPQVTE
UPPP2_STRAW     SAWFRSLVNKEMRHDHDAQMGWLVIVGSIPIGVLGVTLFRDLRITATMLIVMGVILGIADRLAARDKKLQ
UPPP_STAAU      HIQRRSKPRRLNLLHVLVGMVPAGILGLLFDDFIEEHLFSVPTVM-IGLFVGAIYMIIADKYSVKPQTVD
UPPP_STAAC      HIQRRSKPRRLNLLHVLVGMVPAGILGLLFDDFIEEHLFSVPTVM-IGLFVGAIYMIIADKYSAKVKNPQ
UPPP_SHESW      TAWIASIFKGKQSDDSKLAWWIILAFGFMAKDFIETHL-RSAEVIAVTTIVFGLLLWWADKM----SHQD
UPPP_SHEPC      TAWIASIFKGKQSDDSKLAWWIILAFGFMAKDFIETHL-RSAEVIAVTTIVFGLLLWWADKM----SHQD
UPPP_SHEPA      TAWTGSVVSRKQTDESKLAWWIILAIGFSAKDFIETH-FRSIEVIAATTIIFGLLLWWADKMQRQGLNEF
UPPP_THEYD      FR------ERKMLLFXXXXXXXXXXXXXXFHDLIESAL-RHPLIIVVTLILVGFLMLYAEKVGKKL----
UPPP_STAHJ      NEEFRSKPRRLNLLHVLVGMIPAGILGVLFDDFIEAHLFSVPTVM-IGLFLGAIYMIIADKYSKKPKSVD
UPPP_LEUMM      SKKTDHEKFQTWRLWIRVIVGVLPAIGFALNDFMDAHLMNFWVVSATLIIYGAFIVIENRQKSIVPVITN
UPPP_XANAC      TGLG-ERANRDYVLKVGVAFLVTAVVGLIVRK-AGWQLPETLQPVAWALLIGGVWMLVAEHFAGKLPERD
UPPP_SHEPW      IASGKQTQESKLSWWIILATIPAVIVGFTAKGFIETYLRNIEV-IAATTIIFGLLLWWADRMQRQGFNEF
UPPP2_STRCO     AAWTRSLTDKSMRHDPDARMGWLVIVGSIPIGVLGLTLFRDLRITATMLIVVGVIIGIADRMPQQRKELE
UPPP_STRSV      PGKSARQVQKTWQLWXXXXXXXXXXIGLFLDDWFEAHFYNLVSVSVMLIVYGAAFIYLERREHEEPAVTD
UPPP_SHEB9      NAWIASIFRGQQSEDSKLAWWIILAFGFLAKDFIATHL-RNAEVIAVTTVVFGLLLWWADKMSRR----D
UPPP_SHEB8      NAWIASIFRGQQSEDSKLAWWIILAFGFLAKDFIATHL-RNAEVIAVTTVVFGLLLWWADKMSRR----D
UPPP_SHEB5      NAWIASIFRGQQSEDSKLAWWIILAFGFLAKDFIATHL-RNAEVIAVTTVVFGLLLWWADKMSRR----D
UPPP_SHEB2      NAWIASIFRGQQSEDSKLAWWIILAFGFLAKDFIATHL-RNAEVIAVTTVVFGLLLWWADKMSRR----D
UPPP_THICR      AILAISLQHLRLWNNVLIAFLPIAIIGFIFQDTVKA--FFTIETVAWXXXXXXXXXXXMEKLYVDGKHRD
UPPP_SHESR      KAWIASMVKGQHSDDSKLAWWIILAFGFIAKDFIETHL-RSAGVIAVTTIVFGLLLWWADKMSRR----D
UPPP_SHESM      KAWIASMVKGQHSDDSKLAWWIILAFGFIAKDFIETHL-RSAGVIAVTTIVFGLLLWWADKMSRR----D
UPPP_BORPE      RGTLTGVRQEVNFTRNLLLAFLPAAIGAIFIKSIKQVFYH-PGVVAVTLVVGGFIMLWVERRXXRASAHT
UPPP_XANC5      TGLG-ERANRDYVLKVGVAFLVTAVVGLIVRK-AGWQLPETLQPVAWALLIGGVWMLVAEHFAGKLPERD
UPPP_SHESA      KAWIASMVKGQHSDDSKLAWWIILAFGFMAKDFIETHL-RSAGVIAVTTVVFGLLLWWADKMSRR----D
UPPP_BORPA      RGTLTGVRQEVNFTRNLLLAFLPAAIGAIFIKSIKQVFYH-PGVVAVTLVVGGFIMLWVERRXXRATAHT
UPPP_BORBR      RGTLTGVRQEVNFTRNLLLAFLPAAIGAIFIKSIKQVFYH-PGVVAVTLVVGGFIMLWVERRXXRATAHT
UPPP_XANOR      TGLG-ERDNRDYVLKVSVAFLVTAVVGLIVRK-AGWQLPETLQPVAWALLIGGVWMLVAEHVAGKLPERD
UPPP_XANOP      TGLG-ERDNRDYVLKVSVAFLVTAVVGLIVRK-AGWQLPETLQPVAWALLIGGVWMLVAEHVAGKLPERD
UPPP_XANOM      TGLG-ERDNRDYVLKVSVAFLVTAVVGLIVRK-AGWQLPETLQPVAWALLIGGVWMLVAEHVAGKLPERD
UPPP_PELPD      VSTSLDTPARRLPFLVIASAVPAALVGKLFETQIEELFRSRPXXXXXXXXXXXXXXXXADLFGRKRRF--
UPPP_LEPIN      VSQNSDSEGFHFLIQICIGAFPILIAGFIAKKFLDTIKARPDLLLSGAWIFGGVLILVAEYFHQRPEEKK
UPPP_LEPIC      VSQNSDSEGFHFLIQICIGAFPILIAGFIAKKFLDTIKARPDLLLSGAWIFGGVLILVAEYFHQRPEEKK
UPPP_CLOTE      DIFAPDRRGLRFWINIVVACIPAVIFGFSLDDYIDKYLFNPXXXXXXXXXXXXXXXXXENKYRRRSKTKN
UPPP_CHLTE      GAVISGLVKGKPLGTDEARTGWMIAVGTIPHE-IETVL--RSLYIVSASMIGLALVLVVAEKHTANRARD
UPPP1_SHEON     KAWIASIVKGQHSDDSKLAWWIILAFGFMAKDFIATHLRNTGV-IAVTTVVFGLLLWWADKMSRH----D
UPPP1_PSEHT     LSAQGSTDDSKLGWWIILGTIPAAILGLLLKDMIELYL-RSAWVIAVTTIIFGLLLWYADAKGKQIKTIY
UPPP_SHEAM      KAWLASIFRGQQSDDSKLAWWIILAVGFTAKDMVETHL-RGPGVIAITTVIFGLLLWFADRIAKD----E
UPPP_XANCP      TGL-----GERANRDYVLKIGVAFLVTAVVGLIVRKAGWQLPETIQPVLLIGGVWMLVAEHFAGKLPERD
UPPP_XANC8      TGL-----GERANRDYVLKIGVAFLVTAVVGLIVRKAGWQLPETIQPVLLIGGVWMLVAEHFAGKLPERD
UPPP_PSEA6      VAFGSGFSKNQTDDSRLAWWVIIATIPALIFGFAGKAFIESALVIACTTIGFGLLLWYADKKAALNKH--
UPPP_BAUCH      ----------------------------------------------------------------KPRATC
UPPP_MACCJ      HIEKTKTEGPRLNLLHIFIGLIPAGIGLLFDDFIDKHLFSVPTVXXXXXXXXXXXXXXXXFNKKVTHTTT
UPPP_RUBXD      GAFDLSEPDQRLAYLVLAATVPAALIGYLWEDFFETAV-RSPWVVVFNLAFVGLLFLVAEAVGRKSRRAE
UPPP_LARHH      IDLPTSTMARKFVLNLLIAFLPAAIVGVLLIKTIKSYLFN-PXXXXXXXXXXXXXILWAERRECTARVHR
UPPP_HALOH      FFKKEKRWLTILILVGIIPTGI---IGILFEDFFAN-LFSSVKTVGFMLLVTGFLLYLSEKLSNYNKELK
UPPP_ALKMQ      VDLLTNNQYRKLGLLIIVATIPTGIIGLFFKDLF-TSFYNSTLIIGISLLVTGTLLWTAEKVNTGKR--D
UPPP_XYLFT      TGLDK-----YSNRDYVMKLATAFLITAVVGLAVRKANWQLPETIQPXXXXXXXXXXXXXXAESVAKHLP
UPPP_ALCBS      VQQRRMNDDLKLGLLVALATIPAVVFGFLGDDFIEREL-RSALVIAITTLVFGALLWASDAFGKRE--FS
UPPP_VIBHB      QALFASIFKGDRSKEAKLAWMIVIAFGLLMKDIIEVYL-RSAYVIATTTIIFGLLLWWVDRNA--ELVAD
UPPP_TERTT      IGWLSSVTGRGTDESGRLGWYLIAAFGLIFDDLIETHLRSTDVIATTTLVFG-VLLWVADRKPAETK--Q
UPPP4_BACAH     IKNPFSKLMLLLIVGTIPAVV----IGLLFKDFFEDIS-KTGITIGWEFLVTGFFLYMADKQKNGRKKMD
UPPP2_BACSK     QAATQSEGRGLTXXXXXXXXXXXXXXXXXFEDKMESIFHVRT--VAFALIAGAFLMIAADRNNKKKQQVD
UPPP4_BACCZ     IKNPFSKLMLLLIVGTIPAVV----IGLLFKDFFEDIS-KTGITIGWEFLVTGFFLYMADKQKNGRKKMD
UPPP_ALKOO      LSKTKKRETMRIWYKVVVGIIPAGVMGLLFDDWLNEHLYNYWTVAAMLIVYGVLFIIIENRN--KHRYAK
UPPP3_BACCR     IKNPFSKLMLLLIVGTIPAVV----IGLLFKDFFEDIS-KTGITIGWEFLVSGFFLYMADKQKNGRKKMD
UPPP_VIBVY      AALFASIFKGERSKEAKLAWMIVIAFGLVMKDVIEVYL-RSAYVIATTTIIFGLLLWWVD------KNAS
UPPP_VIBVU      AALFASIFKGERSKEAKLAWMIVIAFGLVMKDVIEVYL-RSAYVIATTTIIFGLLLWWVD------KNAS
UPPP_STRMU      SGKTAREVQITWQLWAKVILSALPAIGLIFDDWLDAH-FQNFFSVALMLILYGIAFIYVERQGVEPQVTH
UPPP_STREM      PGKPQQIRLTWQLWLKVAIACIPSIIIAVPLDDWFDVHFNHMLPIAIALIVYGIAFLWIEKQTLEPRVVK
UPPP_STACT      KYQPAATETESADGKIGKRVKPKRLLGLLFDDVIEKYLFSVPTVM-IGLLLGAFYMIFAQKFSERYAHRE
UPPP_GEOSF      SDFPTSRRLPFYIIAGTFPAAI---VGKLFETTIEELFRKSPSXXXXXXXXXXXXXXXXDTSGSKKWKIE
UPPP_CHLPB      RGVPFETQESRMGWMIAAGTMPIVILGLLFKTEIETSLRSLYWISVALIVLALMLTLAEWLMKRRAKAKT
UPPP2_AGRT5     AAWLRQNLRLGEYNKADARLGWLIIVGSVPIVFLGLFFLRNLYITAVMLIVFGIVLGLADRIGEKRYKLN
UPPP1_BACSK     RGFPQNKAMFWFAIYLVVATGITGVAGILFEDYISET-FKAPIFIALALAVTGLFLIIIERFVRHGNRTE
UPPP_RHIL3      LG-----WRDPVNRDYAAKLIVAFLITAILGLVVKKLGFELPETIAWALIIGGIWMIAAARRPPHKEITW
UPPP3_BACC1     IKNPFSKLMLLLIVGTIPAVV----IGLLFKDFFEDIS-KTGITIGWEFLVTGFFLYMADKXKNGRKKMD
UPPP_RHILW      LGW-REPANRDYAAKLIVAFLITAVLGLVVKKVLHFELPETATPIAWALIIGGFMIFAEWAAARKAPHKE
UPPP_METI4      FLWKDREKLPYFLKLSVAFI-----ITSILGLWVKKMGWELPKDLGPVIIAGAFWIYFTEKVSSRQSFVE
UPPP_LACLS      KLNPADKQKTPREIQLTWRLWLKVXXXXXXNDWLDKHFYHF-VPVAFMLIIYGVAFIVIERRWVPNHEFS
UPPP4_BACHK     IKNPFSKLMLLLIVGTIPAVV----IGLLFKDFFEDIS-KTGITIGWEFLVTGFFLYVADKQKNGRKKMG
UPPP_STRE4      PGKPQQIRLTWQLWLKVAIACIPSIIIAVPLDDWFDAHFNHMLPIAIALIVYGIAFLWIEKQTLEPRVVK
UPPP_RHIEC      LG-----WREPENRDYAAKLIVAFLITAILGLVVKKLGFELPETIAWALIIGGIWMIAAARRPPHKQITW
UPPP_STRS7      PGKPQQIRLTWQLWLKVAIACIPSIIIAVPLDDWFEAHFNHMLPIAIALIVYGVAFLWIEKQTLEPRVVK
UPPP_PARD8      FRGLFKFQMNAETKYVINILISMIPIGIVGVFFKDTVIFGSGLLVCMLLLTAALLAFSYYAKPRQKESIS
