[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for atum0:AAK86181.1

[Show Plain Result]


## Summary of Sequence Search
    1::299
    7::305     3e-41  33%  309 aa  RBSK_ECOLI RecName: Full=Ribokinase;         EC=2.7.1.15;
    7::305     3e-41  33%  309 aa  RBSK_ECO57 RecName: Full=Ribokinase;         EC=2.7.1.15;
    6::289     4e-38  39%  294 aa  RBSK_BACHD RecName: Full=Ribokinase;         EC=2.7.1.15;
    4::292     3e-37  36%  293 aa  RBSK_BACSU RecName: Full=Ribokinase;         EC=2.7.1.15;
    4::292     2e-36  36%  300 aa  RBSK_LACLA RecName: Full=Ribokinase;         EC=2.7.1.15;
    5::298     3e-35  31%  306 aa  RBSK_HAEIN RecName: Full=Ribokinase;         EC=2.7.1.15;
    4::311     1e-32  33%  318 aa  RBSK_SCHPO RecName: Full=Putative ribokinase;         EC=2.7.1.15;
    3::329     2e-30  36%  333 aa  RBSK_YEAST RecName: Full=Probable ribokinase;         EC=2.7.1.15;
   22::321     4e-28  30%  322 aa  RBSK_HUMAN RecName: Full=Ribokinase;         EC=2.7.1.15;
   23::322     2e-26  28%  323 aa  RBSK_MOUSE RecName: Full=Ribokinase;         EC=2.7.1.15;
    5::318     1e-16  26%  318 aa  RBSK_DICDI RecName: Full=Probable ribokinase;         EC=2.7.1.15;
   11::319     5e-12  27%  328 aa  SCRK2_SOLLC RecName: Full=Fructokinase-2;         EC=2.7.1.4;
   11::319     6e-12  28%  328 aa  SCRK2_SOLHA RecName: Full=Fructokinase-2;         EC=2.7.1.4;
  193::316     1e-11  39%  323 aa  SCRK1_ORYSJ RecName: Full=Fructokinase-1;       
  193::316     1e-11  39%  323 aa  SCRK1_ORYSI RecName: Full=Fructokinase-1;       
   13::299     5e-11  24%  476 aa  HLDE_MANSM RecName: Full=Bifunctional protein hldE;Includes:
  193::316     7e-11  38%  323 aa  SCRK1_MAIZE RecName: Full=Fructokinase-1;       
   12::310     9e-11  27%  319 aa  SCRK_SOLTU RecName: Full=Fructokinase;         EC=2.7.1.4;
   13::321     9e-11  26%  325 aa  IOLC_LISIN RecName: Full=5-dehydro-2-deoxygluconokinase;       
  195::321     2e-10  27%  325 aa  IOLC_LISMH RecName: Full=5-dehydro-2-deoxygluconokinase;       
  195::321     2e-10  27%  325 aa  IOLC_LISMF RecName: Full=5-dehydro-2-deoxygluconokinase;       
  195::321     2e-10  27%  325 aa  IOLC_LISMC RecName: Full=5-dehydro-2-deoxygluconokinase;       
   24::320     4e-10  26%  320 aa  YDJE_BACSU RecName: Full=Uncharacterized sugar kinase ydjE;        
   27::301     4e-10  30%  307 aa  SCRK_VIBAL RecName: Full=Fructokinase;         EC=2.7.1.4;
   37::318     4e-10  24%  325 aa  IOLC_BACLD RecName: Full=5-dehydro-2-deoxygluconokinase;       
   49::296     5e-10  27%  480 aa  HLDE_THICR RecName: Full=Bifunctional protein hldE;Includes:
   23::263     8e-10  28%  284 aa  YURL_BACSU RecName: Full=Uncharacterized sugar kinase yurL;        
    5::250     1e-09  26%  250 aa  Y356_ARCFU RecName: Full=Uncharacterized sugar kinase AF_0356;     
   12::298     1e-09  23%  475 aa  HLDE_HAES1 RecName: Full=Bifunctional protein hldE;Includes:
  180::302     1e-09  34%  475 aa  HLDE_COXBN RecName: Full=Bifunctional protein hldE;Includes:
   10::318     1e-09  31%  345 aa  SCRK3_ARATH RecName: Full=Probable fructokinase-3;       
  195::321     1e-09  26%  325 aa  IOLC_LISMO RecName: Full=5-dehydro-2-deoxygluconokinase;       
   11::294     2e-09  24%  309 aa  Y1544_METTH RecName: Full=Uncharacterized sugar kinase MTH_1544;   
  195::317     2e-09  29%  330 aa  IOLC_BACA2 RecName: Full=5-dehydro-2-deoxygluconokinase;       
   13::299     2e-09  23%  476 aa  HLDE_HAEIE RecName: Full=Bifunctional protein hldE;Includes:
   13::299     2e-09  23%  476 aa  HLDE_HAEI8 RecName: Full=Bifunctional protein hldE;Includes:
   59::315     3e-09  32%  333 aa  YZ37_SYNY3 RecName: Full=Uncharacterized sugar kinase slr0537;     
   28::305     3e-09  25%  307 aa  SCRK_ECOLX RecName: Full=Fructokinase;         EC=2.7.1.4;
  195::318     3e-09  28%  325 aa  IOLC_BACSU RecName: Full=5-dehydro-2-deoxygluconokinase;       
   13::299     3e-09  23%  476 aa  HLDE_HAEIN RecName: Full=Bifunctional protein hldE;Includes:
   13::299     3e-09  23%  476 aa  HLDE_HAEIG RecName: Full=Bifunctional protein hldE;Includes:
  180::302     3e-09  34%  475 aa  HLDE_COXBU RecName: Full=Bifunctional protein hldE;Includes:
  180::302     3e-09  34%  475 aa  HLDE_COXBR RecName: Full=Bifunctional protein hldE;Includes:
   13::305     3e-09  28%  477 aa  HLDE_CITK8 RecName: Full=Bifunctional protein hldE;Includes:
    9::82      4e-09  33%  325 aa  SCRK1_ARATH RecName: Full=Probable fructokinase-1;       
  195::319     9e-09  27%  326 aa  IOLC_BACSK RecName: Full=5-dehydro-2-deoxygluconokinase;       
   31::293     1e-08  21%  309 aa  K6PF2_ECOLI RecName: Full=6-phosphofructokinase isozyme 2;       
   13::305     1e-08  28%  476 aa  HLDE_ENT38 RecName: Full=Bifunctional protein hldE;Includes:
   36::314     1e-08  24%  340 aa  ADK_DICDI RecName: Full=Adenosine kinase;         Short=AK;        
   11::319     2e-08  29%  329 aa  SCRK2_ARATH RecName: Full=Probable fructokinase-2;       
   39::313     2e-08  26%  331 aa  IOLC_PHOPR RecName: Full=5-dehydro-2-deoxygluconokinase;       
   13::283     2e-08  28%  477 aa  HLDE_ECOHS RecName: Full=Bifunctional protein hldE;Includes:
   36::334     2e-08  26%  344 aa  ADK1_ARATH RecName: Full=Adenosine kinase 1;         Short=AK 1;   
   13::283     3e-08  28%  475 aa  HLDE_ENTS8 RecName: Full=Bifunctional protein hldE;Includes:
   37::322     4e-08  22%  331 aa  IOLC_BACHD RecName: Full=5-dehydro-2-deoxygluconokinase;       
   13::283     4e-08  28%  477 aa  HLDE_SHIFL RecName: Full=Bifunctional protein hldE;Includes:
   13::283     4e-08  28%  477 aa  HLDE_SHIF8 RecName: Full=Bifunctional protein hldE;Includes:
   13::283     4e-08  28%  477 aa  HLDE_SHIDS RecName: Full=Bifunctional protein hldE;Includes:
   13::283     4e-08  28%  477 aa  HLDE_SHIBS RecName: Full=Bifunctional protein hldE;Includes:
   13::283     4e-08  28%  477 aa  HLDE_SHIB3 RecName: Full=Bifunctional protein hldE;Includes:
   37::305     4e-08  27%  477 aa  HLDE_SALDC RecName: Full=Bifunctional protein hldE;Includes:
   13::283     4e-08  28%  477 aa  HLDE_ECOUT RecName: Full=Bifunctional protein hldE;Includes:
   13::283     4e-08  28%  477 aa  HLDE_ECOSM RecName: Full=Bifunctional protein hldE;Includes:
   13::283     4e-08  28%  477 aa  HLDE_ECOSE RecName: Full=Bifunctional protein hldE;Includes:
   13::283     4e-08  28%  477 aa  HLDE_ECOLU RecName: Full=Bifunctional protein hldE;Includes:
   13::283     4e-08  28%  477 aa  HLDE_ECOLI RecName: Full=Bifunctional protein hldE;Includes:
   13::283     4e-08  28%  477 aa  HLDE_ECOLC RecName: Full=Bifunctional protein hldE;Includes:
   13::283     4e-08  28%  477 aa  HLDE_ECOL6 RecName: Full=Bifunctional protein hldE;Includes:
   13::283     4e-08  28%  477 aa  HLDE_ECOL5 RecName: Full=Bifunctional protein hldE;Includes:
   13::283     4e-08  28%  477 aa  HLDE_ECOK1 RecName: Full=Bifunctional protein hldE;Includes:
   13::283     4e-08  28%  477 aa  HLDE_ECODH RecName: Full=Bifunctional protein hldE;Includes:
   13::283     4e-08  28%  477 aa  HLDE_ECOBW RecName: Full=Bifunctional protein hldE;Includes:
   13::283     4e-08  28%  477 aa  HLDE_ECO8A RecName: Full=Bifunctional protein hldE;Includes:
   13::283     4e-08  28%  477 aa  HLDE_ECO81 RecName: Full=Bifunctional protein hldE;Includes:
   13::283     4e-08  28%  477 aa  HLDE_ECO7I RecName: Full=Bifunctional protein hldE;Includes:
   13::283     4e-08  28%  477 aa  HLDE_ECO55 RecName: Full=Bifunctional protein hldE;Includes:
   13::283     4e-08  28%  477 aa  HLDE_ECO45 RecName: Full=Bifunctional protein hldE;Includes:
   13::283     4e-08  28%  477 aa  HLDE_ECO27 RecName: Full=Bifunctional protein hldE;Includes:
   13::283     4e-08  28%  477 aa  HLDE_ECO24 RecName: Full=Bifunctional protein hldE;Includes:
   37::283     6e-08  28%  477 aa  HLDE_SHISS RecName: Full=Bifunctional protein hldE;Includes:
   37::283     6e-08  28%  477 aa  HLDE_ECO5E RecName: Full=Bifunctional protein hldE;Includes:
   37::283     6e-08  28%  477 aa  HLDE_ECO57 RecName: Full=Bifunctional protein hldE;Includes:
  176::304     7e-08  33%  307 aa  SCRK_SALTY RecName: Full=Fructokinase;         EC=2.7.1.4;
   90::218     7e-08  33%  221 aa  SCRK_SALTH RecName: Full=Fructokinase;         EC=2.7.1.4;Flags:
   18::323     7e-08  22%  332 aa  IOLC2_BACCZ RecName: Full=5-dehydro-2-deoxygluconokinase 2;        
   13::283     7e-08  28%  477 aa  HLDE_ESCF3 RecName: Full=Bifunctional protein hldE;Includes:
   62::339     1e-07  25%  362 aa  YEII_ECOLI RecName: Full=Uncharacterized sugar kinase yeiI;        
   36::282     1e-07  28%  309 aa  LACC_STRPG RecName: Full=Tagatose-6-phosphate kinase;       
   38::323     1e-07  22%  332 aa  IOLC1_BACCZ RecName: Full=5-dehydro-2-deoxygluconokinase 1;        
   51::282     1e-07  26%  476 aa  HLDE_VIBPA RecName: Full=Bifunctional protein hldE;Includes:
   51::309     1e-07  26%  477 aa  HLDE_KLEP7 RecName: Full=Bifunctional protein hldE;Includes:
   51::309     1e-07  26%  477 aa  HLDE_KLEP3 RecName: Full=Bifunctional protein hldE;Includes:
  181::283     2e-07  34%  310 aa  LACC_STRA1 RecName: Full=Tagatose-6-phosphate kinase;       
  200::323     2e-07  21%  332 aa  IOLC_BACHK RecName: Full=5-dehydro-2-deoxygluconokinase;       
  200::323     2e-07  21%  332 aa  IOLC_BACC3 RecName: Full=5-dehydro-2-deoxygluconokinase;       
  200::323     2e-07  21%  332 aa  IOLC_BACAN RecName: Full=5-dehydro-2-deoxygluconokinase;       
  200::323     2e-07  21%  332 aa  IOLC_BACAH RecName: Full=5-dehydro-2-deoxygluconokinase;       
  200::323     2e-07  21%  332 aa  IOLC_BACAC RecName: Full=5-dehydro-2-deoxygluconokinase;       
  200::323     2e-07  21%  332 aa  IOLC_BACAA RecName: Full=5-dehydro-2-deoxygluconokinase;       
   13::299     2e-07  25%  476 aa  HLDE_PASMU RecName: Full=Bifunctional protein hldE;Includes:
  218::335     2e-07  33%  345 aa  ADK2_ARATH RecName: Full=Adenosine kinase 2;         Short=AK 2;   
  181::283     2e-07  34%  310 aa  LACC_STRA5 RecName: Full=Tagatose-6-phosphate kinase;       
  181::283     2e-07  34%  310 aa  LACC2_STRA3 RecName: Full=Tagatose-6-phosphate kinase 2;       
   13::298     2e-07  24%  474 aa  HLDE_PSE14 RecName: Full=Bifunctional protein hldE;Includes:
    6::314     3e-07  28%  324 aa  SCRK5_ARATH RecName: Full=Putative fructokinase-5;       
   36::282     4e-07  28%  309 aa  LACC_STRP8 RecName: Full=Tagatose-6-phosphate kinase;       
   37::305     4e-07  27%  477 aa  HLDE_SALTY RecName: Full=Bifunctional protein hldE;Includes:
   37::305     4e-07  27%  477 aa  HLDE_SALTI RecName: Full=Bifunctional protein hldE;Includes:
   37::305     4e-07  27%  477 aa  HLDE_SALSV RecName: Full=Bifunctional protein hldE;Includes:
   37::305     4e-07  27%  477 aa  HLDE_SALPK RecName: Full=Bifunctional protein hldE;Includes:
   37::305     4e-07  27%  477 aa  HLDE_SALPC RecName: Full=Bifunctional protein hldE;Includes:
   37::305     4e-07  27%  477 aa  HLDE_SALPB RecName: Full=Bifunctional protein hldE;Includes:
   37::305     4e-07  27%  477 aa  HLDE_SALPA RecName: Full=Bifunctional protein hldE;Includes:
   37::305     4e-07  27%  477 aa  HLDE_SALNS RecName: Full=Bifunctional protein hldE;Includes:
   37::305     4e-07  27%  477 aa  HLDE_SALHS RecName: Full=Bifunctional protein hldE;Includes:
   37::305     4e-07  27%  477 aa  HLDE_SALG2 RecName: Full=Bifunctional protein hldE;Includes:
   37::305     4e-07  27%  477 aa  HLDE_SALEP RecName: Full=Bifunctional protein hldE;Includes:
   37::305     4e-07  27%  477 aa  HLDE_SALCH RecName: Full=Bifunctional protein hldE;Includes:
   37::305     4e-07  27%  477 aa  HLDE_SALA4 RecName: Full=Bifunctional protein hldE;Includes:
   37::309     5e-07  26%  477 aa  HLDE_SALAR RecName: Full=Bifunctional protein hldE;Includes:
   13::305     5e-07  26%  477 aa  HLDE_EDWI9 RecName: Full=Bifunctional protein hldE;Includes:
   32::338     5e-07  26%  343 aa  ADK_PHYPA RecName: Full=Adenosine kinase;         Short=AK;        
  180::282     6e-07  33%  309 aa  LACC_STRPF RecName: Full=Tagatose-6-phosphate kinase;       
   13::298     1e-06  23%  474 aa  HLDE_PSESM RecName: Full=Bifunctional protein hldE;Includes:
   10::107     1e-06  31%  326 aa  SCRK4_ARATH RecName: Full=Probable fructokinase-4;       
   13::299     1e-06  25%  476 aa  HLDE_SHEHH RecName: Full=Bifunctional protein hldE;Includes:
  239::325     2e-06  35%  335 aa  SCRK2_MAIZE RecName: Full=Fructokinase-2;       
   36::282     2e-06  28%  309 aa  LACC_STRPC RecName: Full=Tagatose-6-phosphate kinase;       
   36::282     2e-06  28%  309 aa  LACC_STRPB RecName: Full=Tagatose-6-phosphate kinase;       
   36::282     2e-06  29%  309 aa  LACC_STRP1 RecName: Full=Tagatose-6-phosphate kinase;       
    6::293     3e-06  25%  298 aa  KHK_HUMAN RecName: Full=Ketohexokinase;         EC=2.7.1.3;AltName:
   36::282     4e-06  28%  309 aa  LACC_STRPM RecName: Full=Tagatose-6-phosphate kinase;       
   36::282     4e-06  28%  309 aa  LACC_STRPD RecName: Full=Tagatose-6-phosphate kinase;       
   51::298     4e-06  27%  474 aa  HLDE_PSEPF RecName: Full=Bifunctional protein hldE;Includes:
  168::301     5e-06  26%  314 aa  Y057_BUCAP RecName: Full=Uncharacterized sugar kinase BUsg_057;    
   36::282     5e-06  28%  309 aa  LACC_STRPZ RecName: Full=Tagatose-6-phosphate kinase;       
  178::277     5e-06  34%  476 aa  HLDE_VIBSL RecName: Full=Bifunctional protein hldE;Includes:
  189::305     5e-06  33%  475 aa  HLDE_AERS4 RecName: Full=Bifunctional protein hldE;Includes:
  239::325     7e-06  35%  336 aa  SCRK2_ORYSJ RecName: Full=Fructokinase-2;       
  239::325     7e-06  35%  336 aa  SCRK2_ORYSI RecName: Full=Fructokinase-2;       
  177::260     7e-06  29%  261 aa  FRLD_SHIFL RecName: Full=Fructoselysine kinase;         EC=2.7.1.-;
  177::260     7e-06  29%  261 aa  FRLD_ECOLI RecName: Full=Fructoselysine kinase;         EC=2.7.1.-;
  104::351     7e-06  24%  361 aa  ADK_MOUSE RecName: Full=Adenosine kinase;         Short=AK;        
   36::282     9e-06  31%  309 aa  LACC_STRP3 RecName: Full=Tagatose-6-phosphate kinase;       
  218::282     9e-06  37%  309 aa  LACC1_STRA3 RecName: Full=Tagatose-6-phosphate kinase 1;       
  187::302     9e-06  30%  324 aa  KDGK_BACSU RecName: Full=2-dehydro-3-deoxygluconokinase;       
  180::278     9e-06  35%  307 aa  K1PF_BORBU RecName: Full=1-phosphofructokinase;       
  189::313     9e-06  23%  326 aa  IOLC_LACCA RecName: Full=5-dehydro-2-deoxygluconokinase;       
   13::298     9e-06  23%  474 aa  HLDE_PSEU2 RecName: Full=Bifunctional protein hldE;Includes:
  104::351     9e-06  26%  361 aa  ADK_RAT RecName: Full=Adenosine kinase;         Short=AK;       
  180::282     2e-05  32%  309 aa  LACC_STRP6 RecName: Full=Tagatose-6-phosphate kinase;       
  241::314     2e-05  30%  486 aa  HLDE_ACIBL RecName: Full=Bifunctional protein hldE;Includes:
   34::310     2e-05  24%  315 aa  YDJH_ECOLI RecName: Full=Uncharacterized sugar kinase ydjH;        
   49::305     2e-05  23%  478 aa  HLDE_DICNV RecName: Full=Bifunctional protein hldE;Includes:
   13::299     3e-05  24%  476 aa  HLDE_SHEPA RecName: Full=Bifunctional protein hldE;Includes:
  200::315     3e-05  22%  338 aa  IOLC_CLOPE RecName: Full=5-dehydro-2-deoxygluconokinase;       
  200::315     3e-05  22%  338 aa  IOLC_CLOP1 RecName: Full=5-dehydro-2-deoxygluconokinase;       
  176::304     3e-05  33%  473 aa  HLDE_METCA RecName: Full=Bifunctional protein hldE;Includes:
  209::296     3e-05  31%  472 aa  HLDE_CAMC1 RecName: Full=Bifunctional protein hldE;Includes:
  234::351     3e-05  26%  361 aa  ADK_CRIGR RecName: Full=Adenosine kinase;         Short=AK;        
  136::301     4e-05  24%  315 aa  Y060_BUCAI RecName: Full=Uncharacterized sugar kinase BU060;       
  218::282     4e-05  35%  309 aa  LACC_STRSV RecName: Full=Tagatose-6-phosphate kinase;       
  219::283     4e-05  35%  310 aa  LACC_STAHJ RecName: Full=Tagatose-6-phosphate kinase;       
  204::277     4e-05  28%  303 aa  K1PF_BACSU RecName: Full=1-phosphofructokinase;       
   13::298     4e-05  23%  473 aa  HLDE_PSEPG RecName: Full=Bifunctional protein hldE;Includes:
  188::298     4e-05  26%  477 aa  HLDE_PSEF5 RecName: Full=Bifunctional protein hldE;Includes:
  189::303     4e-05  30%  477 aa  HLDE_BLOPB RecName: Full=Bifunctional protein hldE;Includes:
  219::283     6e-05  34%  310 aa  LACC_STRMU RecName: Full=Tagatose-6-phosphate kinase;       
  219::283     6e-05  34%  310 aa  LACC_CLOPE RecName: Full=Tagatose-6-phosphate kinase;       