UPPP_LACLM      KLNPADKQKTPREIQLTWRLWLKVXXXXXXNDWLDKHFYHF-VPVAFMLIIYGVAFIVIERRWVPNHEFS
UPPP_VIBSL      SAFFGSVFKGDRSKEAKLAWMIILAFGLLMKDIVELYL-RSAWVIATTTIIFGLLLWWVD------KNSS
UPPP_CLOCE      INFFPGKVGYEKSGFKFWFMIFIACIPGAAVKLLLDAPVETPVSVAIVLILGGLWMIYAEK---KFRNNN
UPPP_CHLL2      REVPLGTTEAKMGWMIAAGTIPIVIFGLLFKNEIETSLRSLYWISXXXXXXXXXXXXXEKRMKNQLRQGV
UPPP_PROM5      KILRPSFFSNKIYKSIFIGTIPIVLIGGIVKLFVTDXXXXXXXXIAVVSILMSLIMFLADIST--NKFIN
UPPP_DESOH      VSVPRSDRDAEGLKLALLIVVGSVPTAILGLGLVDHLFFSLPLVGAMLLVTGTLLWLTRDR---DTGGVG
UPPP_CLAM3      GGMPKGDPDVRMGWLVIIGTIPIGIAGYLFQDTIRST-FRSLWXXXXXXXXXXXXXXXXDRYSRSDRLEK
UPPP2_CLOD6     IEFKEGKIGFRFGMNVIIGCIPFAIIGVLFYDNIKS-LFNLQSXXXXXXXXXXXXXXXETLFRKKNHSTD
UPPP_CARHZ      -----KKPWGRLPLLIIAGTVPTALIGLGFKDFFER-LFVSGSTLGIEFIITGLILWLAERQKSGRKNLE
UPPP_RHIE6      LG-----WREPENRDYAAKLIVAFLITAILGLVVKKLGFELPETIAWALIIGGWMIFAEWAAARKAPHKE
UPPP_BLOPB      ----------------------------------------------------------------EPRVSR
UPPP_STRGG      SAWFRSLTDRSMRGDHDAQMGWLVIVGSIPIGVLGITLFRDLRLIATTLIVMGIVLGVADRLAARDKHRV
UPPP_STAAR      HIQRRSKPRRLNLLHVLVGMVPAGILGLLFDDFIEEHLFSVPTVM-IGLFVGAIYMIIADKYSAKVKNPQ
UPPP_PROM2      YYFLHERLLRSIFIGTIPIVLLGGSVKLFVPNFIDNVL-RSNLSIALVSIVMAFFMYLADSS--KRGSID
UPPP_PROMP      -NYKNTNSRKPSYSFLFNKLNKSIFIGTIPIVFIGVIILRSNLSIALVSILMSLIMLFADISTKKSINLN
UPPP_PROA2      GAVPLGTPDAKMGWMIAAGTIPIVVFGLLFKTEIETSLXXXXXXXXXXXXXXEWLIKKRIAKGIEPKSMS
UPPP_CLOPS      VELAESKTGFRFGINVIIGTIPAAILGLLFHDEIKEYLFSTKTVAXXXXXXXXXXXXXENNFRKRAKRSK
UPPP_CLOPE      VELAESETGFRFGINVIIGTIPAAILGLLFHDEIKEYLFSTKTVAXXXXXXXXXXXXXENNFRKRAKRSK
UPPP_CLOP1      VELAESETGFRFGINVIIGTIPAAILGLLFHDEIKEYLFSTKTVAXXXXXXXXXXXXXENNFRKRAKRSK
UPPP_VIBF1      TAWVGSIVKKEHNKESNLAWLIVLAFGLLFKDFIEIYL-RSAWVIAATTIVFGLLLWWVDKNATLAKDEY
UPPP_VIBFM      TAWVGSIVKKEHNKESNLAWLIVLAFGLLFKDFIEIYL-RSAWVIAATTIVFGLLLWWVDKNATLAKDEY
UPPP_VIBCM      SAFFASIFKGDRSKEAKLAWLIVLAFGFVMKDIVELYL-RSAWVIATTTIVFGLLLWYVDKHAELKADEY
UPPP_VIBCH      SAFFASIFKGDRSKEAKLAWLIVLAFGFVMKDIVELYL-RSAWVIATTTIVFGLLLWYVDKHAELKADEY
UPPP_VIBC3      SAFFASIFKGDRSKEAKLAWLIVLAFGFVMKDIVELYL-RSAWVIATTTIVFGLLLWYVDKHAELKADEY
UPPP_METVS      GVFKKDEKYITLSLKLFVSMIPAAIVGIFFEDFIKSIFSET-FFIGVFLAITGVFMLLSDKMDKNLK--T
UPPP_ALISL      SAWTFSIVKKEHNKESKLAWLIILSTGLMFKDFIEVYL-RSAWVIAITTIVFGLLLWWVDKNSTLVKDEY
UPPP_VIBPA      RALFASIFKGDRSKEAKLAWMIVIAFGLLMKDVIEVYL-RSAYVIATTTIVFGLLLWWVDKNA--KLVAD
UPPP_SACD2      AGWFGSITGKQSENGSLAWCIIVATVGLLLGNFIEEHL-RSVSVIATTTVVFGLLLWFADAKHSETKQLA
UPPP_LEPBP      VRFGLGKSTDRSGFQFYXXXXXXXXXXXXXXXXXKSQLDQIKMRSDLLLIVGGIIMVFVEKRHLDESSGK
UPPP_LEPBL      -------------------------VGFIAKKFLDTIKARPDLLLASAWIFGGVLILIAEWFFQKRQGTE
UPPP_LEPBJ      -------------------------VGFIAKKFLDTIKARPDLLLASAWIFGGVLILIAEWFFQKRQGTE
UPPP_LEPBA      VRFGLGKSTDRSGFQFYXXXXXXXXXXXXXXXXXKSQLDQIKMRSDLLLIVGGIIMVFVEKRHLDESSGK
UPPP_STAS1      -------------------------LGLLFDDVIQEYLFSVPTVM-IGLFIGAIYMIIADIYSKKPRNVD
UPPP_BACTN      FKGLFKFQMNDETRYVINIVISMIPIGIVGKDYVEAIFGSGLMIVCMLLLTAALLSFSYYYKPRQKDKIS
UPPP_SHELP      TAWTSSTQESKLAWWIILATIPAVIFGFTAKDFISTHL-RNIEVIATTTIVFGLLLWWADKLNREGFSEF
UPPP_PELTS      SALRRRGTHEARMFWYLVLATVPGAVGYLLEEQAETV-FRTPXXXXXXXXXXXXXXYWADAK--KPAVKG
UPPP_CLONN      PSKPKSGFKFWLNIAVSAVPAGV--LGLKFHSKINEKLFN-PGSVTAALIVGAIWMIFAEKR-YRGKFTD
UPPP_BUCBP      ICKQITKKNDLXXXXXXXXXXXXXXXXXCIYQYIKYL--SNFYSIIYALIFGTILLILTEISKTKISSNK
UPPP_BACFR      FRGLFKFEMNSETRYVINILISMLPIGIVGVFFKDEVIFGSGLLICMLLLTAALLSFSYYAKPRQKENIS
UPPP_BACFN      FRGLFKFEMNSETRYVINILISMIPIGIVGVFFKDEVIFGSGLLICMLLLTAALLSFSYYAKPRQKENIS
UPPP_STAES      QHKPESKPRRLNLIHVLVGMVPAGILGFLFDDLIEKYLFSVPTVL-IGLFIGAIYMIIAD------KYSK
UPPP_STAEQ      QHKPESKPRRLNLIHVLVGMVPAGILGFLFDDLIEKYLFSVPTVL-IGLFIGAIYMIIAD------KYSK
UPPP_COREF      TGWDRRGRDYKMGWMIIVATIPVVVLGVLGKDLIRDAL-RNMWITATVLVLFSFVFILAEKVGKKDRGYD
UPPP_CALS8      VKGITKSDQGKLLWFIIVATIPGAGFGYFFENIVENVFRKQYLLIAVVLAVFGFILYYVDK-TAKNKFT-
UPPP_RHOBA      L------KDRRVIGLLVIGTLPAVVIGLTIKTQFPEIL-RSPLLAGAMLIVTGVMLIVLGRLTPKSGTYD
UPPP_MICLC      VTIPHSDPDARMGWLIIVGSIPIAVLGLLLEDWIDTE-FRSLWITATMLIVFGVLLALADRLGRQTKPLE
UPPP_GEOMG      VVNALSGLTGGAHSSATRLPWYIIAVGKTLEEPIEAIFRANPXXXXXXXXXXXXXXXXXDTLGSKKSRMD
UPPP_GEMAT      SAWRIARTRRVETVHDRRVLYLIAAIGGLLLNDLAETTFRSPVVIATSLIVMGILLWAVDRWSARARVLE
UPPP_BORA1      ----------------------------------------------------------------------
UPPP_SYMTH      VEGLTKGMKTPTGRLAWGIVLGTVPFGLLMEDVVEAVFRQSXXXXXXXXXXXXXXXXXXDRFG--PKRRS
UPPP_PSYIN      RAWVGSLRGKGETQDSRLAWWILWSIGFFGKSLVETYL-RSGYVIAVTTTVFGLLLWWADANAKQVK---
UPPP_METMP      GITKKETEYINLASKLVLSTIPAVIVGLCFGDFIESV-FSSTLLIGVFLSITGILMLLSDNLNKNLKTIK
UPPP2_CORJK     SAVHRQSFDYRMGWMVIVGTLPVAVLGYLGKDLIRDNL-RNLWITATMLVLFSFVFILAERMGRRERSFD
UPPP_CHLPD      AAVIQGIMKGRPFDTHEAAMGWMIAVGTLPI-VICGLLFKTEIETSLRALIGFALLLLVAEWSVKKRLKQ
UPPP_ALTMD      VAWVTQGFSKQQSTDSKLAWYVIVGIGFLMKGWIEENA-RTALVIAGTTIIFGLLLWYADATAKREQ--E
UPPP_CORGL      TGWERRGFEYRMGWMIIVATIPVVILGVLGKDLIREAL-RNMWITASVLILFSLVFILAEKMGKKERDYD
UPPP_SYNWW      -----KKPFCRLTYLLIVGCIPAGLAGFLLAPYFEKA-FESLLVVGIALIFTGILLSLSENLSKKHKEAD
UPPP_MOOTA      LSQPRSQDGRLFWYLIVASIPGAI-FGVLFEKQAETI-FRSPXXXXXXXXXXXXXXXXXDRVGRKRRQLD
UPPP_KOCRD      KQWALSLTGRVDRKDPDARMGWFIILGSLLQDVIET-QFRSLWITATMLIVFGLFLAVADHVGKQERHLE
UPPP_DESAP      QARGVGTADGRLFWFLVVATIPGVVVGYFLEDIVETTL-RAPXXXXXXXXXXXXXXYLADRYGGQVKR--
UPPP_METM5      GISKKDNEYINLASKLVLSTIPAVIVGLCFGDFIESV-FSSTFLIGVFLSITGILMLLSDK--LNQNLKT
UPPP_CORGB      TGWERRGFEYRMGWMIIVATIPVVILGVLGKDLIREAL-RNMWITASVLILFSLVFILAEKMGKKERDYD
UPPP_MAGSM      RAWRQANAESHLVLQLALATIPVGLVGLACKDWVATVARD-PMIIATTSILFGLLLWWADRQGRCNNDGS
UPPP_CORST      TAWSKRNFDYRMGWMVIAGTIPVGLAGVLLKDLIREN-FRNLWITATVLILFSLVFILAERRGKKTRGFE
UPPP_CORDI      LTKKQRGFDYRMGWMVIVGTLPVSIVGLLAKDIIRDNL-RNMWITASVLIAFSFVFIAAEKWGSKRRSFD
UPPP_CHRSD      PATPESRLGWAVIVGTLPAVV----IGFLLENVIESYL-RASLVIAITTLLFGLLLWWADVRGSRRHALT
UPPP2_FRASC     AAWARSLTRREMRKDPDARTGWLVILGTLPIGLLGVTLFRDLRXXXXXXXXXXXXXXXXDHSPLRPRKV-
UPPP_PROVI      SAVPLESNEARMGWMIAAGTIPIVVFGLLFKDQIETTLRSLYWXXXXXXLSGGRPLKTMEQIGWKE----
UPPP_PHOPR      SAWITSIFKGKHTAESKLTWMIALAFGLFMKDFIELYL-RSXXXXXXXXXXXXXXXXXVDKHS-EHKFDE
UPPP_DESAA      VQVWTTDQDARMALLXXXXXXXXXXXXXXXHK-IADKLFASPVLAGAMLLITGALLWATRYVRTEGKLLP
UPPP_ANATD      IAKPKS-EKGKLFWFIIVATIPGALFGYLFENIVEEVFRKQYLLIAIVLAVFGFILYYVD--SIAKNKIE
UPPP1_CORJK     TAWSKRNFDYRMGWMVIAGTIPVGLAGVLLKDLIREN-FRNLWITATVLILFSLVFILAERRGKKTRGFE
UPPP_PROAC      VAWCKGLAHKEDRDDPDYTLGWGIILGSIPKDAIETTLSSLWVVAIALILWSGVMWLGDRQLGLNMKEIG