  178::299     6e-05  27%  476 aa  HLDE_SHEB8 RecName: Full=Bifunctional protein hldE;Includes:
   51::277     8e-05  25%  476 aa  HLDE_VIBF1 RecName: Full=Bifunctional protein hldE;Includes:
  178::299     8e-05  27%  476 aa  HLDE_SHESW RecName: Full=Bifunctional protein hldE;Includes:
  178::299     8e-05  27%  476 aa  HLDE_SHEPC RecName: Full=Bifunctional protein hldE;Includes:
  178::299     1e-04  27%  476 aa  HLDE_SHEB9 RecName: Full=Bifunctional protein hldE;Includes:
  178::299     1e-04  27%  476 aa  HLDE_SHEB5 RecName: Full=Bifunctional protein hldE;Includes:
  178::299     1e-04  27%  476 aa  HLDE_SHEB2 RecName: Full=Bifunctional protein hldE;Includes:
  155::294     1e-04  26%  298 aa  YIHV_ECOLI RecName: Full=Uncharacterized sugar kinase yihV;        
   49::270     1e-04  26%  321 aa  YEGV_ECOLI RecName: Full=Uncharacterized sugar kinase yegV;        
   51::277     1e-04  22%  476 aa  HLDE_VIBFM RecName: Full=Bifunctional protein hldE;Includes:
   13::307     1e-04  25%  477 aa  HLDE_HAHCH RecName: Full=Bifunctional protein hldE;Includes:
  235::352     1e-04  27%  362 aa  ADK_HUMAN RecName: Full=Adenosine kinase;         Short=AK;        
    7::253     2e-04  24%  310 aa  Y1459_PYRHO RecName: Full=Uncharacterized sugar kinase PH1459;     
  180::292     2e-04  31%  297 aa  KHK_PONAB RecName: Full=Ketohexokinase;         EC=2.7.1.3;AltName:
  178::277     3e-04  31%  476 aa  HLDE_VIBCM RecName: Full=Bifunctional protein hldE;Includes:
  178::277     3e-04  31%  476 aa  HLDE_VIBC3 RecName: Full=Bifunctional protein hldE;Includes:
  365::472     4e-04  27%  763 aa  THIED_CORGL RecName: Full=Multifunctional protein thiED;Includes:
   67::300     4e-04  21%  476 aa  HLDE_PSYIN RecName: Full=Bifunctional protein hldE;Includes:
  188::298     4e-04  25%  473 aa  HLDE_PSEPW RecName: Full=Bifunctional protein hldE;Includes:
  139::243     6e-04  33%  312 aa  PDXK_RAT RecName: Full=Pyridoxal kinase;       
  149::253     6e-04  35%  322 aa  PDXK_PIG RecName: Full=Pyridoxal kinase;       
  219::283     6e-04  32%  310 aa  LACC_STRU0 RecName: Full=Tagatose-6-phosphate kinase;       
  203::293     6e-04  34%  298 aa  KHK_RAT RecName: Full=Ketohexokinase;         EC=2.7.1.3;AltName:
  189::277     6e-04  32%  476 aa  HLDE_VIBVY RecName: Full=Bifunctional protein hldE;Includes:
  189::277     6e-04  32%  476 aa  HLDE_VIBVU RecName: Full=Bifunctional protein hldE;Includes:
  188::298     6e-04  26%  473 aa  HLDE_PSEU5 RecName: Full=Bifunctional protein hldE;Includes:
   13::298     6e-04  23%  473 aa  HLDE_PSEPK RecName: Full=Bifunctional protein hldE;Includes:
   13::298     6e-04  23%  473 aa  HLDE_PSEP1 RecName: Full=Bifunctional protein hldE;Includes:
  211::288     8e-04  33%  302 aa  Y406_METJA RecName: Full=Uncharacterized sugar kinase MJ0406;      
  149::258     8e-04  31%  283 aa  PDXK_SHIDS RecName: Full=Pyridoxine kinase;       
  219::288     8e-04  36%  310 aa  LACC_STAAR RecName: Full=Tagatose-6-phosphate kinase;       
  188::298     8e-04  25%  473 aa  HLDE_PSEE4 RecName: Full=Bifunctional protein hldE;Includes:
    1::299

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MITVFGSINMDLVATAKRLPKPGETVTGDTFSTAAGGKGANQALAARRAGVTVKMAGATGDDTFAAPALT
RBSK_ECOLI      -LVVLGSINADHILNLQSFPTPGETVTGNHYQVAFGGKGANQAVAAGRSGANIAFIACTGDDSIGESVRQ
RBSK_ECO57      -LVVLGSINADHILNLQSFPTPGETVTGNHYQVAFGGKGANQAVAAGRSGANIAFIACTGDDSIGESVRQ
RBSK_BACHD      -ITVVGSINMDMVTITDVVPVQGETVLGKDFRTVPGGKGANQAVAAARLGANVRMIGRVGDDPFGHVLTE
RBSK_BACSU      -ICVIGSCSMDLVVTSDKRPKAGETVLGTSFQTVPGGKGANQAVAAARLGAQVFMVGKVGDDHYGTAILN
RBSK_LACLA      -VSVIGSISMDLVTRTNRVPNAGETVFGEDFAMVPGGKGANQAVAARLSPNEVSMIGAVGKDAFGESILQ
RBSK_HAEIN      -LTVLGSINADHVISVPYFTKPGETLTGQNYQIAYGGKGANQXXXXXXXXXXXXFISCIGSDSIGKTMKN
RBSK_SCHPO      -IVVLGSMNTDLVMRTKICPSGGETIHGDGFSTGNGGKGANQAVAVARADTKVSMLGCVGDDAFGVEMLS
RBSK_YEAST      -ITVIGSLNYDLDTFTDRLPNAGETFRANHFETHAGGKGLNQAAAIGKSRYSVRMIGNVGNDTFGKQLKD
RBSK_HUMAN      -----GSCMTDLVSLTSRLPKTGETXXXXXXXXXXXXXXANQCVQAARLGAMTSMVCKVGKDSFGNDYIE
RBSK_MOUSE      -----GSCMTDLVSLTSRLPKTGETXXXXXXXXXXXXXXANQCVQAARLGAKAAIVCKVGNDSFGNDYIE
RBSK_DICDI      -ITVVGASNWDTFIYVDKMPRVGETIKGTDLKVSYGGKAANQAVQASLLGSNCTLITKLGDDPSGVNTLK
SCRK2_SOLLC     LIVSFGEMLIDFVPTVSGV----SLAEAPGFLKAPGGAPANVAIAVTRLGGKSAFVGKLGDDEFGHMLAG
SCRK2_SOLHA     LIVSFGEMLIDFVPTVSGV----SLAEAPGFLKAPGGAPANVAIAVTRLGGRSAFVGKLGDDEFGHMLAG
SCRK1_ORYSJ     ----------------------------------------------------------------------
SCRK1_ORYSI     ----------------------------------------------------------------------
HLDE_MANSM      -VLVLGDVMLDRYATNRISPEAPVPVVRVQENEERAGGAANVAMNIASLNVPVQLLGLTGLDETGKALTT
SCRK1_MAIZE     ----------------------------------------------------------------------
SCRK_SOLTU      LIVSFGEMLIDFVPTVSGV----SLAEAPGFLKAPGGAPANVAIAVTRLGGKSAFVGKLGDDEFGHMLAG
IOLC_LISIN      LITV-GRACIDLNAVEYNRPME-ETMT---FSKYVGGSPANIAIGTAKLGLKVGFIGKISDDQHGRFIEK
IOLC_LISMH      ----------------------------------------------------------------------
IOLC_LISMF      ----------------------------------------------------------------------
IOLC_LISMC      ----------------------------------------------------------------------
YDJE_BACSU      -----------------------DLMEGRQFLKSAGGAPANVSAAIAKLGGDAAFSGKVGKDPFGYFLKR
SCRK_VIBAL      -----------------------------------GGAPANVAVAIARLSGKSAFFGRVGDDPFGRFMQS
IOLC_BACLD      -----------------------------TFSKYVGGSPANIAIGSSKLGLKTGFIGKIPDDQHGRFIET
HLDE_THICR      ------------------------------------GGAANVALNIADLGADVNLMGVIGQDSFGQQLNQ
YURL_BACSU      -----------------------------------GGNALNVAVLAKRLGHESSYIGIVGNDEAAAHLLN
Y356_ARCFU      -----------------------------------------------RLGIETAYIGKVGSDEEGRILLA
HLDE_HAES1      -VLVLGDVMLDRYATNRISPEAPVPVVRVQENEERAGGAANVAMNIASLNVPVRLLGLTGKDEAARALMQ
HLDE_COXBN      ----------------------------------------------------------------------
SCRK3_ARATH     LIVSFGEMLIDFVPTVSGVSSPG-------FLKAPGGAPANVAIAVSRLGGRAAFVGKLGDDDFGHMLAG
IOLC_LISMO      ----------------------------------------------------------------------
Y1544_METTH     -----GHTAFDYIIHLDEFPEPNTSTAIKRMRNLHGGAAANVALVGSRLGLRTSLVSAVGGDFEGSEYRE
IOLC_BACA2      ----------------------------------------------------------------------
HLDE_HAEIE      -VLVLGDVMLDRYATNRISPEAPVPVVRVQENEERAGGAANVAMNIASLNVSVQLMGLIGQDETGSALSL
HLDE_HAEI8      -VLVLGDVMLDRYATNRISPEAPVPVVRVQENEERAGGAANVAMNIASLNVSVQLMGLIGQDETGSALSL
YZ37_SYNY3      ---------------------------------SSGGSAANTLVSLAQLGGTGFYACKVGKDEAGAFYLQ
SCRK_ECOLX      -----------------------------------GGAPANVAVGIARLGGTSGFIGRVGDDPFGALMQR
IOLC_BACSU      ----------------------------------------------------------------------
HLDE_HAEIN      -VLVLGDVMLDRYATNRISPEAPVPVVRVQENEERAGGAANVAMNIASLNVPVQLMGLIGQDETGSALSL
HLDE_HAEIG      -VLVLGDVMLDRYATNRISPEAPVPVVRVQENEERAGGAANVAMNIASLNVPVQLMGLIGQDETGSALSL
HLDE_COXBU      ----------------------------------------------------------------------
HLDE_COXBR      ----------------------------------------------------------------------
HLDE_CITK8      -VMVVGDVMLDRYPTSRISPEPVPVVKVDTIEERPGG-AANVAMNIASLGANSRLVGLTGIDDAARALSK
SCRK1_ARATH     LIVSFGEMLIDFVPTESGV----SLAEAPGFLKAPGGAPANVAIAVSRLGGRSAFVGKLGDDEFGHMLAG
IOLC_BACSK      ----------------------------------------------------------------------
K6PF2_ECOLI     --------------------------TAPVFEPGGGGINVARAIAHLGGSATAPAGGATGEHL-----VS
HLDE_ENT38      -VMVVGDVMLDRYPTSRISPEPVPVVKVDTIEERPGG-AANVAMNIASLGAHSRLVGLTGIDDAARALSK
ADK_DICDI       -----------ILAEDKHLPLYGEIKSGKV-EYIPGGAAQNTSRVCQKDKQTVCYTGCVGTDENATILKT
SCRK2_ARATH     LVVSFGEMLIDFVPT-----ESGVSLSESSFLKAPGGAPANVAIAVSRLGGRAAFVGKLGDDEFGHMLAG
IOLC_PHOPR      ------------------------------FNKFVGGSAANIAVAISKLGGKVGFIGCVADDAFGGYVRG
HLDE_ECOHS      -VMVVGDVMLDRYPTSRISPEPVPVVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARALSK
ADK1_ARATH      -------LNNAILAEDKHLPMYDEMSQKFNVEYIAGGATQNSIKVAQWMGATSYM-GSIGKDKYGEAMKK
HLDE_ENTS8      -VMVVGDVMLDRYPTSRISPEPVPVVKVETIEERPGG-AANVAMNIASLGASSRLVGLTGIDDAARALSQ
IOLC_BACHD      -----------------------------TFSKYVGGSPANIVIGSSKLGLKAGFIGKIADDQHGRFIES
HLDE_SHIFL      -VMVVGDVMLDRYPTSRISPEPVPVVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARALSK
HLDE_SHIF8      -VMVVGDVMLDRYPTSRISPEPVPVVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARALSK
HLDE_SHIDS      -VMVVGDVMLDRYPTSRISPEPVPVVKVNTIEERPGG-AANVAMNITSLGANARLVGLTGIDDAARALSK
HLDE_SHIBS      -VMVVGDVMLDRYPTSRISPEPVPVVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARALSK
HLDE_SHIB3      -VMVVGDVMLDRYPTSRISPEPVPVVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARALSK
HLDE_SALDC      ---------------------PVPVVKVNTVEERPGG-AANVAMNIASLGANVRLVGLTGIDDAARALSK
HLDE_ECOUT      -VMVVGDVMLDRYPTSRISPEPVPVVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARALSK
HLDE_ECOSM      -VMVVGDVMLDRYPTSRISPEPVPVVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARALSK
HLDE_ECOSE      -VMVVGDVMLDRYPTSRISPEPVPVVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARALSK
HLDE_ECOLU      -VMVVGDVMLDRYPTSRISPEPVPVVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARALSK
HLDE_ECOLI      -VMVVGDVMLDRYPTSRISPEPVPVVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARALSK
HLDE_ECOLC      -VMVVGDVMLDRYPTSRISPEPVPVVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARALSK
HLDE_ECOL6      -VMVVGDVMLDRYPTSRISPEPVPVVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARALSK
HLDE_ECOL5      -VMVVGDVMLDRYPTSRISPEPVPVVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARALSK
HLDE_ECOK1      -VMVVGDVMLDRYPTSRISPEPVPVVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARALSK
HLDE_ECODH      -VMVVGDVMLDRYPTSRISPEPVPVVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARALSK
HLDE_ECOBW      -VMVVGDVMLDRYPTSRISPEPVPVVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARALSK
HLDE_ECO8A      -VMVVGDVMLDRYPTSRISPEPVPVVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARALSK
HLDE_ECO81      -VMVVGDVMLDRYPTSRISPEPVPVVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARALSK
HLDE_ECO7I      -VMVVGDVMLDRYPTSRISPEPVPVVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARALSK
HLDE_ECO55      -VMVVGDVMLDRYPTSRISPEPVPVVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARALSK
HLDE_ECO45      -VMVVGDVMLDRYPTSRISPEPVPVVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARALSK
HLDE_ECO27      -VMVVGDVMLDRYPTSRISPEPVPVVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARALSK
HLDE_ECO24      -VMVVGDVMLDRYPTSRISPEPVPVVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARALSK
HLDE_SHISS      ---------------------PVPVVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARALSK
HLDE_ECO5E      ---------------------PVPVVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARALSK
HLDE_ECO57      ---------------------PVPVVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARALSK
SCRK_SALTY      ----------------------------------------------------------------------
SCRK_SALTH      ----------------------------------------------------------------------
IOLC2_BACCZ     -----GRLCVDLNANETQRPMEATR----TFTKYVGGSPANIAIGATRLGLQTGFIGKVSDDQMGRFITR
HLDE_ESCF3      -VMVVGDVMLDRYPTSRISPEPVPVVKVNTIEERPGG-AANVAMNIASLGANARLVGLTGIDDAARALSK
YEII_ECOLI      ---VVGTINMDIRGMAD-IRYPQSASHPGTIHCSAGGVGRNIAHNLALLGRDVHLLSVIGDDFYGEMLLE
LACC_STRPG      -----------------------------------GGKGLNVCRVLNDFGETVKATGCIGGES-GDFIIN
IOLC1_BACCZ     -----------------------------TFTKYVGGSPANIAIGAARLGLQTGFIGKVSDDQMGRFITG
HLDE_VIBPA      ------------------------------------GGAANVAMNIASLGGHAHIVGLTGEDEPAKVLTE
HLDE_KLEP7      ------------------------------------GGAANVAMNIASLGATSRLVGLTGIDDAARALSQ
HLDE_KLEP3      ------------------------------------GGAANVAMNIASLGATSRLVGLTGIDDAARALSQ
LACC_STRA1      ----------------------------------------------------------------------
IOLC_BACHK      ----------------------------------------------------------------------
IOLC_BACC3      ----------------------------------------------------------------------
IOLC_BACAN      ----------------------------------------------------------------------
IOLC_BACAH      ----------------------------------------------------------------------
IOLC_BACAC      ----------------------------------------------------------------------
IOLC_BACAA      ----------------------------------------------------------------------
HLDE_PASMU      -VLVLGDVMLDRYATNRISPEAPVPVVRVQDNEERAGGAANVAMNIAALNVPVKLLGLTGRDETGLALES
ADK2_ARATH      ----------------------------------------------------------------------
LACC_STRA5      ----------------------------------------------------------------------
LACC2_STRA3     ----------------------------------------------------------------------
HLDE_PSE14      -VLVVGDVMLDRYGTSRISPEPVPVVKVDQIEDRPGG-AANVALNIAALGAPASLVGVTGDDEAAESLAN
SCRK5_ARATH     LIVSFGEMLIDFVPDTSGVSLAEST----GFLKAPGGAPANVACAITKLGGKSAFIGKFGDDEFGHMLVN
LACC_STRP8      -----------------------------------GGKGLNVCRVLNDFGETVKATGCIGGES-GDFIIN
HLDE_SALTY      ---------------------PVPVVKVNTVEERPGG-AANVAMNIASLGANARLVGLTGIDDAARALSK
HLDE_SALTI      ---------------------PVPVVKVNTVEERPGG-AANVAMNIASLGANARLVGLTGIDDAARALSK
HLDE_SALSV      ---------------------PVPVVKVNTVEERPGG-AANVAMNIASLGANARLVGLTGIDDAARALSK
HLDE_SALPK      ---------------------PVPVVKVNTVEERPGG-AANVAMNIASLGANARLVGLTGIDDAARALSK
HLDE_SALPC      ---------------------PVPVVKVNTVEERPGG-AANVAMNIASLGANARLVGLTGIDDAARALSK
HLDE_SALPB      ---------------------PVPVVKVNTVEERPGG-AANVAMNIASLGANARLVGLTGIDDAARALSK
HLDE_SALPA      ---------------------PVPVVKVNTVEERPGG-AANVAMNIASLGANARLVGLTGIDDAARALSK
HLDE_SALNS      ---------------------PVPVVKVNTVEERPGG-AANVAMNIASLGANARLVGLTGIDDAARALSK
HLDE_SALHS      ---------------------PVPVVKVNTVEERPGG-AANVAMNIASLGANARLVGLTGIDDAARALSK
HLDE_SALG2      ---------------------PVPVVKVNTVEERPGG-AANVAMNIASLGANARLVGLTGIDDAARALSK
HLDE_SALEP      ---------------------PVPVVKVNTVEERPGG-AANVAMNIASLGANARLVGLTGIDDAARALSK
HLDE_SALCH      ---------------------PVPVVKVNTVEERPGG-AANVAMNIASLGANARLVGLTGIDDAARALSK
HLDE_SALA4      ---------------------PVPVVKVNTVEERPGG-AANVAMNIASLGANARLVGLTGIDDAARALSK
HLDE_SALAR      ---------------------PVPVVKVNTVEERPGG-AANVAMNIASLGANARLVGLTGIDDAARALSK
HLDE_EDWI9      -VLVVGDVMLDRYPTSRISPEPVPVVKVETIEERPGG-AANVAMNIASLGASARLVGLTGVDDAARALST
ADK_PHYPA       ------TLNNAILAEDKHLPMYKELAANPDVEYIAGGATQNTIRIAQGESNATSYFGCVGKDEYGDRMFK
LACC_STRPF      ----------------------------------------------------------------------
HLDE_PSESM      -VLVVGDVMLDRYGTSRISPEPVPVVKVDQIEDRPGG-AANVALNIAALGAPASLVGVTGDDEAAESLTN
SCRK4_ARATH     LIVSFGEMLIDFVPTVSGV----SLADAPGFIKAPGGAPANVAIAISRLGGRAAFVGKLGDDEFGHMLAG
HLDE_SHEHH      -VLVVGDVMLDRYPTARISPEPVPVVKVEQLEDRPGG-AANVAINIATLGGSASLAGIVGEDE-TADALT
SCRK2_MAIZE     ----------------------------------------------------------------------
LACC_STRPC      -----------------------------------GGKGLNVSRVLNDFGETVKATGCVGGES-GDFIIN
LACC_STRPB      -----------------------------------GGKGLNVSRVLNDFGETVKATGCVGGES-GDFIIN
LACC_STRP1      -----------------------------------GGKGLNVSRVLNEFGETVKATGCVGGES-GDFIIN
KHK_HUMAN       -ILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFMGSMAPGHVADFVLD
LACC_STRPM      -----------------------------------GGKGLNVSRVLNDFGETVKATGCIGGES-GDFIIN
LACC_STRPD      -----------------------------------GGKGLNVSRVLNDFGETVKATGCIGGES-GDFIIN
HLDE_PSEPF      ------------------------------------GGAANVALNIAALGAPASLVGVTGDDEAADSLSN
Y057_BUCAP      ----------------------------------------------------------------------
LACC_STRPZ      -----------------------------------GGKGLNVSRVLNDFGETVKATGCIGGES-GDFIIN
HLDE_VIBSL      ----------------------------------------------------------------------
HLDE_AERS4      ----------------------------------------------------------------------
SCRK2_ORYSJ     ----------------------------------------------------------------------
SCRK2_ORYSI     ----------------------------------------------------------------------
FRLD_SHIFL      ----------------------------------------------------------------------
FRLD_ECOLI      ----------------------------------------------------------------------
ADK_MOUSE       --------------------------------------------------------GCIGIDKFGEILKR
LACC_STRP3      -----------------------------------GGKGLNVCRVLNEFGETVKATGCIGGES-GDFIIN
LACC1_STRA3     ----------------------------------------------------------------------
KDGK_BACSU      ----------------------------------------------------------------------
K1PF_BORBU      ----------------------------------------------------------------------
IOLC_LACCA      ----------------------------------------------------------------------