UPPP_DESAH      VSLGRADGDVRLAALIIVGSIPTAVIGLILKNYVHALFSSLVIVGSMLMVTGTFLWLTRHSTPGGKKVEQ
UPPP_PROM0      SQSSKKFLEYLFHERLLRSIFIGTIIKIFIPSFFENVLRSNLSIALVSFLMAFFMYLADSS---KRGSIN
UPPP_BACV8      LFKFEMNAETKYVINILVSMIPIGIVGVFFKDYVEEI-FGSGLLICMXXXXXXXXXFSYYAKPRLKENIS
UPPP1_BACCR     TRAEDAKSDFFFIIYLVIATIPAGVIGVLFKDYIDQYLKGVKMVGISLLIVGLWII-----RNLRGRKND
UPPP_METM7      GISKKDKEYINLASKLVLSTIPAVFVGLFFGDFIESV-FSSTYLIGIFLSITGILMLLSDK--LNKNLKT
UPPP_CAMC1      IAQRKMVGDSLLVWCVGFATIPVGIFGLLFNNVIEEYA-RSGVVIAVTTIIFGIALYFADL-----RSTN
UPPP_BIFLO      TRMGRGDNYATLGWNXXXXXXXXXXLGFTLQNVIETSLRNLWITVTVLLVFG-ILLWMVDAKARQNKTMN
UPPP_BIFLD      TRMGRGDNYATLGWNXXXXXXXXXXLGFTLQNVIETSLRNLWITVTVLLVFG-ILLWMVDAKARQNKTMN
UPPP3_BACAN     TRAEDAKSDFFFIIYLVIATIPAGVIGVLFKDYIDQYLKGVKMVGISLLIVGLWII-----RNLRGRRND
UPPP2_BACHK     TRAEDAKSDFFFIIYLVIATIPAGVIGVLFKDYIDQYLKGVKMVGISLLIVGLWII-----RNLRGRKND
UPPP2_BACCZ     TRAEDAKSDFFFIIYLVIATIPAGVIGVLFKDYIDQYLKGVKMVGISLLIVGLWII-----RNLRGRKND
UPPP2_BACAH     TRAEDAKSDFFFIIYLVIATIPAGVIGVLFKDYIDQYLKGVKMVGISLLIVGLWII-----RNLRGRKND
UPPP1_BACC1     TRAEDAKSDFFFIIYLVIATIPAGVIGVLFKDYIDQYLKGVKMVGISLLIVGLWII-----RNLRGRKND
UPPP_ACIBL      FAFPKGKSGNHTALTHPLTLTIIAFLCTAIPAFLFTKIIESVIIMGSALLIGGIVMWIVDVMFADKGATD
UPPP_METM6      GISKKDKEYINLASKLVLSTIPAVIVGLCFGDFIESV-FSSTFLIGVFLSITGILMLLSDKLNKNLKTIK
UPPP_HALHL      VVFAPSLLRFTRYSLRDAYGWARAGLGMLSVLFTGVVVFANPWMIAFTLILTGALLFWTDKLP--PRRRG
UPPP_FERNB      YGLVRSDKNMWNLALKIIISSIPAGIVGLFFESKVEAAFSSQKLIGVFFLVTAAALWLSDKYSGNKTLND
UPPP_DESPS      -------------------------IGLLFHKEIKT-LFTVPM-VGTMFIVGGIVFLVLEHFERSSHVQE
UPPP_TREDE      KSKPEDKDDLMMXXXXXXXXXXXXXXXLLLKDWVKTXXXXXXXXXXXXT---GLLLIASSKIKHNKQAKN
UPPP_SALRD      EEAWAGLRAPR----------------AVPTRFAENDTFRLGVFILVTLVPTG-VAYVLFREPLEPRFTS
UPPP_ELUMP      LTKPKTEEGKILWLLVLGTIPAAIC-GVLFEDWIETV-FRSPXXXXXXXXXXXXXXXXXDK---RAGQKD
UPPP_ACIC1      VADERRSPDALLGWYVIAGTIPIGLAGYLGRNVIKHDL-RSLWYVVAGLVLWSIAIVYAERTAAQRR--D
UPPP1_STRAW     SAWGRGLRNRDERHHHDYKFAWWVIYATIPIVIVGLALIEGPLVVAASLIVGSGVMWAADQMGRHKRGED
UPPP_PROM9      IQSSKKIFDYLIHERLLRSXXXXXXXXXXXXXXXKLFIFRSNLSIALVSFLMAILMYIADRS--KKGSIN
UPPP_BUCAP      LQLPMQKESNEKKNIHVLISILPTMLGLIFYNKIKSLF--NPTNVMYALILGGFFLIIAEKFPKKPKTNS
UPPP_HAHCH      IKQITASQESRLAWAVILGTIPACVAGLLLDSWIEENL-RSALVIALTTIGFGVLLGMADR---KEGTRD
UPPP_BUCAT      KFNINVKKTNTKNLHIILAILPTIFFGLLFYKKIK-LLFNTYNVMYALILGGIFLLISEIFKPKKYKTCS
UPPP_BUCAI      KFNINVKKTNTKNLHILLAILPTIFFGLLFYKKIK-LLFNTYNVMYALILGGIFLLISEIFKPKKYKTCS
UPPP_BUCA5      KFNINVKKTNTKNLHILLAILPTIFFGLLFYKKIK-LLFNTYNVMYALILGGIFLLISEIFKPKKYKTCS
UPPP_ANASP      IKGATRAIALKDYADYDLRLSLGIVLGTIPIVFIKTFIPDSPIAIAVASIVMSLLLGVGEKLGKRERDFE
UPPP3_FRASC     VRDPAEHPDYRFGWAVILGSIPIGLVGVAFKDQIETTL-RSLWFVGGALILWSGVMGYADHVGTQKRHEE
UPPP_PELPB      VAAVIEGIVQRKPLENSDAKMGWMIVAGTIPIVIFGKLFETQIXXXXXXXXEGKIKNRIKKLPLKA----
UPPP_METST      KGFILSIIDLTEGVDIFKRELHRVPMGILLKDAIETIFRGT-------LFVGIFLLVTAAVLYYSERHSS
UPPP_COLP3      VAWLGTVGVGPEKGRGGFDAKLSWWIGLLGKDFIEEHLRSALVIAMTTXXXXXXXXXADIKAGKRTEHKP
UPPP_SYNS9      TGIPDARLGVAMVIGTLPILVLGLGIKFFWHGYASSPLRSVPSIAIVSIVMALFLAMAEC---MGPRLKQ
UPPP_PROMS      AYLLHKRLLRSILIGTIPIVLLGGSIKLFVPYFFDNVLRSNLSIALVSFLMAFFMYLADSS---RRGSIN
UPPP_PROM3      LAFPKARLGLAIAIGTMPILLAGMAIKLFWPGYEASSIRSLPS-IAVVSIVMALLLALAERIGPRLKQMH
UPPP_SYNY3      KGIIKAVQTRQYDSLEFKXXXXXXXFGLLMKLLVQDLFFRSLSTIAIASIVMALLLALAEKLGTHRRPFE
UPPP_GRAFK      ----------------------------------------------------------------------
UPPP_GLUOX      GGMYRQMEAIRIFGLLVIATIPAVLVGWLLEHRLRAV-FGTPLAVAGFLILNGFLLMVTEWLRRQKGHRD
UPPP_BIFAA      GAMGAHNRDTQMGWFIIIGTLPILIAGLLFKDAIESTL-RNLWITVTVLIIFGILLWVVDARAKQVKTMD
UPPP_XYLFA      ----------------------------------------------------------------------
UPPP_MARMM      MGKRVTPGGRLALLVAASMPPIIIVAGALAFDLVDAL--RSPRVIAIATLAFALPLWLADRYGRQTITIE
UPPP_THISH      AEWLGSLAGRGLTPDAKLAWAVGLGTGLLFHDIIATHL-RSAQVIAMATIGFAVLLLFADVSGKRTRDEH
UPPP_GEOSL      ----------------------------------------------------------------------
UPPP_ERYLH      IVLGTAFGLAIKLGAFNSIAETWFNITVIDDDLMSSIRFTD--LIAFNLIVYGIALGLADWLGKEVKKFE
UPPP_THET2      -----------------------------------------------------------DRLAERAQYQD
UPPP_SULNB      IDL---------WMKLLFAFLPLAIVGFIFKDQVKALF--NVQVVAWMFIIGGIIFLIVEYYYKEQAWKD
UPPP_IDILO      IAARQHVGQSRLGWAVVVGTIPACIAGILLLDYIDTALRAVGVIITTTVVFA-VLLAAGDRFARGSRTLQ
UPPP_THET8      -------------------------IGFLFYPLIKGVILGNDXXXXXXXXXXXXXXXXXDRLAERAQYQD
UPPP_DICNV      YAPPAPEAKLGNQLIVATLPALL--IGFMVKDHIDA-LTHRPLLIASTTMIFAIFLAAADFWGRKKLSLP
UPPP2_PSEU5     LARRERVGDSRLAWAVILGTIPAGIAGLLFKGFIEEQM-RSPLVIAWATIGFGLLLWVVSRRTPQPRDEH
UPPP_SYNFM      LTFKDQSHVSKLGWYVILGSLPVATFGLVFKKVIEGSLTKSLIVISASLIVFGILLEVVARFSKSIKRIS
UPPP_MARAV      MGQRKIVGQGALAWYLVIGTIPAGLAGLALLDMIDNELRGASVIFFTTLVFG--ILLGIDWLPKRQRTMD
UPPP_BORBZ      FSLKTVKSDXXXXXXXXXXXXXXXXXXXXXXXXSKYESMFTLSFVLINFIITGILILMLEFNFLK-----
UPPP_BORBU      FSLKTVKSDXXXXXXXXXXXXXXXXXXXXXXXXSKYESMFTLSFVLINFIITGILILMLEFNFLK-----
UPPP_BIFLI      TRMGRGDEYATLGWNIIVGSIPIVILGFTLQDVIETSL-RNLWITXXXXXXXXXXXXXXDAKARQNKTMD
UPPP2_BACHD     VGFFSYFKDKSEENRIQFMFAIYIIVATXXXXXXXXAQMKTPPFIAGALIITGTFLIIIERFFVYKDRT-
UPPP_PELCD      YFRPEAHQYRRLLRLLIIATVPTAIIGLSFKDFFVGAFHNLP-LISLMLVVTGGLLFFSERLRKNGRSQG
UPPP_JANSC      IALLTGRIDTPGAKLAFLLIIATIPVIIFGLFLEVTGIYDSLRSIAVIMLIFGLVLYWADQRGGTEKQSD
UPPP_VESOH      IIKRQIIGQSKLAWGVLLGTIPIGLVGMIFKDFVAVDLRSIEIIAYTTLVFGLLLGFAFNHKNKNPKSTI
UPPP_SOLUE      IRREGDREXXXXXXXXXXXXIGTVPVGIAGLLFNKQAAWRNPFVMGFMLIVVGVLMWIAENAGRQQRXXX
UPPP_THEAB      KGLFTLKKEYYSLVLKIIISTIPAAIFGFLFNSTIENSFSNLKIISFFFLVTAASLFVSDKLKGKKDFFN
UPPP_PELUB      -------------------------------------------IIAWTTLIFGIILYLADKSKFDKKISS
UPPP1_BACLD     VKNEKGKADFRFIIYLIIATIPAGVIGVLFDDEISAFFKDGVRITAVTLLITGLALFLIRNLRGRKSDGE
UPPP_SULDN      ----------------------------------------------------------------------
UPPP_BIFA0      SRFGAHNKDARLGWYXXXXXXXXXXAGVLFQHAIETTL-RNLWITVAMLFIFGVILWIVDDRARQVKTLD
UPPP_CHLP8      GAV-------------------------------------------------------------------
UPPP_ACAM1      LSLTSSTARQQEGWRMALLVVLGSIPTAMIGLGLKPIFEELPLYVSFALIVTGLVLWFTPKSGLKRNAMS
UPPP_THEM4      GLIKLEKNYINLTLKIIVSTIPAAIFGVLLESKIEASLSNLKIISFFFLVTSAALLIS-DKIKGN-KDLS
UPPP_SYNR3      RGLARALREGDWGSPDARLGIAIA-VGTLAGLLIKLFWYETSPLIGIVSIVMALLLALAERLGQRRKQLP
UPPP_PROMA      MRGISKASFQNSWNNQNTKLASAIVLGTLPIVFAGMLIYETSPIIAVVSIVMALLLLIAENVGRRTRNFE
UPPP_ALHEH      VVFWPSLWRFSLNXXXXXXXXXXXXXGVLGLTLKATFVFASPLMIAXXXXXXXXXXXXXDR--LAPRRRG