HLDE_PSEU2      -VLVVGDVMLDRYGTSRISPEPVPVVKVDQIEDRPGG-AANVALNIAALGAPASLVGVTGDDEAAESLTN
ADK_RAT         --------------------------------------------------------GCIGIDKFGEILKS
LACC_STRP6      ----------------------------------------------------------------------
HLDE_ACIBL      ----------------------------------------------------------------------
YDJH_ECOLI      ----------------------------ERIAMTTGGDAINEATIISRLGHRTALMSRIGKDAAGQFILD
HLDE_DICNV      --------------------------------TATAGGAANVAMNIAALGGQVYLCGLIGDDDAGAVLRQ
HLDE_SHEPA      -VLVVGDVMLDRYPTARISPEPVPVVKVEQLEDRPGG-AANVAINIATLGGSASLAGIVGVDETADALTV
IOLC_CLOPE      ----------------------------------------------------------------------
IOLC_CLOP1      ----------------------------------------------------------------------
HLDE_METCA      ----------------------------------------------------------------------
HLDE_CAMC1      ----------------------------------------------------------------------
ADK_CRIGR       ----------------------------------------------------------------------
Y060_BUCAI      ----------------------------------------------------------------------
LACC_STRSV      ----------------------------------------------------------------------
LACC_STAHJ      ----------------------------------------------------------------------
K1PF_BACSU      ----------------------------------------------------------------------
HLDE_PSEPG      -VLVVGDVMLDRYGTSRISPEPVPVVKVDQIEDRPGG-AANVALNIAALGAPASLIGVTGQDEAADSLAN
HLDE_PSEF5      ----------------------------------------------------------------------
HLDE_BLOPB      ----------------------------------------------------------------------
LACC_STRMU      ----------------------------------------------------------------------
LACC_CLOPE      ----------------------------------------------------------------------
HLDE_SHEB8      ----------------------------------------------------------------------
HLDE_VIBF1      ------------------------------------GGAANVAMNIAALGGDAHLVGLVGEDEPAQALTT
HLDE_SHESW      ----------------------------------------------------------------------
HLDE_SHEPC      ----------------------------------------------------------------------
HLDE_SHEB9      ----------------------------------------------------------------------
HLDE_SHEB5      ----------------------------------------------------------------------
HLDE_SHEB2      ----------------------------------------------------------------------
YIHV_ECOLI      ----------------------------------------------------------------------
YEGV_ECOLI      -------------------------------SVNVGGCALNIAVALKRLGIEAGNALPLGQGVWAEMIRN
HLDE_VIBFM      ------------------------------------GGAANVAMNIAALGGDAHLVGLVGEDEPAQALTT
HLDE_HAHCH      -VVVVGDVMLDRYATSRISPEPVPVVKVEQLEDRPGG-AANVALNIAALGSAAVILGVTGKDEAAQSLAA
ADK_HUMAN       ----------------------------------------------------------------------
Y1459_PYRHO     MIASIGELLIDLISVEE-----GDLKDVRLFEKHPGGAPANVAVGVSRLGVKSSLISKVGNDPFGEYLIE
KHK_PONAB       ----------------------------------------------------------------------
HLDE_VIBCM      ----------------------------------------------------------------------
HLDE_VIBC3      ----------------------------------------------------------------------
THIED_CORGL     ----------------------------------------------------------------------
HLDE_PSYIN      ----------------------------------------------------VNLIGLVGDDEAANVLVK
HLDE_PSEPW      ----------------------------------------------------------------------
PDXK_RAT        ----------------------------------------------------------------------
PDXK_PIG        ----------------------------------------------------------------------
LACC_STRU0      ----------------------------------------------------------------------
KHK_RAT         ----------------------------------------------------------------------
HLDE_VIBVY      ----------------------------------------------------------------------
HLDE_VIBVU      ----------------------------------------------------------------------
HLDE_PSEU5      ----------------------------------------------------------------------
HLDE_PSEPK      -VLVVGDVMLDRYGTSRISPEPVPVVKVDQIEDRPGG-AANVALNIAALGAPASLIGVTGQDEAADSLAN
HLDE_PSEP1      -VLVVGDVMLDRYGTSRISPEPVPVVKVDQIEDRPGG-AANVALNIAALGAPASLIGVTGQDEAADSLAN
Y406_METJA      ----------------------------------------------------------------------
PDXK_SHIDS      ----------------------------------------------------------------------
LACC_STAAR      ----------------------------------------------------------------------
HLDE_PSEE4      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           LLRDAGTDLSLVKTAPGPTGTAVILIGEGGENMISVIPAANGEVSAFDATKVVGEMDAGDILMLQFEIPX
RBSK_ECOLI      QLATDNIDITPVSVIKGSTGVALIFVNGEGENVIGIHAGANAALSPALVEAQRERIANASALLMQLESPL
RBSK_ECO57      QLATDNIDITPVSVIKGSTGVALIFVNGEGENVIGIHAGANAALSPALVEAQRERIANASALLMQLESPL
RBSK_BACHD      NLAKEGIITDSVKPVTDCTGVATILLSD-RDNRIIVTKGANEHVTPDYVAAFEQELAASDVVLLQLEIPL
RBSK_BACSU      NLKANGVRTDYMEVTHTESGTAHIVLAE-GDNSIVVVKGANDDITPAYALNALEQIEKVDMVLIQQEIPE
RBSK_LACLA      NFKENAVLFENVGTVPQTTGIAQITLYDD-DNRIIIIPGANNEVLPSYLADLWEKIKESQLVILQNEIPH
RBSK_HAEIN      AFAQEGIDTTHINTVSQETGMAFIQVAKSSENSIVLASGANSHLSEMVVRQSEAQIAQSDCLLMQLETPL
RBSK_SCHPO      GLXXXXXXXXXXXXIENKTGVAMIIVEETGENRILLSEGANGNVDTAFVKAMEQRISTCNLLIMQLEIPL
RBSK_YEAST      TLSDCGVDITHVGTYEGNTGTATILIEEGGQNRILIVEGANSK-TIYDPKQLCEIFPEGEYVVFQHEIPD
RBSK_HUMAN      NLKDISTEFT-YQTKDAATGTASIIVNNEGQNIIVIVAGANLLLNTEDLRAAANVISRAKVMVCQLEITP
RBSK_MOUSE      NLKQNHISTEFTQTRDAATGTASIIVNNEGQNIIVIVAGANLFLNSEDLKKAASVISRAKVMICQLEISP
RBSK_DICDI      NFKDKNINCEFVSVVSNPSGCATXXXXXXXXXXXXXXXXXXXLLNEKDVDNAKSQIQNSSLLLCQLEVSN
SCRK2_SOLLC     ILKTNGVQAEGINFDKGATALAFVTLRADGERMFYRNPSADGSISLIVEPCRAAHMKAMEVALLSYDPNL
SCRK2_SOLHA     ILKTNGVQADGINFDKGATALAFVTLRADGERMFYRNPSADGSISLIVEPCRAAHMKAMEVALLSYDPNL
SCRK1_ORYSJ     ----------------------------------------------------------------------
SCRK1_ORYSI     ----------------------------------------------------------------------
HLDE_MANSM      LLQTQKIDCDFVRLATHPTITKLRILSRHQQLLRLDFEEDFKNVQSTELTKLENAVKNFGALILSDYGKG
SCRK1_MAIZE     ----------------------------------------------------------------------
SCRK_SOLTU      ILKTNGVQADGINFDKGATALAFVTLRADGERMFYRNPSADMLLTPLDLIRSAKVFHYGSISLI------
IOLC_LISIN      YMRDLNTDGMVKDTAGRKVGLAFTEIKSPEE--CSILMYRENVADLYLTPEEISEDYIKETRVLLVQSPS
IOLC_LISMH      ----------------------------------------------------------------------
IOLC_LISMF      ----------------------------------------------------------------------
IOLC_LISMC      ----------------------------------------------------------------------
YDJE_BACSU      TLDAVHVDTSLVMDEKAPTTLAFVSLKQNGERDF----VFNRGADALFTLEDIDQEKLNEAKILHFGSAT
SCRK_VIBAL      ILDQEGVCTELIKDPEQRTSTVVVDLDDQGERSFTVKPSADQFMSVED----MGNFKQGDWLHV------
IOLC_BACLD      YMRNTGVDTSQMAVKAGLAFTEILSPEECSILMVADLYLAPSEVNEDYIAKSKMLLVSGTALAKSPSREA
HLDE_THICR      VLEQAGVASNWVYSESG-TICKLRVLSHHQQLIRMDFENAVPELSAKSLAKLVAEKVADDVLVISDYAKG
YURL_BACSU      VLKLEQVNADYIRQAHGENGMAIVTLDEQGDRIF--VRSNKGGIQAFQE-KDVSFISGHDLLH-------
Y356_ARCFU      DFEREGVSTDFVIRAEGRSGTAMIFVDEKGNRAILVDPGVNDTI-AYDEIDVDSARKYDLIHLTSF----
HLDE_HAES1      LLEKQSIHCDFTQLDSHPTITKLRILSRHQQLLLDFEEDFNNITSADLLRKLESAVQNYGALILSDYGKG
HLDE_COXBN      ----------------------------------------------------------------------
SCRK3_ARATH     ILRKNGVDDQGINFDEGATALAFVTLRSDGEGSISLIPCRSAHMKAMEVAKEAG-------ALLSYDPNL
IOLC_LISMO      ----------------------------------------------------------------------
Y1544_METTH     LLESSGIDISMILVADESTPTAFVMT-DSDHNQISYFYW--GAARYFDAETPADAIKSARAVHLATGDPS
IOLC_BACA2      ----------------------------------------------------------------------
HLDE_HAEIE      LLEKQKIDCNFVALETHPTITKLRILSRHQQLLRLDFEEDFNNVDCKDLAKLESAVKNYGALILSDYGKG
HLDE_HAEI8      LLEKQKIDCNFVALETHPTITKLRILSRHQQLLRLDFEEDFNNVDCKDLAKLESAVKNYGALILSDYGKG
YZ37_SYNY3      DLNDCGLDTNPHHETAGE--------GITGKCLVFVTPDADRTMNAFSGSLSVTEMDWSALKQSQYPSXX
SCRK_ECOLX      TLLTEGVDITYLKQDEWHTSTVLVDLNDQGERSFTFMVRPSADL--FLETTDLPCWRHGEWLHL---CSI
IOLC_BACSU      ----------------------------------------------------------------------
HLDE_HAEIN      LLEKQKIDCNFVALETHPTITKLRILSRHQQLLRLDFEEDFNNVDCKDLAKLESAVKNYGALILSDYGKG
HLDE_HAEIG      LLEKQKIDCNFVALETHPTITKLRILSRHQQLLRLDFEEDFNNVDCKDLAKLESAVKNYGALILSDYGKG
HLDE_COXBU      ----------------------------------------------------------------------
HLDE_COXBR      ----------------------------------------------------------------------
HLDE_CITK8      TLADVNVKCDFVSVPTHPTITKLRVLSEGFEGVDPLINQALGSIGAL----VLSDYAKGALASVQQMIQL
SCRK1_ARATH     ILRKNGVD--------------------------------------------------------------
IOLC_BACSK      ----------------------------------------------------------------------
K6PF2_ECOLI     LLADENVPVATVEAKDWTRQNLHVHVEASGEQYRFVMPAALNEDEFRQLEEQVLEIESGAILVISGSLPP
HLDE_ENT38      TLADVNVKCDFVSVPTHPTITKLRVLGVDPEPMHERIAQALGSIGAL----VLSDYAKGALASVQQMIQL
ADK_DICDI       ATESNGVVTKYQVDSSAPTGACAVLINHKERSMVTNLGAANNKIAHFQTEEMKAIVNSAQFFYLVGYFPD
SCRK2_ARATH     ILRKNDVDDQGINFDKGATALAFVTLRSDGERSISLIPCRSAHMKAMEVAKEAGAL-------LSYDPNL
IOLC_PHOPR      YMTEQGINLDGMMTDNSGSRTSVAFT-EMKPNDCTVLIYRN---KASDLTLKPEQVDPAYIAQSKMESPS
HLDE_ECOHS      SLADVNVKCDFVSVPTHPTITKLRVLSRNQEGFEGVDPQPNQALSSIGAL-VLSDYAKGALASVQQMIQL
ADK1_ARATH      DATAAGVYVHYYEDEATPTGTCGVCVLGGERSLIANLSAANEHLKKPENWALVEKAKAGFFLTVS---PE
HLDE_ENTS8      SLAQVNVKCDFVSVPTHPTITKLRVLGVDPEPLHERINQALGQIGAL----VLSDYAKGALASVQQMIQL
IOLC_BACHD      YMRGVGVDTSVVDQEGHKTGLAFTEIKSPEE--CSILMYRQDVADLYLSPEEVNELVSGTALSKSPSREA
HLDE_SHIFL      SLADVNVKCDFVSVPTHPTITKLRVLSRNQEGFEGVDPQPNQALSSIGAL-VLSDYAKGALASVQQMIQL
HLDE_SHIF8      SLADVNVKCDFVSVPTHPTITKLRVLSRNQEGFEGVDPQPNQALSSIGAL-VLSDYAKGALASVQQMIQL
HLDE_SHIDS      SLADVNVKCDFVSVPTHPTITKLRVLSRNQEGFEGVDPQPNQALSSIGAL-VLSDYAKGALASVQQMIQL
HLDE_SHIBS      SLADVNVKCDFVSVPTHPTITKLRVLSRNQEGFEGVDPQPNQALSSIGAL-VLSDYAKGALASVQQMIQL
HLDE_SHIB3      SLADVNVKCDFVSVPTHPTITKLRVLSRNQEGFEGVDPQPNQALSSIGAL-VLSDYAKGALASVQQMIQL
HLDE_SALDC      TLAEVNVKCDFVSVPTHPTITKLRVLSEGGDPLHERINQALGSIGAL----VLSDYAKGALTSVQTMISL
HLDE_ECOUT      SLADVNVKCDFVSVPTHPTITKLRVLSRNQEGFEGVDPQPNQALSSIGAL-VLSDYAKGALASVQQMIQL
HLDE_ECOSM      SLADVNVKCDFVSVPTHPTITKLRVLSRNQEGFEGVDPQPNQALSSIGAL-VLSDYAKGALASVQQMIQL
HLDE_ECOSE      SLADVNVKCDFVSVPTHPTITKLRVLSRNQEGFEGVDPQPNQALSSIGAL-VLSDYAKGALASVQQMIQL
HLDE_ECOLU      SLADVNVKCDFVSVPTHPTITKLRVLSRNQEGFEGVDPQPNQALSSIGAL-VLSDYAKGALASVQQMIQL
HLDE_ECOLI      SLADVNVKCDFVSVPTHPTITKLRVLSRNQEGFEGVDPQPNQALSSIGAL-VLSDYAKGALASVQQMIQL
HLDE_ECOLC      SLADVNVKCDFVSVPTHPTITKLRVLSRNQEGFEGVDPQPNQALSSIGAL-VLSDYAKGALASVQQMIQL
HLDE_ECOL6      SLADVNVKCDFVSVPTHPTITKLRVLSRNQEGFEGVDPQPNQALSSIGAL-VLSDYAKGALASVQQMIQL
HLDE_ECOL5      SLADVNVKCDFVSVPTHPTITKLRVLSRNQEGFEGVDPQPNQALSSIGAL-VLSDYAKGALASVQQMIQL
HLDE_ECOK1      SLADVNVKCDFVSVPTHPTITKLRVLSRNQEGFEGVDPQPNQALSSIGAL-VLSDYAKGALASVQQMIQL
HLDE_ECODH      SLADVNVKCDFVSVPTHPTITKLRVLSRNQEGFEGVDPQPNQALSSIGAL-VLSDYAKGALASVQQMIQL
HLDE_ECOBW      SLADVNVKCDFVSVPTHPTITKLRVLSRNQEGFEGVDPQPNQALSSIGAL-VLSDYAKGALASVQQMIQL
HLDE_ECO8A      SLADVNVKCDFVSVPTHPTITKLRVLSRNQEGFEGVDPQPNQALSSIGAL-VLSDYAKGALASVQQMIQL
HLDE_ECO81      SLADVNVKCDFVSVPTHPTITKLRVLSRNQEGFEGVDPQPNQALSSIGAL-VLSDYAKGALASVQQMIQL
HLDE_ECO7I      SLADVNVKCDFVSVPTHPTITKLRVLSRNQEGFEGVDPQPNQALSSIGAL-VLSDYAKGALASVQQMIQL
HLDE_ECO55      SLADVNVKCDFVSVPTHPTITKLRVLSRNQEGFEGVDPQPNQALSSIGAL-VLSDYAKGALASVQQMIQL
HLDE_ECO45      SLADVNVKCDFVSVPTHPTITKLRVLSRNQEGFEGVDPQPNQALSSIGAL-VLSDYAKGALASVQQMIQL
HLDE_ECO27      SLADVNVKCDFVSVPTHPTITKLRVLSRNQEGFEGVDPQPNQALSSIGAL-VLSDYAKGALASVQQMIQL
HLDE_ECO24      SLADVNVKCDFVSVPTHPTITKLRVLSRNQEGFEGVDPQPNQALSSIGAL-VLSDYAKGALASVQQMIQL
HLDE_SHISS      SLADVNVKCDFVSVPTHPTITKLRVLSRNQEGFEGVDPQPNQALSSIGAL-VLSDYAKGALASVQQMIQL
HLDE_ECO5E      SLADVNVKCDFVSVPTHPTITKLRVLSRNQEGFEGVDPQPNQALSSIGAL-VLSDYAKGALASVQQMIQL
HLDE_ECO57      SLADVNVKCDFVSVPTHPTITKLRVLSRNQEGFEGVDPQPNQALSSIGAL-VLSDYAKGALASVQQMIQL
SCRK_SALTY      ----------------------------------------------------------------------
SCRK_SALTH      ----------------------------------------------------------------------
IOLC2_BACCZ     YLQDINTDQICIDRTGAVTGLAFTEI-KSPEDCSILMYRDNVADLNLDPTEVSEDIKQSKALLISAKSPS
HLDE_ESCF3      SLADVNVKCDFVSVPTHPTITKLRVLSRNQEGFEGVDPQPNQALSSIGAL-VLSDYAKGALASVQQMIQL
YEII_ECOLI      ETRRAGVNVSGCVRLHGQSTSTYLAIANRDDQTVLAINDTH-LLEQLTPQLLNGSRDAGVVLA---DCNL
LACC_STRPG      HLPDS--ILSRFYKISGDTRTCIVILHEGNQTEILEVEEIDGFTHHFDVVTLSGSLPAG--------MPD
IOLC1_BACCZ     YLKDINTDQIRIDCTGAVTGLAFTEI-KSPEDCSILMYRDNVADLNLDPTEVSEDIKQSKALLISAKSPS
HLDE_VIBPA      TLSALNVKCDFVALPDYPTITKLRVMSRG-QQLIRL--DFEDKFENTDATPVLSRMDAAKAVIMSDYAKG
HLDE_KLEP7      ALANVNVKCDFVSVPTHPTITKLRVLGVDPQPMHERIQQALGSIGAL----VLSDYAKGALTSVQTMI--
HLDE_KLEP3      ALANVNVKCDFVSVPTHPTITKLRVLGVDPQPMHERIQQALGSIGAL----VLSDYAKGALTSVQTMIKL
LACC_STRA1      ----------------------------------------------------------------------
IOLC_BACHK      ----------------------------------------------------------------------
IOLC_BACC3      ----------------------------------------------------------------------
IOLC_BACAN      ----------------------------------------------------------------------
IOLC_BACAH      ----------------------------------------------------------------------
IOLC_BACAC      ----------------------------------------------------------------------
IOLC_BACAA      ----------------------------------------------------------------------
HLDE_PASMU      LLAKSRIECDFVQLHTHPTITKLRILSEDFQNVTSLLQKLDSALQNYGAL-VLSDYGKGTLNQVQKMIQL
ADK2_ARATH      ----------------------------------------------------------------------
LACC_STRA5      ----------------------------------------------------------------------
LACC2_STRA3     ----------------------------------------------------------------------
HLDE_PSE14      SLKAAGVLARFQRIANQPTIVKLRVISRHQQLLIDFEEAFNTDPLALSA-EVYSLLDGIKVLVLSDYGKG
SCRK5_ARATH     ILKKNGVNSEGVCDTNARTALAFVTLKKDGERMFYRNPSADAKIFHYGSISLISEKDAG--VLLSYDPNV
LACC_STRP8      HLPDS--ILSRFYKISGDTRTCIAILHEGNQTEILEVEEIDGFTHHFDVVTLSGSLPAG--------MPD
HLDE_SALTY      TLAEVNVKCDFVSVPTHPTITKLRVLSEGFEGLHERINQALGSIGAL----VLSDYAKGALTSVQTMISL
HLDE_SALTI      TLAEVNVKCDFVSVPTHPTITKLRVLSEGFEGLHERINQALGSIGAL----VLSDYAKGALTSVQTMISL
HLDE_SALSV      TLAEVNVKCDFVSVPTHPTITKLRVLSEGFEGLHERINQALGSIGAL----VLSDYAKGALTSVQTMISL
HLDE_SALPK      TLAEVNVKCDFVSVPTHPTITKLRVLSEGFEGLHERINQALGSIGAL----VLSDYAKGALTSVQTMISL
HLDE_SALPC      TLAEVNVKCDFVSVPTHPTITKLRVLSEGFEGLHERINQALGSIGAL----VLSDYAKGALTSVQTMISL
HLDE_SALPB      TLAEVNVKCDFVSVPTHPTITKLRVLSEGFEGLHERINQALGSIGAL----VLSDYAKGALTSVQTMISL
HLDE_SALPA      TLAEVNVKCDFVSVPTHPTITKLRVLSEGFEGLHERINQALGSIGAL----VLSDYAKGALTSVQTMISL
HLDE_SALNS      TLAEVNVKCDFVSVPTHPTITKLRVLSEGFEGLHERINQALGSIGAL----VLSDYAKGALTSVQTMISL
HLDE_SALHS      TLAEVNVKCDFVSVPTHPTITKLRVLSEGFEGLHERINQALGSIGAL----VLSDYAKGALTSVQTMISL
HLDE_SALG2      TLAEVNVKCDFVSVPTHPTITKLRVLSEGFEGLHERINQALGSIGAL----VLSDYAKGALTSVQTMISL
HLDE_SALEP      TLAEVNVKCDFVSVPTHPTITKLRVLSEGFEGLHERINQALGSIGAL----VLSDYAKGALTSVQTMISL
HLDE_SALCH      TLAEVNVKCDFVSVPTHPTITKLRVLSEGFEGLHERINQALGSIGAL----VLSDYAKGALTSVQTMISL
HLDE_SALA4      TLAEVNVKCDFVSVPTHPTITKLRVLSEGFEGLHERINQALGSIGAL----VLSDYAKGALTSVQTMISL
HLDE_SALAR      TLAEFNVKCDFVSVPTHPTITKLRVLGVDPEPLHERINQALGSIGAL----VLSDYAKGALTSVQTMIAL
HLDE_EDWI9      RLDEVHVECDFVAIPAQPTITKLRVLSR------------NQQLIRLDFEEGFGGVDPGPILARIRQALP
ADK_PHYPA       LASEGGVNIRYDVDEDLPTGTCGVLVVKGERSLVANLSAANKENWAF-VEKAKYIYSAGFFLTVS---PE
LACC_STRPF      ----------------------------------------------------------------------
HLDE_PSESM      SLKAAGVVARFQRIADQPTIVKLRVMSRHQQLLIDFEEPFNTDPLALSA-EVYSLLDGIKVLVLSDYGKG
SCRK4_ARATH     ILKQNGVSAEGINFDTGATALAFVTLRSDGE---------------------------------------
HLDE_SHEHH      LIQTLGVEPNWHKVAGKPTITKLRVMSRNQQLLLDFEESYTQAESEALLAKTLPELDKVDVAVLSDYAKG
SCRK2_MAIZE     ----------------------------------------------------------------------
LACC_STRPC      HLPDS--ILSRFYKISGDTRTCIAILHEGNQTEILEVDEIDGFTHQFDVVTMSGSLPAG--------MPD
LACC_STRPB      HLPDS--ILSRFYKISGDTRTCIAILHEGNQTEILEVDEIDGFTHQFDVVTMSGSLPAG--------MPD
LACC_STRP1      HLPDS--ILSRFYKISGDTRTCIAILHEGNQTMLSV-----DEIDGFDVVTLSGSLPAG--------MPD
KHK_HUMAN       DLRRYSVDLRYVFQTTGSVPIATVIINEAGSRTILYYDRSLPDVSATDFEKVEGRNASEQVKMLQ-----
LACC_STRPM      HLPDS--ILSRFYKISGDTRTCIAILHEGNQTEILEVDEIDGFTHHFDVVTLSGSLPAG--------MPD
LACC_STRPD      HLPDS--ILSRFYKISGDTRTCIAILHEGNQTEILEVDEIDGFTHHFDVVTLSGSLPAG--------MPD
HLDE_PSEPF      SLKGAGVRALFQRIAHQPTIVKLRVMSRHQQ----LLRIDFEEPFATDALALGAQVD--DLL----EGIK
Y057_BUCAP      ----------------------------------------------------------------------
LACC_STRPZ      HLPDS--ILSRFYKISGDTRTCIAILHEGNQTEILEVDEIDGFTHHFDVVTLSGSLPAG--------MPD