UPPP_MYCVP      KAWFAGLFRAGQRSADYWLGWWVIIVGLLFKDEIRTGA-RNLWLVATAMIVFSFVIAAAEYYGRQARRVE
UPPP_GRABC      ----------------------------------------------------------------------
UPPP_GLUDA      FGSQRQAESIHILALLVVATIPAVIIGGLLEHWLRA-LFGTARYAAIXXXXXXXXXXXTERMPVQGGYA-
UPPP3_FRAAA     ----------------------------------------------------------------------
UPPP_SILPO      AGLPRALTGRLDTPGARLAMGLIVATGAALHFTGLSDALRSITVIGWTMLLFGLLLWWADRTGAQVK--E
UPPP_NOCSJ      ----------------------------------------------------------------------
UPPP_KINRD      GRLPRNDPDARMGWLVTLGTIPIGVLGLLFQDSIETVL-RGFVVIGTTLWLFALVLGAADRFGRKERTLD
UPPP2_CLOAB     -----------------------------------------------------WMIFAENKYRKRAKIKS
UPPP_SYNPX      QGIPEARLGIAMAVGTLPILAVGLAIKLFWDEGYETSPLRSVPSIAVVSIVMALLLAVAERMG--PRRKQ
UPPP_STRMK      ---------------------------------------ETVSPVAWALIIGGVWMLLVEAYTARLPDRD
UPPP_MYCTU      VVKAHRNTDYRLGWYVIIGTIPICILGLFFKDDIRSGVRNLWVVVTALVVFSGVIALA-EYVGRQSRHIE
UPPP_MYCTA      VVKAHRNTDYRLGWYVIIGTIPICILGLFFKDDIRSGVRNLWVVVTALVVFSGVIALA-EYVGRQSRHIE
UPPP_MYCS2      LRAPEHRDADYRLGWFVIVGTIPIGVGLLFKDEIRTGA-RNLWLVATALIVFSVVIAAAEYYGRQVRQVE
UPPP_MYCBT      VVKAHRNTDYRLGWYVIIGTIPICILGLFFKDDIRSGVRNLWVVVTALVVFSGVIALA-EYVGRQSRHIE
UPPP_MYCBP      VVKAHRNTDYRLGWYVIIGTIPICILGLFFKDDIRSGVRNLWVVVTALVVFSGVIALA-EYVGRQSRHIE
UPPP_MYCBO      VVKAHRNTDYRLGWYVIIGTIPICILGLFFKDDIRSGVRNLWVVVTALVVFSGVIALA-EYVGRQSRHIE
UPPP_TRIEI      FGAPDLKMLVSIGLGTIPIVFFGLLIKVFIPDFDNSRLRST-VXXXXXXXXXXXXXXXXERIGSRKRNFE
UPPP_SYNP6      RGLVSAVRRQDFRSEPAQMXXXXXXXXXXXXDYDNSPLRSLAAIAIVSIVMG--LLLGIAEQ-LSKHQRD
UPPP_SYNE7      RGLVSAVRRQDFRSEPAQMXXXXXXXXXXXXDYDNSPLRSLAAIAIVSIVMG--LLLGIAEQ-LSKHQRD
UPPP_PARUW      ----------------------------------------------------------------------
UPPP_MYCUA      VVKSHRNADYRLGWYVIIGTIPICVLGLLFKDEIRSGVRNLWVVATALVVFSGVIALA-EYLGRQSRHVE
UPPP_MYCGI      KAWFAGLFGSGERSPDYWLGWWVIIIGLLFKDEIRTGA-RNLWLVATAMIVFSFVIAAAEYAGRQTRRVE
UPPP_ANADF      ----------------------------------------------------------------------
UPPP_MYCMM      VVTSHRNADYRLGWYVIIGTIPICVMGLLFKDEIRSGVRNLWVVATALVVFSGVIALA-EYLGRQSRHVE
UPPP_STRM5      ---------------------------------------ETVSPVAWALIIGGIWMLLVEAYTARLPDRD
UPPP_MYCLE      HAWCRGLTVTLHRTADYWLGWYVIILGLVCKDEIRSGIRPLWVVATALVAFSGVIAFA-EYVGRQNRCIE
UPPP_MYCLB      HAWCRGLTVTLHRTADYWLGWYVIILGLVCKDEIRSGIRPLWVVATALVAFSGVIAFA-EYVGRQNRCIE
UPPP_CHLT3      SATPFGSQDSRMGWMISAGTIPIVVLGLLFKKNIETTFXXXXXXXXXXXMYAEYLVKKREARGEKMLSLD
UPPP_SYNJB      ILGSWKAWRERDFQQEPWRLSVGILVGTVAGWAIKAIWGSPPRQLWVIATIGLAVLLGWAEQTGK-RQRD
UPPP_METS3      -------------------------VGVLFESQVESLFAGALYVPAFFLFVTGTILYLSQRM--NSGEVD
UPPP_GEOLS      VQQPEAPRRLRLPWMIVLASIPAAIAGKTLEQPIEELFRSSPXXXXXXXXXXXXXXXXTDRYG--KKLHD
UPPP_SILST      IGLPRALIGRLDTKGARLAL-------GLIVATIPTVIFGTFLYFTTMLVFGVVLYIADQRGPIDKSASD
UPPP1_BACHD     KGSARGKGDFRISFYXXXXXXXXXXXXXXFKDWIETELKQLHV-IAFALLITGMALWLIRHLNGRKQDGD
UPPP_NITOC      RDWLQSLAAGQQQGESRLAWAXXXXXXXXXXXXIMLTALRSPLIIAWSTVGFGFLLAYADWAGKQQRNEH
UPPP_ACICJ      GLLGRGEPGEVDAQRGLLLRLVVATLPAVLIGFAKPILFASPEIAAAFLIANGAVLIIGERLRRRRAGNG
UPPP_SYNAS      --------------------------GKLFHEVIETYLFG-PLPVVYALVAGGVLMIGVDRNRLRISDVN
UPPP_SACEN      VTWFRGLVNAEVRRTQDYRLAWYVIVGSLPQDYIRGAL-RSLWITGAMLILFGILMGLAERFGAQRRGHD
UPPP_RUTMC      IIKRQTIGESKLAWGVLLGTIPVGLVGMIFRDSIATDLRSVEIIAYATLVFGGFASWFSHRNKNQKSTIS
UPPP_KOSOT      ----------------------------------------------LMLLVTAFFLILADRFNGNKKILD
UPPP_RHOSR      IAEHRGDLDYRMGWYVIIGTIPVGVLGFLFKDQIRTGA-RNLWLIATMLIVFALVIAAAEYYGRKVR--P
UPPP_PROMM      LAFPNARLGLAIAIGTMPILLAGMAIKLFWPGYEASSIRSLPSIAVVSIVMALLLALAES---FGPRLKQ
UPPP_MYCSS      TAWGRRDADYRLGWYVXXXXXXXXXXXXXXKDEIRTAA-RNLWAIAIALIVFSAVIAAAEYFGRQVRHVE
UPPP_MYCSK      TAWGRRDADYRLGWYVXXXXXXXXXXXXXXKDEIRTAA-RNLWAIAIALIVFSAVIAAAEYFGRQVRHVE
UPPP_MYCSJ      TAWGRRDADYRLGWYVXXXXXXXXXXXXXXKDEIRTAA-RNLWAIAIALIVFSAVIAAAEYFGRQVRHVE
UPPP_MYXXD      AAFFRGLARREPFGTLEARLAWFVLVGTLPVGIAKFIENEFRSLYXXXXXXXXXXXXXXXXEKRASHQRT
UPPP_KORCO      ELPKGSAFSSPERKLPLYILIGTVPVAVLGLALAKYVIFGSSKIVGVGLLITAALLYAGGERPLDLRRAL
UPPP_HYPNA      IAAPVTRKPLSAGGRLALCILVATPFGAVIYEFIPENIWTALRSVYAVAIVFGALLWWADARGGQSRSEG
UPPP2_BURTA     AGFFASLNGRKNDEGHLMWALIIGTIGLLLEKRIERV-FHDLRIVAVALIVNGILLWLGDRIQRARAHRP
UPPP_MYCPA      ----------------------------------------------------------------------
UPPP_MYCA1      ----------------------------------------------------------------------
UPPP1_STRCO     VSAERYHHDYRFAWWVIYATIPIVLVGLAAKPLIKGPLASL-WVVAGSLIVGSGVMWWADRTGRHKRGED
UPPP2_BURCM     L-ISGFFAQLGGRKNDDGHLMWALIIGTIPTGIVGLLLFHDLRIVAVALIINGVLLWVGDRIQRSRAHQA
UPPP_SYNS3      KGIPEARLGIAMLIGTLPILIAGLCIKLYWPGYATSSLRSVPA-IAVVSIVMALLLGFAELLGPRLKQLN
UPPP2_BURCH     -------------------------VGLLLEKRIERV-FHDLRIVAIALIVNGVLLWLGDRIQRSRAHQA
UPPP2_BURCA     -------------------------VGLLLEKRIERV-FHDLRIVAIALIVNGVLLWLGDRIQRSRAHQA
UPPP2_BURS3     QLGGRKNDDGHLMWALIIGTIPTGIVGLLLEKRIERV-FHDLRIVAIALIVNGVLLWLGDRIQRSRAHQA
UPPP1_BURPS     AGFFASLNGRKNDEGHLMWALIIGTIGLLLEKRIERV-FHDLRIVAAALIINGVLLWLGDRIQRARAHRP
UPPP1_BURP1     AGFFASLNGRKNDEGHLMWALIIGTIGLLLEKRIERV-FHDLRIVAAALIINGVLLWLGDRIQRARAHRP
UPPP1_BURP0     AGFFASLNGRKNDEGHLMWALIIGTIGLLLEKRIERV-FHDLRIVAAALIINGVLLWLGDRIQRARAHRP
UPPP_NOCFA      -------------------------LGFLFKDEIRTGA-RNLWLVSFMLIAFALVIAAAEHYGAKRRPIE
UPPP1_FRAAA     ----------------------------------------------------------------------
UPPP2_BURXL     VR--GFFASFGGRRNDDAHMMWALIIGTIPAGLVGLLLFHDLRIVAIALIVNGVLLWFGDRL----QRTR
UPPP_TROWT      ----------------------------------------------------------------------
UPPP_TROW8      ----------------------------------------------------------------------
UPPP_OCEIH      ----------------------------------------------------------------------
UPPP_SYNPW      LRGISGAVRRGQWREPEARLGIAMTIGTLPILFAGLAIYETSPLRSVPAIAGVSILMALERFGPRSKQLD
UPPP_GLOVI      ----------------------------------------------------------------------
UPPP2_CHRVO     ----------------------------------------------------------------------
UPPP_BORHD      VKFVLGKTTECDFAKXXXXXXXXXXXXXXXXXXXXXEMFKGLFTLNLVLI--NFIVTSILLFLLESRIV-
UPPP_WIGBR      --------------------------------------FYSPKYISYFLILGSIFFILSEFISLKKIKID
UPPP_CAMC5      SIVRRERVGDSTLVWAVCFATIPAGIFGLAFNSLIEEYTRSGIVIAVTTIIFGVVLLADKRVGTKSEY--
UPPP_ANAVT      ----------------------------------------------------------------------
UPPP_ROSDO      ASLRLARGKVDTQGAFLALCLIIATIPVMIAGLIIKLTGLDEMMRSVAVILGGLVLYWADRTGASTRTAS