HLDE_VIBSL      ----------------------------------------------------------------------
HLDE_AERS4      ----------------------------------------------------------------------
SCRK2_ORYSJ     ----------------------------------------------------------------------
SCRK2_ORYSI     ----------------------------------------------------------------------
FRLD_SHIFL      ----------------------------------------------------------------------
FRLD_ECOLI      ----------------------------------------------------------------------
ADK_MOUSE       KAADAHVDAHYYEQNEQPTGTCAACITGGNRSLVANLAAAN----CYKKEKHL-DLERNWVLVEKARVPE
LACC_STRP3      HLPDS--ILSRFYKISGYTRTCIAILHEGNQTMLSV-----DEIDGFDVVTLSGSLPAG--------MPD
LACC1_STRA3     ----------------------------------------------------------------------
KDGK_BACSU      ----------------------------------------------------------------------
K1PF_BORBU      ----------------------------------------------------------------------
IOLC_LACCA      ----------------------------------------------------------------------
HLDE_PSEU2      SLKAAGVLARFQRIADQPTIVKLRVMSRHQQLLIDFEEPFRTDPLALSA-EVYSLLDGIKVLVLSDYGKG
ADK_RAT         KAADAHVDAHYYEQNEQPTGTCAACITGGNRSLVANLAAANCENNWMLVEKARVYYIAGFFLTVS---PE
LACC_STRP6      ----------------------------------------------------------------------
HLDE_ACIBL      ----------------------------------------------------------------------
YDJH_ECOLI      HCRKENIDISLKQDVSIDTSINVGLVTEDGER--TFVTNRNGSLWKLNIDDVFARFSQAKLLSLAFNSPL
HLDE_DICNV      IMREHAIGDALSVCAL-PTITKLRVLSQH-QQLIRLDFESNAECAHLMAVPFNRALPEHDLVIFSDYGKG
HLDE_SHEPA      GVRALGVEPNWHKVADKPTITKLRVMSRNQQLLRLDFEESYSQAES-DAAQSLSELDKVDVAVLSDYAKG
IOLC_CLOPE      ----------------------------------------------------------------------
IOLC_CLOP1      ----------------------------------------------------------------------
HLDE_METCA      ----------------------------------------------------------------------
HLDE_CAMC1      ----------------------------------------------------------------------
ADK_CRIGR       ----------------------------------------------------------------------
Y060_BUCAI      --------------------------------------------------KIIDSISSFKILVLSDYAKG
LACC_STRSV      ----------------------------------------------------------------------
LACC_STAHJ      ----------------------------------------------------------------------
K1PF_BACSU      ----------------------------------------------------------------------
HLDE_PSEPG      SLQAAGVRSVFQRIAHQPTIVKLRVMSRH-QQLLRIDPFATDPLSL--ATEVDSLLEGVKVLVLSDYGKG
HLDE_PSEF5      ----------------------------------------------------------------------
HLDE_BLOPB      ----------------------------------------------------------------------
LACC_STRMU      ----------------------------------------------------------------------
LACC_CLOPE      ----------------------------------------------------------------------
HLDE_SHEB8      ----------------------------------------------------------------------
HLDE_VIBF1      TLESLKVHCDFVALPEFPTITKLRVMSRGQQLIVAAEPIISRMQQALSSVKVLSDYAKGALEHVQLMIQE
HLDE_SHESW      ----------------------------------------------------------------------
HLDE_SHEPC      ----------------------------------------------------------------------
HLDE_SHEB9      ----------------------------------------------------------------------
HLDE_SHEB5      ----------------------------------------------------------------------
HLDE_SHEB2      ----------------------------------------------------------------------
YIHV_ECOLI      ----------------------------------------------------------------------
YEGV_ECOLI      RMAKEGL-ISLIDNAEGDNGWCLALVEPDGERTLARLTVAPGSLLYFSGYQLASP--CGELLVEWLE---
HLDE_VIBFM      TLESLKVHCDFVALPEFPTITKLRVMSRGQQLIRLDFEDSFHDVAAEPISRMQQALSSVKAVVLSDYAKG
HLDE_HAHCH      RMESAGADFQEHETLPTITKLRVILIRMDFEESFAGVPQEQLEKKXXXXXXXXXXXXXSDYGKGALRDPQ
ADK_HUMAN       ----------------------------------------------------------------------
Y1459_PYRHO     ELSKENVDTGIVKDEKKHTGIVFVQLKGASPSFLLYDDVAYFNMTLNDINWDIVEVNFGSVILARNPSRE
KHK_PONAB       ----------------------------------------------------------------------
HLDE_VIBCM      ----------------------------------------------------------------------
HLDE_VIBC3      ----------------------------------------------------------------------
THIED_CORGL     ----------------------------------------------------------------------
HLDE_PSYIN      NLKSVHVNTDFVSVPNFPTITKLRVLSR--HQQLLRLDFEEG-FEGIDSTDILEKMHASSVVILSDYNKG
HLDE_PSEPW      ----------------------------------------------------------------------
PDXK_RAT        ----------------------------------------------------------------------
PDXK_PIG        ----------------------------------------------------------------------
LACC_STRU0      ----------------------------------------------------------------------
KHK_RAT         ----------------------------------------------------------------------
HLDE_VIBVY      ----------------------------------------------------------------------
HLDE_VIBVU      ----------------------------------------------------------------------
HLDE_PSEU5      ----------------------------------------------------------------------
HLDE_PSEPK      SLQAAGVRSVFQRIAHQPTIVKLRVMSRHQQ----LLRIDFEEPFATDPLSLGAEVDSVKVLVLSDYGKG
HLDE_PSEP1      SLQAAGVRSVFQRIAHQPTIVKLRVMSRHQQ----LLRIDFEEPFATDPLSLGAEVDSVKVLVLSDYGKG
Y406_METJA      ----------------------------------------------------------------------
PDXK_SHIDS      ----------------------------------------------------------------------
LACC_STAAR      ----------------------------------------------------------------------
HLDE_PSEE4      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           XXXXXXXXXXXXKRITTVINTAPLTADGPRLAGLADIVIANETEFELLIGKNGLSSGERESELKALHDRT
RBSK_ECOLI      ESVMAAAKIAHQNKTIVALNPAPARELPDELLALVDIITPNETEAEKLTGIRVENDEDAAKAAQVLHEKG
RBSK_ECO57      ESVMAAAKIAHQNKTIVALNPAPARELPDELLALVDIITPNETEAEKLTGIRVENDEDAAKAAQVLHEKG
RBSK_BACHD      ETVAYVLEFCAKHHVTTVLNPAPAQKLPDAAWTDATYISPNENECLQLFG------DEPDANLR------
RBSK_BACSU      ETVDEVCKYCHSHDIPIILNPAPARPLKQETIDHATYLTPNEHEASILFPELTI------SEALALYP--
RBSK_LACLA      ETNLAIAKFCKENAIKVLYNPAPARKTDLEMIDFVDYITPNEHECKELFPNLAL-----EEILKKYSNR-
RBSK_HAEIN      SGVELAAQIAKKNGVKVVLNPAPAQXXXXXXXXXXXXXTPNETEAEIL---TGVEVADEQSAVKAFHDKG
RBSK_SCHPO      EAVEIALQIAHKHGVDVLMNPAPAIPLSHDMISYCAYLVPNEHEAAILLNQADSPATLENVDAKLLSFGV
RBSK_YEAST      PLSIIKWIHANRPNFQIVYNPSPFKAMPKKDWELVDLLVVNEIEGLQIVESNELVEEIREKELKLMNRKK
RBSK_HUMAN      ATSLEALTMARRSGVKTLFNPAPAIADDPQFYTLSDVFCCNESEAEILTGLTVGSAADAGEAALVLLKRG
RBSK_MOUSE      AASLEALTMARRSGVKTLFNPAPAMADDPQFYTLSSIFCCNESEAEILTGHAVSDPTTAGKAAMILLERG
RBSK_DICDI      VTLHALKIAKESNKCKTMLNLTPINNDPLEMFKFVDILIVNEIE---LIGXXXXXXXXXXXQLMEMCDEN
SCRK2_SOLLC     RLPLWPSAEEAKKQIKSIWDSA-------------DVIKVSDVELEFLTGSNKIDD---ESAMSLWHPNL
SCRK2_SOLHA     RLPLWPSAEEAKKQIKSIWDSA-------------DVIKVSDVELEFLTGSNKIDD---ESAMSLWHPNL
SCRK1_ORYSJ     ----------------------------------ADIVKVSEVELEFL---TGIDSVEDDVVMK-LWRPT
SCRK1_ORYSI     ----------------------------------ADIVKVSEVELEFL---TGIDSVEDDVVMK-LWRPT
HLDE_MANSM      TLNDVQQMIQIARKAKVPVLIDPKGTDFERYRG-ATLLTPNMSEFEAVVGKCDTEEDIIEKGLKLIADIE
SCRK1_MAIZE     ----------------------------------ADIVKVSEVELEFL---TGIDSVEDDVVMK-LWRPT
SCRK_SOLTU      ---VEPCRSAHLKAMEVAKEAGALLSYDPNLAEARKAIKVSDVELEFLTGSDKIDD---ESAMSLWHPNL
IOLC_LISIN      REAVLKAVHLAQKNDVIVANTEETAVYYSLVAEQADVIIGTRDEFDMMENQIG---GNNEMTIDNLFKHK
IOLC_LISMH      ------------------------------VAEQADVIIGTRDEFDMMENQVG---GKNEATKAHLFQHQ
IOLC_LISMF      ------------------------------VAEQADVIIGTRDEFDMMENQVG---GKNEATKAHLFQHQ
IOLC_LISMC      ------------------------------VAEQADVIIGTRDEFDMMENQVG---GKNEATKAHLFQHQ
YDJE_BACSU      ALLSDPFCSAYLRLMSIAKDNGQFISFDPKAIAVSDFVKVSDEELEIISGVK-----DHEKGVAILHEIG
SCRK_VIBAL      ---CSISLANEPSRSSTFEAIKRAKAAGGFISNLRDEVWQDQSEIQXXXXXXXXXXXXXEEELLFLTDST
IOLC_BACLD      VLKAVQLAKKHQVKVVFELDYRPYTWTSAEVAEQSDIVIGTRDEFDVMENKSG---GSNEESVQHLFAHS
HLDE_THICR      ALQFVEEMIQAAKSQQVPVLIDPKGNDFSRYAG-ATLVKPNQGEFELIVGVCADQDDLIEKAKQLIQEIN
YURL_BACSU      ---------------TSVYSR--LENDLPQLCGLVPVSFDFSTNREAFFSGSDLSESECGELAKTAHGYG
Y356_ARCFU      ICKNGLDSLNSQKRIVEEFDSVSFDPGMPYARGLGDIFLPNRQEIEMLFSEDYRTAAERCIEMGI-----
HLDE_HAES1      TLNDVQKMIQIARKVNIPVLIDPKGTDFARYRS-ATLLTPNMSEFEAVVGKCHSEEEIAEKGLQLIKDLD