UPPP_SYNJA      ----------------------------------------------------------------------
UPPP_DINSH      ----------------------------------------------------------------------
UPPP_BORAP      ----------------------------------------------------------------------
UPPP_METTH      ----------------------------------------------------------------------
UPPP2_FRAAA     ----------------------------------------------------------------------
UPPP_BORGA      ----------------------------------------------------------------------
UPPP2_RHILO     ----------------------------------------------------------------------
UPPP2_OENOB     ----------------------------------------------------------------------
UPPP_THERP      RA--------------------------------------------------------------------
UPPP_THEP1      ----------------------------------------------------------------------
UPPP_THEMA      ----------------------------------------------------------------------
UPPP_THESQ      ----------------------------------------------------------------------
UPPP_METKA      ----------------------------------------------VQMAIGGALIVTGLLLRISPELRD
UPPP_BORRA      ----------------------------------------------------------------------
UPPP_BORDL      ----------------------------------------------------------------------
UPPP_PROMT      ----------------------------------------------------------------------
UPPP_PROM1      ----------------------------------------------------------------------
UPPP_CHLCH      ----------------------------------------------------------------------
UPPP1_MAGSA     ----------------------------------------------------------------------
UPPP_METTP      ------------------------------------------------LLIGSLLIATGLMLRLRSSSTD
UPPP_THEEB      ----------------------------------------------------------------------
UPPP_ANADE      ----------------------------------------------------------------------
UPPP_ANASK      ----------------------------------------------------------------------
UPPP_ANAD2      ----------------------------------------------------------------------
UPPP_SYNSC      ----------------------------------------------------------------------
UPPP_METBU      LKQPHDPVISFLLISTALTGIVGLPLLLFVTDNVEISGGSATAVIGIMLIVTGILQRTVSRDESLSRVPG
UPPP_HALMA      ----------------------------------------------------------------------
UPPP2_ACIAD     ----------------------------------------------------------------------
UPPP_SULIY      ----------------------------------------------------------------------
UPPP_SULIN      ----------------------------------------------------------------------
UPPP1_FRASC     ----------------------------------------------------------------------
UPPP_SULSO      ----------------------------------------------------------------------
UPPP_SULIM      ----------------------------------------------------------------------
UPPP_SULIK      ----------------------------------------------------------------------
UPPP_PYRIL      IGFLGDAEGRKWLTYVIVTTAATGAVGIPLYMAAKRYLLLGAMVVLGVAVIFNAVLLQRARSVAGLKTFD
UPPP_PYRAE      ----------------------------------------------------------------------
UPPP_ACHLI      ----------------------------------------------------------------------
UPPP_PELLD      ----------------------------------------------------------------------
UPPP1_RHORT     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           IMDYPPSLAFKIGLFQCLAMIPGTSRSGATIVGALLMGTDKRSAAEFSFFLAMPTMLGAFVLDLYKNRDA
UPPP1_AGRT5     IMDYPPSLAFKIGLFQCLAMIPGTSRSGATIVGALLMGTDKRSAAEFSFFLAMPTMLGAFVLDLYKNRDA
UPPP_RHISN      VFDYPPSLALKIGLFQCLAMIPGTSRSGATIAGALLMGTDKRSAAEFSFFLAMPTMLGAFTLDLYKNRDA
UPPP_RHIME      VFDYPPSLALKIGLFQCLAMIPGTSRSGATIAGALLMGTDKRSAAEFSFFLAMPTMVGAFALDLYKNRDA
UPPP_SINMW      VFDYPPSLALKIGLFQCLAMIPGTSRSGATIAGALLMGTDKRSAAEFSFFLAMPTMVGAFALDLYKNREA
UPPP_BRUSU      VMDYPLPICLAIGFIQCLAMIPGVSRSGSTIVGSLLLGADKRSAAEFSFFLAMPTMAGAFAYDLFKSRNI
UPPP_BRUSI      VMDYPLPICLAIGFIQCLAMIPGVSRSGSTIVGSLLLGADKRSAAEFSFFLAMPTMAGAFAYDLFKSRNI
UPPP_BRUO2      VMDYPLPICLAIGFIQCLAMIPGVSRSGSTIVGSLLLGADKRSAAEFSFFLAMPTMAGAFAYDLFKSRNI
UPPP_BRUME      VMDYPLPICLAIGFIQCLAMIPGVSRSGSTIVGSLLLGADKRSAAEFSFFLAMPTMAGAFAYDLFKSRNI
UPPP_BRUMB      VMDYPLPICLAIGFIQCLAMIPGVSRSGSTIVGSLLLGADKRSAAEFSFFLAMPTMAGAFAYDLFKSRNI
UPPP_BRUC2      VMDYPLPICLAIGFIQCLAMIPGVSRSGSTIVGSLLLGADKRSAAEFSFFLAMPTMAGAFAYDLFKSRNI
UPPP_BRUAB      VMDYPLPICLAIGFIQCLAMIPGVSRSGSTIVGSLLLGADKRSAAEFSFFLAMPTMAGAFAYDLFKSRNI
UPPP_BRUA2      VMDYPLPICLAIGFIQCLAMIPGVSRSGSTIVGSLLLGADKRSAAEFSFFLAMPTMAGAFAYDLFKSRNI
UPPP_BRUA1      VMDYPLPICLAIGFIQCLAMIPGVSRSGSTIVGSLLLGADKRSAAEFSFFLAMPTMAGAFAYDLFKSRNI
UPPP_OCHA4      VMDYPLPMCLAIGFIQCLAMIPGVSRSGSTIVGSLLLGADKRSAAEFSFFLAMPTMAGAFAYDLYKSRNI
UPPP1_RHILO     VERFPTRLYLQIGLFQCLSLIPGTSRSGSTIVGALLLGVDKRAAAEFSFFLAIPTMVGAFAFDLFKNRNV
UPPP_MESSB      ITQFPLSVYLKIGLFQCLSMIPGTSRSGSTIVGALLLGVDKRAAAEFSFFLAMPTMAGAFAYDLYKNYHL
UPPP_PHEZH      AGAFPLKTAFIIGLFQCLALIPGVSRSGATVAGALLMRCDKRSAAEFSFFLAMPTMAGAFTVDLAKNYKL
UPPP_CAUCR      VAEYPLKTAFIIGLFQCLALVPGVSRSGATIAGALLLKCDKRSAAEFSFFLAMPTMAGAFAYDLYKNIDK
UPPP_CAUCN      VAEYPLKTAFIIGLFQCLALVPGVSRSGATIAGALLLKCDKRSAAEFSFFLAMPTMAGAFAYDLYKNIDK
UPPP_PARDP      AEDFPLPMALKIGFIQCLAMIPGVSRSGATIVGALLLGADKRSAAEFSFFLSMPTMLGAFVYDLYKNRDI
UPPP_RHOP2      ATTFPVLMYFYIGCAQCVAMIPGVSRSGASIVAAMLFGADKRAAAEFSFFLAIPTMVGAFVYDLYKSRAD
UPPP_BRASO      ATRYPLMMYLWIGVAQCLAMIPGVSRSGSTIVAAMLLGGDKRSAAEFSFFLAIPTMVGAFVYDFYKSRAE
UPPP_RHOPT      ATAFPLLTYFYIGCAQCTAMIPGVSRSGASIVAAMLLGTDKRSAAEFSFFLAIPTMLGAFVYDLYKNHAD
UPPP_RHOPS      ATAFPLPMYFYIGCAQCLAMIPGVSRSGASIVAAMLFGADKRSAAEFSFFLAIPTMVGAFVYDFYKNRGE
UPPP_RHOPA      ATAFPLLTYFYIGCAQCTAMIPGVSRSGASIVAAMLLGTDKRSAAEFSFFLAIPTMLGAFVYDLYKNHAD
UPPP_BRASB      ATRYPLLMYLWIGVAQCLAMIPGVSRSGATIVAAMLLGGDKRSAAEFSFFLAIPTMVGAFVYDFYKSRAE
UPPP_RHOP5      ATEFPLPMYLIIGFAQCIAMFPGVSRSGATIVGAMLLGADRRAAAEFSFFLAIPTMLGAFVYDLYKSRAD
UPPP_BRAJA      ATRFPLLMYLYIGIAQCVAMIPGVSRSGASIVAAMLLGADKRAAAEFSFFLAIPTMIGAFAYDFYKNRSE
UPPP_RHOPB      ATAFPLPMYLYIGCAQCLAMIPGVSRSGATIVGAMLLGADKRAAAEFSFFLAIPTMVGAFVYDLYKNRAD
UPPP_NITWN      ATAFPLPMYVWIGIAQCVAMIPGVSRSGATIVSAMLLGADKRAAAEFSFFLAIPTMTGAFAYDFYKNHAD
UPPP_NITHX      ATAFPLPMYIWIGIAQCLAMIPGVSRSGATIVSAMLLGADKRAAAEFSFFLAIPTMIGAFAYDFYKNRAD
UPPP_RHOS4      AMDLPLNVALKIGFIQCLAMVPGVSRSGATIVGGLMLGAGKRAAAEFSFFLSMPTMAGAFAFDLFKNRDV
UPPP_RHOS1      AMDLPLNVALKIGFIQCLAMVPGVSRSGATIVGGLMLGAGKRAAAEFSFFLSMPTMAGAFAFDLFKNRDV
UPPP_OLICO      AMAFPLPMYLGIGIAQCAAMVPGVSRSGASIVAAMLFGADKRAAAEFSFFLAIPTMLGAFVYDVYKSRGD
UPPP_PARL1      VEAFSMRTALKIGLFQCIALVPGVSRSGATILGALLVGVERKTAAEFSFFLAIPVMLGASVVSLRDTWQL
UPPP_ACIAC      VDDMTPLDALKVGLVQCLAMVPGTSRSGATIIGGMLLGLSRKAATDFSFFLAIPTLIGAGVYSLYKERHL
UPPP_RHOFD      VESMTPMDALKVGLAQCLAMIPGTSRSGATIIGGMLLGLSRKAATDFSFYLAIPTLIGAGVYSLFKERAL
UPPP_POLSJ      VEAMTVMDALKVGLVQCLAMIPGTSRSGATIIGGMLLGLSRKAATDFSFYLAIPTLIGAGVYSLYKERAL
UPPP_NITMU      VEDMDWKHALKVGLAQCLALIPGTSRSGATIIGGLFFGLSRKAATEFSFFLAIPVMFAATFYDLYKNRDI
UPPP_ZYMMO      VQSIPAHKAVLVGLAQCLAMIPGVSRSGATIMGALCLGIDRKTATEYSFFLAIPVMLAATVKELWEQRHN
UPPP_RHOS5      VTEVPLGVALKIGFFQCLAMVPGVSRSGATIVGALLLGTGKRAAAEFSFFLSMPTMAGAFAFDLYKNRDV
UPPP_DIAST      VDDMTPLDALKVGLVQCLAMVPGTSRSGATIIGGMLLGLSRKAATDYSFFLAIPTLIGAGVYSLYKERAL
UPPP_ACISJ      VDDMTPLDALKVGLVQCLAMVPGTSRSGATIIGGMLLGLSRKAATDYSFFLAIPTLIGAGVYSLYKERAL
UPPP3_ACIAD     ATKITFKQAIAVGFIQCLAMIPGTSRSGATIIGGMLSGLSRKAATEFSFFLAMPTMLGAATYDLLRNADV
UPPP_PSEMY      VDDMTWKLALKVGFAQCLALIPGTSRSGATIIGGLVFGLSRKAATEFSFFLAMPTMIAATVYSLFKYRDI
UPPP2_RHORT     EMTWVDAL--KIGLAQCFALIPGTSRSGATIIGGLFFGLSRKAATEFSFFLAIPTLTAASLYDLYKNRAL
UPPP_ERWT9      VDDITYRQAFMIGCFQCLALWPGFSRSGATISGGMLVGVSRYAASEFSFLLAVPMMIGATGLDLYKSMGF
UPPP1_CHRVO     VDDLSLKDALKVGLCQCLALIPGTSRSGATIIGGLFLGLSRKAATEFSFFLGIPTLGAASLYSLIKHRDA
UPPP_NEIMB      VDALRPIDALMIGVAQVFALVPGTSRSGSTIMGGMLWGIERKTATEFSFFLAVPMMVAATAYDVLKHYRF
UPPP_NEIG1      VDALRPIDALMIGVAQVFALVPGTSRSGSTVMGGMLWGIERKTATEFSFFLAVPMMVAATAYDVLKHYRF
UPPP_AERS4      LDDISYKQAFGIGLFQCLALWPGFSRSGATISGGMLMGISRQAAAEFSFILAVPMMVAASGLDLYKSRDL
UPPP_AERHH      LDDISYKQALGIGLFQCLALWPGFSRSGATISGGMLMGISRQAAAEFSFILAVPMMVAASGLDLYKSRDL
UPPP_VEREI      AMTAPDAL--KVGLVQCLAMVPGTSRSGATIIGGMLLGLSRQAATDFSFFLAIPTLIGAGVYSLYQERAL
UPPP_NEIG2      VDALRPIDALMIGVAQVFALVPGTSRSGSTVMGGMFWGIERKTATEFSFFLAVPMMVAATAYDVLKHYRF
UPPP_THIDA      VDDLGWRRALAVGFAQALAMVPGTSRSGATIIGGLFLGLSRKAAAEFSFLLAIPTMFAATAYDLYKNWQL
UPPP_PSEA7      DMTWKDAL--KIGCAQCLAMVPGTSRSGATIIGGLLFGLSRKAATEFSFFLAMPTMVGAAVYSGYKYREL
UPPP_SPHWW      VEGMSLRTSFGVGLVQCLSMIPGVSRSGATIMGALTLGVERRTAAEYSFFLAIPTMLGATTLALWKARHE
UPPP_NEIMF      VDALRPIDALMIGVAQVFALVPGTSRSGSTIMGGMLWGIERKTATEFSFFLAVPMMVAATAYDVLKHYRF
UPPP_NEIMA      VDALRPIDALMIGVAQVFALVPGTSRSGSTIMGGMLWGIERKTATEFSFFLAVPMMVAATAYDVLKHYRF
UPPP_NEIM0      VDALRPIDALMIGVAQVFALIPGTSRSGSTIMGGMLWGIERKTATEFSFFLAVPMMVAATAYDVLKHYRF
UPPP_METFK      LNEITPWQALKVGCAQSLAIMPGVSRSGATILGGMIFGLNRKTATEFSFFLAIPVMLAATFYDVYKNFSL
UPPP_RALEJ      VDDLNWRDALKVGLAQCFALVPGTSRSGATIIGGMLFGLSRQVATEFSFFLAIPVIFGATVYELYKARAL
UPPP_KLEP7      IDDMTYRQAFVIGCFQCLALWPGFSRSGATISGGMLMGVSRYAASEFSFLLAVPMMMGATVLDVYKSIGF
UPPP_KLEP3      IDDMTYRQAFVIGCFQCLALWPGFSRSGATISGGMLMGVSRYAASEFSFLLAVPMMMGATVLDVYKSIGF
UPPP_CAUSK      GMALSLKTAALIGLFQCLSLLPGVSRSGSTIVGSMLIGVDRKAAAEFSFFMAIPIMVGAFALDLLKSYKD
UPPP_AZOSE      VDEMRWADALKVGFAQAAAMIPGTSRSGATILGGLVFGLSRKAAAEFSFFLSIPTMFAATVYDLYKNRDL
UPPP_PSYA2      AEDVGLKTALMIGLFQCLALIPGTSRSGATIVGALWLGVSRKASAEFSFFLGIPVIVGAALLDLLKHKDV
UPPP_RALME      VDDLNWRDALKVGLAQCFALVPGTSRSGATIIGGMLFGLSRQVATEFSFFLAIPVIFGATVYELYKARAL
UPPP_ENT38      LDDMTYRQAFMIGCFQCLALWPGFSRSGATISGGMLMGVSRYAASEFSFLLAVPMMMGATALDLYKSYHF
UPPP1_BACHK     LDDLTYRQALTIGLFQCLAVYPGFSRAGSTISGGLLAKVNYKTASEFSFLIALPVMVGATGLDLLKSWTY
UPPP_VARPS      VDDMTMWDALKVGLVQCFAMIPXXXXXXXXXXXXMLLGLSRQAATDFSFFLAIPTLIGAGAYSLYKERAL
UPPP1_BACAN     LDDLTYRQALTIGLFQCLAVYPGFSRAGSTISGGLLAKVNYKTASEFSFLIALPVMVGATGLDLLKSWTY
UPPP_NOVAD      IGQLPLRQAIGVGLAQCLAMVPGVSRSGATIMGALAMGIERRTAAEFSFFLAIPTMLGATTLELLDNRDA
UPPP_PSYCK      AEDVSLKTALMIGLLQCLALIPGTSRSGATIIGALWLGVSRKASAEFSFFLGIPVIIGAALLDFIKHRDV
UPPP1_BACAH     LDDLTYRQALTIGLFQCLAVYPGFSRAGSTISGGLLAKVNYKTASEFSFLIALPVMVGATGLDLLKSWTY
UPPP1_BACCZ     LDDLTYRQALTIGFFQCLAVYPGFSRAGSTISGGLLAKVNYKTASEFSFLIALPVMVGATSLDLLKSWKY
UPPP_POLNA      VESMSTMDALKVGLVQCLAMIPXXXXXXXXXXXXMLLGLSRKAATDFSFYLAIPTLIGAGAYSLFKDRAL
UPPP_RALEH      VDDLNWRDALKVGLAQCFALVPGTSRSGATIIGGMLFGLSRQVATEFSFFLAIPVIFGATVYELYKARAL
UPPP_WOLSU      SIGYKEALA--IGFFQALAMIPGTSRSGSTIVGGLILGLNRKVAAEFSFLLALPTMFIATGYDLYKNSHT
UPPP_POLNS      VDDLRPLDALKVGLAQCAALIPGTSRSGATIIGGMLFGLPRAVATEFSFFLAIPVIGGATLLKLWKAPVA
UPPP_ERWCT      LDDITHRQAFMIGCFQCLALWPGFSRSGATISGGMLMGVSRYAASEFSFILAVPMMMGATVLDLYKSWHF
UPPP2_MAGSA     IEDMSPALALGVGFCQVLAMVPGVSRAGATIMGSMLLGLDRRAAAEFSFFLAIPTMCGASAYSLYKNWAT
UPPP_DESMR      LDEMTPGLALGIGCFQCLSLWPGFSRSAATIMGGMLLGAKRSLAAEYSFIGAVPLMFAATLYDFYKSAHL
UPPP_HERAR      RVQSVDEMAFKVGCAQAFALIPGTSRSGASIIGGMMFGLSRKAATEFSFFLAIPTLMGATVYSVYKDRAL
UPPP1_PSEU5     VDDMTWTLALKVGFAQCLALVPXXXXXXXXXXXXLLFGLSRKAATEFSFFLAMPTMVGAAVYSGYKYRDL
UPPP_THETN      NMDVSTSKAFWIGVAQVMSLFPGMSRSASTIMGGMLVGLSVRAAAEFSFFLAIPTMLAATGFELVKNITS
UPPP_NITEC      VDDMNWKHALKIGCAQCLALIPGTSRSGATIIGGLLSGLSRKAAAEFSFFLAIPIMFAATFYDVYKHREF
UPPP_PECCP      LDDITHRQAFMIGCFQCLALWPGFSRSGATISGGMLVGVSRYAASEFSFILAVPMMMGATVLDLYKSWHF
UPPP_NITEU      VDDMSWKQALQVGCAQCLALIPGTSRSGATIIGGLLFGLSRKAAAEFSFFLAIPVMFAATFYDVYKHREF
UPPP_PSEA8      DMTWKDAL--KIGCAQCLAMVPGTSRSGATIIGGLLFGLSRKAATEFSFFLAMPTMVGAAVYSGYKYRDL
UPPP_PSEAB      DMTWKDAL--KIGCAQCLAMVPGTSRSGATIIGGLLFGLSRKAATEFSFFLAMPTMVGAAVYSGYKYRDL
UPPP_JANMA      RVETVDDMALKVGCAQAFALIPGTSRSGASIIGGMFFGLSRKAATEFSFFLAIPTLMGATVYSVYKDRAL
UPPP_PSEAE      DMTWKDAL--KIGCAQCLAMIPGTSRSGATIIGGLLFGLSRKAATEFSFFLAMPTMVGAAVYSGYVYRDL
UPPP_FLAJ1      TSQKITYLALKIGLFQCIAMIPGVSRSGASIVGGMSQKLSRTTAAEFSFFLAVPTMLGATVYDYYKAGFE
UPPP_YERE8      LDDITYRQAFAIGCFQCLALWPGFSRSGATISGGMLVGVNRYAASEFSFILAVPMMLGASGLDLYKSLHF
UPPP_DESAD      LDEVTPKLALGIGCFQCLALWPGFSRSAATIMGGMLLGAKRKIAAEYSFIAAVPIMFAATGYDMLKSYKL
UPPP1_BURCH     VDALTPLDALKVGIAQCFALVPGMSRSGSTIIGGMLFGLDRRVATEFSFFLAIPIIFGATLYETVKDWQA
UPPP1_BURCA     VDALTPLDALKVGIAQCFALVPGMSRSGSTIIGGMLFGLDRRVATEFSFFLAIPIIFGATLYETVKDWQA
UPPP_PSEU2      VDDMSWSDALKIGLVQCLAMIPXXXXXXXXXXXXLLFGLSRKAATEFSFFLAMPTMVGAAVYSGYKYRDM
UPPP_YERPY      LDDITYRQAFAIGCFQCLALWPGFSRSGATISGGMLVGVNRYAASEFSFILAVPMMIGASGLDLYKSLHF
UPPP_YERPS      LDDITYRQAFAIGCFQCLALWPGFSRSGATISGGMLVGVNRYAASEFSFILAVPMMIGASGLDLYKSLHF
UPPP_YERPP      LDDITYRQAFAIGCFQCLALWPGFSRSGATISGGMLVGVNRYAASEFSFILAVPMMIGASGLDLYKSLHF
UPPP_YERPN      LDDITYRQAFAIGCFQCLALWPGFSRSGATISGGMLVGVNRYAASEFSFILAVPMMIGASGLDLYKSLHF
UPPP_YERPG      LDDITYRQAFAIGCFQCLALWPGFSRSGATISGGMLVGVNRYAASEFSFILAVPMMIGASGLDLYKSLHF
UPPP_YERPE      LDDITYRQAFAIGCFQCLALWPGFSRSGATISGGMLVGVNRYAASEFSFILAVPMMIGASGLDLYKSLHF
UPPP_YERPB      LDDITYRQAFAIGCFQCLALWPGFSRSGATISGGMLVGVNRYAASEFSFILAVPMMIGASGLDLYKSLHF
UPPP_YERPA      LDDITYRQAFAIGCFQCLALWPGFSRSGATISGGMLVGVNRYAASEFSFILAVPMMIGASGLDLYKSLHF
UPPP_YERP3      LDDITYRQAFAIGCFQCLALWPGFSRSGATISGGMLVGVNRYAASEFSFILAVPMMIGASGLDLYKSLHF
UPPP_SHISS      LDDMTYRQAFMIGCFQCLALWPGFSRSGATISGGMLMGVSRYAASEFSFLLAVPMMMGATALDLYKSWGF
UPPP_PSEF5      VDDITWKDALKVGCAQCLAMIPXXXXXXXXXXXXLLFGLSRKTATEFSFFLAMPTMVGAAVYSGYKYRHL
UPPP_AZOSB      VDEMRWGDALKVGFAQALAMIPGTSRSGATIMGGLIFGLSRKTAAEFSFFLAIPTMLAATVYDVYKNWTL
UPPP2_BACC1     LDEITYKQAFTIGMFQCLALWPGFSRSGSTISGGLLARVSHTAAAEYTFILAVPMMVAASGLDLIKSWDI
UPPP_METPP      IDDMSALDALKVGLVQCAALIPGTSRSGATIIGAMLFGFSRKAATEFSFFLGIPTLMGAGAYSLIKQRDL
UPPP_SHIFL      LDDMTYRQAFMIGCFQCLALWPGFSRSGATISGGMLMGVSRYAASEFSFLLAVPMMMGATALDLYKSWGF
UPPP_SHIF8      LDDMTYRQAFMIGCFQCLALWPGFSRSGATISGGMLMGVSRYAASEFSFLLAVPMMMGATALDLYKSWGF
UPPP_SHIBS      LDDMTYRQAFMIGCFQCLALWPGFSRSGATISGGMLMGVSRYAASEFSFLLAVPMMMGATALDLYKSWGF
UPPP_SHIB3      LDDMTYRQAFMIGCFQCLALWPGFSRSGATISGGMLMGVSRYAASEFSFLLAVPMMMGATALDLYKSWGF
UPPP_ECOUT      LDDMTYRQAFMIGCFQCLALWPGFSRSGATISGGMLMGVSRYAASEFSFLLAVPMMMGATALDLYKSWGF
UPPP_ECOSE      LDDMTYRQAFMIGCFQCLALWPGFSRSGATISGGMLMGVSRYAASEFSFLLAVPMMMGATALDLYKSWGF
UPPP_ECOLU      LDDMTYRQAFMIGCFQCLALWPGFSRSGATISGGMLMGVSRYAASEFSFLLAVPMMMGATALDLYKSWGF
UPPP_ECOLI      LDDMTYRQAFMIGCFQCLALWPGFSRSGATISGGMLMGVSRYAASEFSFLLAVPMMMGATALDLYKSWGF
UPPP_ECOLC      LDDMTYRQAFMIGCFQCLALWPGFSRSGATISGGMLMGVSRYAASEFSFLLAVPMMMGATALDLYKSWGF
UPPP_ECOL6      LDDMTYRQAFMIGCFQCLALWPGFSRSGATISGGMLMGVSRYAASEFSFLLAVPMMMGATALDLYKSWGF
UPPP_ECOL5      LDDMTYRQAFMIGCFQCLALWPGFSRSGATISGGMLMGVSRYAASEFSFLLAVPMMMGATALDLYKSWGF
UPPP_ECOK1      LDDMTYRQAFMIGCFQCLALWPGFSRSGATISGGMLMGVSRYAASEFSFLLAVPMMMGATALDLYKSWGF
UPPP_ECOHS      LDDMTYRQAFMIGCFQCLALWPGFSRSGATISGGMLMGVSRYAASEFSFLLAVPMMMGATALDLYKSWGF
UPPP_ECODH      LDDMTYRQAFMIGCFQCLALWPGFSRSGATISGGMLMGVSRYAASEFSFLLAVPMMMGATALDLYKSWGF
UPPP_ECOBW      LDDMTYRQAFMIGCFQCLALWPGFSRSGATISGGMLMGVSRYAASEFSFLLAVPMMMGATALDLYKSWGF
UPPP_ECO8A      LDDMTYRQAFMIGCFQCLALWPGFSRSGATISGGMLMGVSRYAASEFSFLLAVPMMMGATALDLYKSWGF
UPPP_ECO81      LDDMTYRQAFMIGCFQCLALWPGFSRSGATISGGMLMGVSRYAASEFSFLLAVPMMMGATALDLYKSWGF
UPPP_ECO5E      LDDMTYRQAFMIGCFQCLALWPGFSRSGATISGGMLMGVSRYAASEFSFLLAVPMMMGATALDLYKSWGF
UPPP_ECO57      LDDMTYRQAFMIGCFQCLALWPGFSRSGATISGGMLMGVSRYAASEFSFLLAVPMMMGATALDLYKSWGF
UPPP_ECO55      LDDMTYRQAFMIGCFQCLALWPGFSRSGATISGGMLMGVSRYAASEFSFLLAVPMMMGATALDLYKSWGF
UPPP_ECO45      LDDMTYRQAFMIGCFQCLALWPGFSRSGATISGGMLMGVSRYAASEFSFLLAVPMMMGATALDLYKSWGF
UPPP_ECO27      LDDMTYRQAFMIGCFQCLALWPGFSRSGATISGGMLMGVSRYAASEFSFLLAVPMMMGATALDLYKSWGF
UPPP_ECO24      LDDMTYRQAFMIGCFQCLALWPGFSRSGATISGGMLMGVSRYAASEFSFLLAVPMMMGATALDLYKSWGF
UPPP3_BACHK     LDEITYKQAFTIGMFQCLALWPGFSRSGSTISGGLLARVSHTAAAEYTFILAVPMMVAASGLDLIKSWDI
UPPP2_SHEON     -IENIEKIGFKXXXXXXXXXXPGTSRSGATIVGGMLSGVSRKAATEYSFFLAIPTMLGAAIYDASKNYHL
UPPP_SPHAL      VEAMPLRTAIAIGAVQCIAMIPGVSRSGATIMGALLMGVERRTAAEFSFFLAVPTMMGATAYSLWKDRAI
UPPP_PSESM      VDDMTWRDALKIGLVQCLAMIPXXXXXXXXXXXXLLFGLSRKAATEFSFFLAMPTMVGAAVYSGYKYRDM
UPPP_ESCF3      LDDMTYRQAFMIGCFQCLALWPGFSRSGATISGGMLMGVSRYAASEFSFLLAVPMMMGATALDLYKSWGF
UPPP_ECO7I      LDDMTYRQAFMIGCFQCLALWPGFSRSGATISGGMLMGVSRYAASEFSFLLAVPMMMGATALDLYKSWGF
UPPP_CITK8      LDDMTYRQAFMIGCFQCLALWPGFSRSGATISGGMLMGVSRYAASEFSFLLAVPMMMGATALDLYKSWSF
UPPP_PSE14      VDDMTWSDALKVGLVQCLAMIPXXXXXXXXXXXXLLFGLSRKAATEFSFFLAMPTMVGAAVYSGYKYRDM
UPPP_CELJU      MDRISYADAFNVGLCQCLALIPGTSRSGATIIGGMYFGLSRRASTEFSFFLAIPMIGAASLYALWEAREQ
UPPP_PSEPW      VDDMRWSHALKIGFVQCLAMIPXXXXXXXXXXXXLLFGLSRKAATEFSFFLAMPTMVGAAVYSGYKYRDL
UPPP_DECAR      VDEMSMLDALKLGIAQAFALIPGTSRSGATIIGGLLFGLSRKAATEFSFFLAIPTLIVATFYQLYKERAL
UPPP1_BURCM     IDALTPLDALKVGLAQCFALVPGMSRSGSTIIGGMLFGLDRRVATEFSFFLAIPIIFGATLYETVKDWQA
UPPP_PSEPG      VDDMRWSHALKIGFVQCLAMIPXXXXXXXXXXXXLLFGLSRKAATEFSFFLAMPTMVGAAVYSGYKYRDL
UPPP_ACIBY      ATKITFKQALLVGLAQCVAMIPGTSRSGATIVGGMFAGLSRKAATEFSFFLAMPTMLGAATFDLIKNADV
UPPP_ACIBT      ATKITFKQALLVGLAQCVAMIPGTSRSGATIVGGMFAGLSRKAATEFSFFLAMPTMLGAATFDLIKNADV
UPPP_ACIBS      ATKITFKQALLVGLAQCVAMIPGTSRSGATIVGGMFAGLSRKAATEFSFFLAMPTMLGAATFDLIKNADV
UPPP_ACIBC      ATKITFKQALLVGLAQCVAMIPGTSRSGATIVGGMFAGLSRKAATEFSFFLAMPTMLGAATFDLIKNADV
UPPP_ACIB5      ATKITFKQALLVGLAQCVAMIPGTSRSGATIVGGMFAGLSRKAATEFSFFLAMPTMLGAATFDLIKNADV
UPPP_ACIB3      ATKITFKQALLVGLAQCVAMIPGTSRSGATIVGGMFAGLSRKAATEFSFFLAMPTMLGAATFDLIKNADV
UPPP3_BACCZ     LDEITYKQAFTIGMFQCLALWPGFSRSGSTISGGLLARVSHTAAAEYTFILAVPMMVAASGLDLIKSWDI
UPPP3_BACAH     LDEITYKQAFTIGMFQCLALWPGFSRSGSTISGGLLARVSHTAAAEYTFILAVPMMVAASGLDLIKSWDI
UPPP2_BACAN     LDEITYKQAFTIGMFQCLALWPGFSRSGSTISGGLLARVSHTAAAEYTFILAVPMMVAASGLDLIKSWDI
UPPP_PSEE4      VDEMSWHHALKIGFVQCLAMIPXXXXXXXXXXXXLLFGLSRKAATEFSFFLAMPTMVGAAVYSGYKYREL
UPPP_LACF3      LNTLPYKVAILIGCFQILSLIPGTSRSGATILGAILIGTSRYVAAEFSFFLAIPTMFGASLLKLYKHGGT
UPPP1_BURS3     VDELTPLDALKVGIAQCFALIPGMSRSGSTIIGGMLFGLDRRVATEFSFFLAIPIIFGATLYETVKDWQA
UPPP1_PSEPF     VDEIRWTDALKIGFAQCLAMIPXXXXXXXXXXXXLLFGLSRKTATEFSFFLAMPTMVGAAVYSGYKYRDL
UPPP_SULSY      IYEVPYQKAFLIGVFQSLAMVPGTSRSGATIVGGLLLGLDRKTAAEFSFMLAVPTMFMATFYDVYKNRSN
UPPP_PHOLL      LDDITYRQAFMIGCFQCLALWPGFSRSGATISGGMLMGVNRYTASEFSFILAVPMMMGASGLDLYKSLHF
UPPP_SALPC      LDDMTYRQAFMIGCFQCLALWPGFSRSGATISGGMLMGVSRYAASEFSFLLAVPMMMGATVLDLYKSWSF
UPPP_SODGM      IDDLTYLQAFLIGCFQCLALWPGFSRSGATISGGLLVGVSRYAASEFSFILAVPMMLGATVLDLYKSLPF
UPPP_BURMS      ALT--PFDALKVGLAQCCALIPGMSRSGSTIIGGMLFGLERRVATEFSFFLAIPVIFGATLYETAKDWRA
UPPP_BURMA      ALT--PFDALKVGLAQCCALIPGMSRSGSTIIGGMLFGLERRVATEFSFFLAIPVIFGATLYETAKDWRA
UPPP_BURM9      ALT--PFDALKVGLAQCCALIPGMSRSGSTIIGGMLFGLERRVATEFSFFLAIPVIFGATLYETAKDWRA
UPPP_BURM7      ALT--PFDALKVGLAQCCALIPGMSRSGSTIIGGMLFGLERRVATEFSFFLAIPVIFGATLYETAKDWRA
UPPP2_BURPS     ALT--PFDALKVGLAQCCALIPGMSRSGSTIIGGMLFGLERRVATEFSFFLAIPVIFGATLYETAKDWRA
UPPP2_BURP1     ALT--PFDALKVGLAQCCALIPGMSRSGSTIIGGMLFGLERRVATEFSFFLAIPVIFGATLYETAKDWRA
UPPP2_BURP0     ALT--PFDALKVGLAQCCALIPGMSRSGSTIIGGMLFGLERRVATEFSFFLAIPVIFGATLYETAKDWRA
UPPP_PERMH      ILKIPYYKAFFIGVFQSIAMIPGTSRSGATIIXXXXXXXDRKTAAEFSFLLAVPTMFAATSYDIMKNYHH
UPPP_LACPL      LQTLPYTTALFIGCFQLLSLIPGTSRSGATILGAILIGTSRYVATEFSFFMAIPTMFGASLLKLVKHGGS
UPPP_AZOBR      IERFPAPLALKIGLCQCLALVPGVSRSGATILGSLLMGVDRRTAAEF-----------------------
UPPP_RALPJ      LDDLRISDAIKVGFAQCFALIPXXXXXXXXXXXXLLFGLSRKVATEFSFFLAIPVIFGATVYELYKSRAL
UPPP_PSYWF      AEDVSLKTALLIGLMQCLALIPGTSRSGSTIIGALWLGVSRKAAAEFSFFLGIPVIIGAGLLDLLKHKDV
UPPP2_PSEPF     XXXMKWADALKIGCVQCLAMIPXXXXXXXXXXXXLLFGLSRKAATEFSFFLAMPTMVGAAVYSGYKYREL
UPPP1_BURTA     VQSIDPLDALKVGLAQCFALIPGVSRSGSTIIGGMLFGLERRVATEFSFFLAIPVIFGATLYETAKDWHA
UPPP1_ACIAD     VENIGLKQAIWIGLIQVLSLIPGTSRSGATIIGAMFLGVSRKAATEFSFFLGIPVIIGAGLLDLYQSHEV
UPPP_ENTS8      LDDMTYRQAFFIGCFQCLALWPGFSRSGATISGGMLVGVSRYAASEFSFLLAVPMMMGATALDLYKSMGF
UPPP_RALSO      LDDLRLSDAFKVGLAQCFALIPXXXXXXXXXXXXLLFGLSRKVATEFSFFLAIPVIFGATVYELYKERAL
UPPP_DESVH      LDEMSPALALGIGCFQCLALWPGFSRSAATIXXXXXXXXXXXXXXEYSFIAAVPIMFAATGYDLLKSWTL
UPPP_DESVV      LDEMSPALALGIGCFQCLALWPGFSRSAATIXXXXXXXXXXXXXXEYSFIAAVPIMFAATGYDLLKSWTL
UPPP_DESDA      LDDMTPRLALGIGCFQCLALWPGFSRSAATIMGGMLLGAKRPLAAEYSFIAAVPIMVAATGYDLLKNLSM
UPPP_LACDB      LNKMSNKTALLIGCFQVLSMIPGTSRSGATILGAMLIGSSRYVATEFSFFLAIPTMFGASLLKLFKAGHV
UPPP_LACDA      LNKMSNKTALLIGCFQVLSMIPGTSRSGATILGAMLIGSSRYVATEFSFFLAIPTMFGASLLKLFKAGHV
UPPP_LACC3      LADITYQTALLIGLFQVLSIVPGTSRSGATILGALLIGTSRYVATEFSFFLAIPTMVGVSILKIGKQGNG
UPPP1_BURXL     VDDLGALDALKVGLAQCFALIPGMSRSGSTIIGGMLFGLDRRVATEFSFFLAIPIIFGATAYELHKDWHL
UPPP_CAMFF      DTKTLHEVSFKIGLSQCFAMIPGTSRSGSTIITGLLCGLSREVAARFSFLLAIPTMFAATAYDSYKNADI
UPPP_LACCB      LADITYQTALLIGLFQVLSIVPGTSRSGATILGALLIGTSRYVATEFSFFLAIPTMVGVLIIKIGKQGNG
UPPP_CLOPH      LSDITYQMAFMIGLFQILAMIPGTSRSGATIIGAMLFGASRYVAAEFTFFLAIPTMFGASXXXXXXXXXX
UPPP_BDEBA      DLTYKDSV--KLGLFQAIAMIPGVSRSGATIMGGLTLGMNKKEAAEFSFFLAVPTMAAATLYKLLKIYKT
UPPP_METCA      IDDVDWRLALKLGLFQTLAMIPGTSRXXXXXXXXXXXXXXXXXXXEFSFFLAIPTLFIATAYDLYKTGGI
UPPP_PSEPK      VDDMRWSHALKIGFIQCLAMIPXXXXXXXXXXXXLLFGLSRKAATEFSFFLAMPTMVGAAVYSGYKYRDL
UPPP_FLAPJ      ITYLK---AFKIGLFQCIAMIPGVSRSGASIVGGMSQKLARTSAAEFSFFLAVPTMLGATLYDYYKDGFI
UPPP2_ENTFA     LADISYKTALMIGVFQVLSLIPGTSRSGATIIGALLIGVSRVAAAEFTFFLAVPTMLGASAFKLLKFGFD
UPPP2_BACLD     SVDRMTKQALGMGLFQCLALWPGFSRSGSTISGGVILGLSHRAAADFTFIMAIPIMMGASLLSLIKNWAY
UPPP_SALAR      LDDMTYRQAFMIGCFQCLALWPGFSRSGATISGGMLMGVSRYAASEFSFLLAVPMMMGATVLDLYKSWSF
UPPP_PSEP1      VDDMRWSHALKIGFIQCLAMIPXXXXXXXXXXXXLLFGLSRKAATEFSFFLAMPTMVGAAVYSGYKYRDL
UPPP_AQUAE      VRELPLRKAFMIGVFQSIAVIPGVSRSGSTIIGGMLMGLNRKVAAEFSFLLAIPTMFAATTYDLIKSGGS
UPPP_SALDC      LDDMTYRQAFMIGCFQCLALWPGFSRSGATISGGMLMGVSRYAASEFSFLLAVPMMMGATVLDLYKSWSF
UPPP_THEPX      MDKVDTKKSLLIGIAQVMSLFPGMSRSASTIMGGMLAGLSVKAAAEFSFFLAIPTMFAATTLSLLKGFSA
UPPP_GEOTN      TVDQITKQAFLVGLVQCLSLWPGFSRSGSTIAGGVLVGMSHRAAADFTFIMAVPIMAGASGLSLLKNWQY
UPPP_CYTH3      EEEVSYQTGFLIGCFQCLAMIPGVSRSAATIIGGLTQKLTRKAAAEFSFFLAVPTMFAATAKSLYDEKEL
UPPP_SALTY      LDDMTYRQAFMIGCFQCLALWPGFSRSGATISGGMLMGVSRYAASEFSFLLAVPMMMGATVLDLYKSWSF
UPPP_SALTI      LDDMTYRQAFMIGCFQCLALWPGFSRSGATISGGMLMGVSRYAASEFSFLLAVPMMMGATVLDLYKSWSF
UPPP_SALSV      LDDMTYRQAFMIGCFQCLALWPGFSRSGATISGGMLMGVSRYAASEFSFLLAVPMMMGATVLDLYKSWSF
UPPP_SALNS      LDDMTYRQAFMIGCFQCLALWPGFSRSGATISGGMLMGVSRYAASEFSFLLAVPMMMGATVLDLYKSWSF
UPPP_SALHS      LDDMTYRQAFMIGCFQCLALWPGFSRSGATISGGMLMGVSRYAASEFSFLLAVPMMMGATVLDLYKSWSF
UPPP_SALA4      LDDMTYRQAFMIGCFQCLALWPGFSRSGATISGGMLMGVSRYAASEFSFLLAVPMMMGATVLDLYKSWSF
UPPP_LACSS      LNTLPWLTAFWIGCFQALSIIPGTSRSGATILGAILIGTSRFVGAEFSFFMAIPTMIGVSILKIGKQGNT
UPPP2_BACCR     LDEITYKQAFTIGMFQCLALWPGFSRSGSTISGGLLARVSHTAAAEYTFILAVPMMVAASGLDLIKSWDV
UPPP_SALPK      LDDMTYRQAFMIGCFQCLALWPGFSRSGATISGGMLMGVSRYAASEFSFLLAVPMMMGATVLDLYKSWSF
UPPP_SALPA      LDDMTYRQAFMIGCFQCLALWPGFSRSGATISGGMLMGVSRYAASEFSFLLAVPMMMGATVLDLYKSWSF
UPPP_SALCH      LDDMTYRQAFMIGCFQCLALWPGFSRSGATISGGMLMGVSRYAASEFSFLLAVPMMMGATVLDLYKSWSF
UPPP_AZOVD      EMNWRHAL--KIGCAQCLAMIPXXXXXXXXXXXXLLFGLSRKAATEFSFFLAMPTMVGAAAYSGYKHRAL
UPPP_STRTD      LARMSYKTAFYIGLFQVLSIIPGTSRSGATILGGIIVGTSRSVAADFTFFLAIPTMFGYSGLKAVKDGNT
UPPP_GEOSW      VDQITYKQALIVGLVQCLSLWPGFSRSGSTISGGVLVGMSHRAAADFTFIMAVPIMMGASVLSLLKNWQY
UPPP_THEP3      MDKVDTKKSLLIGIAQVMSLFPGMSRSASTIMGGMLAGLSVKAAAEFSFFLAIPTMFAATTLSLLKGFSA
UPPP_DESDG      LDDVSPALALGIGMFQCLALWPGFSRSAATIMXXXXXXXXXXXXXEYSFVAAVPIMFAATGYDMYKSYSL
UPPP_DEIGD      LKQIGLGRAFLIGAAQCLALLPGFSRSASSILGGMVMGLDRPTATRFSFYLGIPTLGGAALLDFIKSRHL
UPPP_SERP5      LDDITYRQAFMIGCFQCLALWPGFSRSGSTIAGGMLVGVNRYAAAEFSFILAVPMMIGASGLDLYKSLHF
UPPP1_CLOD6     FSQVTYKLALCIGLFQCLALIPGTSRSGSTIIGAVLLGTSRYVAAEFSFFLAIPTM--------------
UPPP_STRT2      LARMSYKTAFYIGLFQVLSIIPGTSRSGATILGGIIVGTSRSVAADFTFFLGIPTMFGYSGLKAVKDGNT
UPPP_STRT1      LARMSYKTAFYIGLFQVLSIIPGTSRSGATILGGIIVGTSRSVAADFTFFLGIPTMFGYSGLKAVKDGNT
UPPP_PORGI      IT-YPK--AFVIGLFQCLAILPGLSRSMATIVGGQQQKLSRKAAAEFSFFLAVPTMLGATLLKAYKGGIE
UPPP_PORG3      IT-YPK--AFVIGLFQCLAILPGLSRSMATIVGGQQQKLSRKAAAEFSFFLAVPTMLGATLLKLYKEGGI
UPPP_DESHD      LSQITYTTAFMIGIFQLIAAIPGTSRSGATIVGGLLLGVSRTVAAEFTFFLAIPVMFGASALKLLKFGFN
UPPP_CAMJE      LEEISFKQAFCIGIFQSLAMIPGTSRSGASIIGGLLLEFNRKVAAEFSFLLAIPTMIIATAYSIYKEPEL
UPPP_LAWIP      LDELTPKTALGIGFFECLALWPGFSRSAATIMGGMLLGAKRHLAAEYSFIAAVPVMFAATGYDLLKNWDL
UPPP_DEIRA      IENISAGKALAIGAAQCLALLPGFSRSASSILGGMLLGLDRPTATKFSFYLGVPTLGGAALLDFIKSREI
UPPP1_CLOAB     ISEITYTTAVLIGIFQLIAAVPGTSRSGATIVGALLIGVSRTVAAEYTFFLAIPVMFGASLLKLFKFGLH
UPPP_RENSM      ELTVKHGILY--GLAQCLALIPGVSRSGGTITAGLLMGYTREAAARYSFLLAIPAVLGSGFYELFKHENA
UPPP_FUSNN      FAGLKYRTAFLIGFFQCLAMIPGTSRSXXXXXXXXXXXXSRPLAAEFSFYLAIPTMFGATALKLFKNGLA
UPPP_LEUCK      VNRITFKMALFIGLFQVLSLVPGTSRSGATILGAVILGASRFVAAEFSFFLSIPVMFGVTILKLLKGG--
UPPP_EXIS2      LDQISYRQAALVGLFQCISLWPGFSRSGSTISGGVFLGMNHRTAADFTFIMAVPIMFGASALSLVKNWEY
UPPP_STRSY      LAKMSYKTALLIGCFQVLSIVPGTSRSGATILGAIILGTSRSVAADFTFFLGIPTMFGYSGLKAVKDGNS
UPPP_STRS2      LAKMSYKTALLIGCFQVLSIVPGTSRSGATILGAIILGTSRSVAADFTFFLGIPTMFGYSGLKAVKDGNS
UPPP_CAMHC      ILTLDGKQAFFIGLSQCFAMVPGTSRSGATIIAGLLSGLNRQTAAAFSFLLAVPTMFAATFYDTYKNREA
UPPP_CLOTH      ISTFE-ELGYKIGAFQVLALIPGTSRSGATILGAIMIGCSREIAAEFSFYLAIPVMFGASLLKLVKFGFA
UPPP_CAMJ8      LEEISFKQAFCIGIFQSLAMIPGTSRSGASIIXXXXXXFNRKVAAEFSFLLAIPTMIIATAYSIYKEPEL
UPPP_META3      LKDISYKQSLLIGIAQAFSLIPGTSRSGATIVGGMLCNLNRKTATEFSFLGALPVMLAASLFDIVKHHSE
UPPP1_OENOB     INHLTLADVLKIGFFQVLSIVPGTSRSGATILGGISIGVSREAAAEFSFFLSIPTMLGVSVLKILHSHGM
UPPP_CAMJR      LEEISFKQAFCIGIFQSLAMIPGTSRSGASIIXXXXXXFNRKVAAEFSFLLAIPTMIIATAYSIYKEPEL
UPPP_CAMJJ      LEEISFKQAFCIGIFQSLAMIPGTSRSGASIIXXXXXXFNRKVAAEFSFLLAIPTMIIATAYSIYKEPEL
UPPP_STRGC      LEKLPYKTALYIGFFQVLSLFPGTSRSGATIVGGLLNGTSRSVVTEFTFFLGIPVMFGASVLKFILKGNS
UPPP_SORC5      VTF---QRALAIGFAQCFSLWPGASRSMTTIVGGQLSGLSTAAAAEFSFLLAIPTLGAATVFDLVKNGRA
UPPP_THEFY      LTDLNAQRGLIYGLFQMLALIPGVSRSGATVTGGMLMGFKREAAARYAFLLAMPAV---FASGLYKLKDI
UPPP_SHEFN      FMGWKKALL--IGLAQAMALIPGTSRSGATMTAALMLGLTRDAAARFSFLMSVPVSFGAALLVTKDLVSS
UPPP_CAMJD      LEEISFKQAFCIGIFQSLAMIPGTSRSGASIIXXXXXXFNRKVAAEFSFLL