HLDE_COXBN      ----------------------PKSVDFSRYAG-ATLLTPNLKEFEAVVG-HCRTDQELESKARALHQYR
SCRK3_ARATH     REPLWPSPEEARTQIMSIWDKA-------------DIIKVSDVELEFL------------TENKTMDDKT
IOLC_LISMO      ------------------------------VAEQADVIIGTRDEFDMMENQVG---GKNEATKAYLFQHQ
Y1544_METTH     FNCRCGEFARSLGKIISFDPGQDLRSQLERAVGVCDILFGNHHEIDRICSKLSV-------DIHGLREMG
IOLC_BACA2      ------------------------------VAEQSDIVIGTRDEFDVMENRSG---GGNDETVRHLFAHS
HLDE_HAEIE      TLKDVQKMIQIARKANVPVLIDPKGTDFERYRG-ATLLTPNMSEFEAVVGKCNTEEEIIKKGLKLISDIE
HLDE_HAEI8      TLKDVQKMIQIARKANVPVLIDPKGTDFERYRG-ATLLTPNMSEFEAVVGKCNTEEEIIKKGLKLISDIE
YZ37_SYNY3      XXXXXXXXXXXQSGVKTCLNMAKFFQDGLKLGSGVDLLFANEAEALEMAGTSDLN------QAIAYCKSI
SCRK_ECOLX      ALSAEPSRTSAFTAMTAIRHAGGFVSFDPNIRXXXDVVKLSEEEWRLISGKT-----QNDRDICALKEYE
IOLC_BACSU      ------------------------------VAEQSDIVIGTRDEFDVMENRTG---GSNEESVNHLFGHS
HLDE_HAEIN      TLKDVQKMIQIARKANVPVLIDPKGTDFERYRG-ATLLTPNMSEFEAVVGKCNTXXXXXXKGLKLISDIE
HLDE_HAEIG      TLKDVQKMIQIARKANVPVLIDPKGTDFERYCG-ATLLTPNMSEFEAVVGKCNTEEEIIKKGLKLISDIE
HLDE_COXBU      ----------------------PKSVDFSRYAG-ATLLTPNLKEFEAVVGH---CRTDQELEFKAIHQYR
HLDE_COXBR      ----------------------PKSVDFSRYAG-ATLLTPNLKEFEAVVGH---CRTDQELEFKAIHQYR
HLDE_CITK8      A-----------RKAGVPVLIDPKGTDFERYRG-ATLLTPNLSEFEAVAGKCKSEEEIVERGMKLIADFE
SCRK1_ARATH     ----------------------------------AEIIKVSDVELEFLTGSNKIDD---ETALTLWHPNL
IOLC_BACSK      ------------------------------LAGMAHIVIGTREEYDIM---EGASASGNEQTAKMLFAKE
K6PF2_ECOLI     GVKLEKLTQLISQGIRCIVDSSGEALSAALAIGNIELVKPNQKELSALVNRELTQPDDRKAAQEIVNSGK
HLDE_ENT38      A-----------RKAGVPVLIDPKGTEFERYRG-ATLLTPNLSEFEAVAGKCKNEEEIVERGMKIIADFD
ADK_DICDI       SAVHLGKHAAENDKPFLYGLAAPFLIDFSELLPYVDIVFANESEAATLWGEDLTVIAEKLAAWEKVNTKR
SCRK2_ARATH     REPLWPSPEEARKQIMSIWDKA-------------DIIKVSDVELEFLTGNKTIDD---ETAMSLWHPNL
IOLC_PHOPR      REATLIAMEHARRSNTVVVLDVDYRPYSWRTAGLSDIVIGNREEFDMM--ETVLAPGNTDDDATADRFLR
HLDE_ECOHS      A-----------RKAGVPVLIDPKSTDFERYRG-ATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIADYE
ADK1_ARATH      SIQLVREHAAANNKVFTMNLSAPFICEQEKCLPYMDYIFGNETEARTFSRVHGWETDDVESQLPKASGTY
HLDE_ENTS8      A-----------RKAGVPVLIDPKGTDFERYRG-ATLLTPNLSEFEAVAGKCKTEQDIVERGMKIIADFD
IOLC_BACHD      VLKAIRLAKRNDVKVVFELDYRPYSWETPEVAEQSDIVIGTREEFDVL--ENRTEKGDNDETIRYLFKHS
HLDE_SHIFL      A-----------RKAGVPVLIDPKGTDFERYRG-ATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIADYE
HLDE_SHIF8      A-----------RKAGVPVLIDPKGTDFERYRG-ATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIADYE
HLDE_SHIDS      A-----------RKAGVPVLIDPKGTDFERYRG-ATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIADYE
HLDE_SHIBS      A-----------RKAGVPVLIDPKGTDFERYRG-ATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIADYE
HLDE_SHIB3      A-----------RKAGVPVLIDPKGTDFERYRG-ATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIADYE
HLDE_SALDC      A-----------RQAGVPVLIDPKGTDFERYRG-ATLLTPNLSEFEAVAGKCKSEDELVERGMKLIADYD
HLDE_ECOUT      A-----------RKAGVPVLIDPKGTDFERYRG-ATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIADYE
HLDE_ECOSM      A-----------RKAGVPVLIDPKGTDFERYRG-ATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIADYE
HLDE_ECOSE      A-----------RKAGVPVLIDPKGTDFERYRG-ATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIADYE
HLDE_ECOLU      A-----------RKAGVPVLIDPKGTDFERYRG-ATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIADYE
HLDE_ECOLI      A-----------RKAGVPVLIDPKGTDFERYRG-ATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIADYE
HLDE_ECOLC      A-----------RKAGVPVLIDPKGTDFERYRG-ATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIADYE
HLDE_ECOL6      A-----------RKAGVPVLIDPKGTDFERYRG-ATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIADYE
HLDE_ECOL5      A-----------RKAGVPVLIDPKGTDFERYRG-ATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIADYE
HLDE_ECOK1      A-----------RKAGVPVLIDPKGTDFERYRG-ATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIADYE
HLDE_ECODH      A-----------RKAGVPVLIDPKGTDFERYRG-ATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIADYE
HLDE_ECOBW      A-----------RKAGVPVLIDPKGTDFERYRG-ATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIADYE
HLDE_ECO8A      A-----------RKAGVPVLIDPKGTDFERYRG-ATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIADYE
HLDE_ECO81      A-----------RKAGVPVLIDPKGTDFERYRG-ATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIADYE
HLDE_ECO7I      A-----------RKAGVPVLIDPKGTDFERYRG-ATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIADYE
HLDE_ECO55      A-----------RKAGVPVLIDPKGTDFERYRG-ATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIADYE
HLDE_ECO45      A-----------RKAGVPVLIDPKGTDFERYRG-ATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIADYE
HLDE_ECO27      A-----------RKAGVPVLIDPKGTDFERYRG-ATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIADYE
HLDE_ECO24      A-----------RKAGVPVLIDPKGTDFERYRG-ATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIADYE
HLDE_SHISS      A-----------RKAGVPVLIDPKGTDFERYRG-ATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIADYE
HLDE_ECO5E      A-----------RKAGVPVLIDPKGTDFERYRG-ATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIADYE
HLDE_ECO57      A-----------RKAGVPVLIDPKGTDFERYRG-ATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIADYE
SCRK_SALTY      -----------------------------RALHMANVVKLSEEELVFISSSNDLAYG-----IASVTERQ
SCRK_SALTH      -----------------------------RALHMANVVKLSEEELVFISSSNDLAYG-----IASVTERQ
IOLC2_BACCZ     REAVFLALEYARKHDVVVVDYRPYTWQSEAAAEKSDVIIGTREEFDMMEKLLNYEESNDQVTAERWFSHH
HLDE_ESCF3      A-----------RKAGVPVLIDPKGTDFERYRG-ATLLTPNLSEFEAVVGKCKTEEEIVERGMKLIADYE
YEII_ECOLI      TAEALEWVFTLADEIPVFVDTVSEFKAGKIKHWLAHIHTLKPTELEILWGQAITSDADRNTAVNALHQQG
LACC_STRPG      DYYQKLIGIANLNGKKTVLDCSGNALEAVLKGDSKPTVIKNLEELSQLLGKEMTKDFEALKEVLQDELFE
IOLC1_BACCZ     REAVFLALEYARKHDVVVVDYRPYTWQSEAAAEKSDVIIGTREEFDMMEKLLNYEQSNDQVTAERWFSHY
HLDE_VIBPA      SLEHVQAYIQKARAANIPVFIDPKGADFERYRG-ATLLTPNMKEFEDVVGKVKSDQELVEKALALVKEFD
HLDE_KLEP7      ---------RLAREAGVPVLIDPKGTDFERYRG-ATLLTPNLSEFEAVVGKCQDEAQIVERGMKLIAEFE
HLDE_KLEP3      A-----------REAGVPVLIDPKGTDFERYRG-ATLLTPNLSEFEAVVGKCQDEAEIVERGMKLIAEFE
LACC_STRA1      ------------------------------------VIKPNLEELTQLIGKPSYSLDELKSTLQQDIFRG
IOLC_BACHK      ----------------------------------SDVIIGTREEFDMMEKLLNYEKSNDQVTAERWFSHH
IOLC_BACC3      ----------------------------------SDVIIGTREEFDMMEKLLNYEQSNDQVTAERWFSHY
IOLC_BACAN      ----------------------------------SDVIIGTREEFDMMEKLLNYEKSNDQVTAERWFSHH
IOLC_BACAH      ----------------------------------SDVIIGTREEFDMMEKLLNYEQSNDQVTAERWFSHY
IOLC_BACAC      ----------------------------------SDVIIGTREEFDMMEKLLNYEKSNDQVTAERWFSHH
IOLC_BACAA      ----------------------------------SDVIIGTREEFDMMEKLLNYEKSNDQVTAERWFSHH
HLDE_PASMU      A-----------RQANIPVLIDPKGTDFERYRG-ATLLTPNMSEFEAVVGKCDSXXXXXXXXXXXXXXXD
ADK2_ARATH      -----------------------------------DFVFGNETEARTFSRVHGWETEDVEQKISQLPKAT
LACC_STRA5      ------------------------------------VIKPNLEELTQLIGKPSYSLDELKSTLQQDLFRG
LACC2_STRA3     ------------------------------------VIKPNLEELTQLIGKPSYSLDELKSTLQQDLFRG
HLDE_PSE14      ALRNHQALIQAARKRGIPVLADPKGKDFTIYRG-ASLITPNLSEFEAIVGHCEDEAQLVTKGAQLMQELD
SCRK5_ARATH     RLPLWPSTEAAIEGIKSIWNEA-------------DIIKVSDDEVTFL------TRGDAEKDLSLMHDKL
LACC_STRP8      DYYQKLIGIANLNGKKTVLDCSGNALEAVLKGDSKPTVIKNLEELSQLLGKEMTKDFEALKEVLQDELFE
HLDE_SALTY      A-----------RQAGVPVLIDPKGTDFERYRG-ATLLTPNLSEFEAVAGKCKSEDELVERGMKLIADYD
HLDE_SALTI      A-----------RQAGVPVLIDPKGTDFERYRG-ATLLTPNLSEFEAVAGKCKSEDELVERGMKLIADYD
HLDE_SALSV      A-----------RQAGVPVLIDPKGTDFERYRG-ATLLTPNLSEFEAVAGKCKSEDELVERGMKLIADYD
HLDE_SALPK      A-----------RQAGVPVLIDPKGTDFERYRG-ATLLTPNLSEFEAVAGKCKSEDELVERGMKLIADYD
HLDE_SALPC      A-----------RQAGVPVLIDPKGTDFERYRG-ATLLTPNLSEFEAVAGKCKSEDELVERGMKLIADYD
HLDE_SALPB      A-----------RQAGVPVLIDPKGTDFERYRG-ATLLTPNLSEFEAVAGKCKSEDELVERGMKLIADYD
HLDE_SALPA      A-----------RQAGVPVLIDPKGTDFERYRG-ATLLTPNLSEFEAVAGKCKSEDELVERGMKLIADYD
HLDE_SALNS      A-----------RQAGVPVLIDPKGTDFERYRG-ATLLTPNLSEFEAVAGKCKSEDELVERGMKLIADYD
HLDE_SALHS      A-----------RQAGVPVLIDPKGTDFERYRG-ATLLTPNLSEFEAVAGKCKSEDELVERGMKLIADYD
HLDE_SALG2      A-----------RQAGVPVLIDPKGTDFERYRG-ATLLTPNLSEFEAVAGKCKSEDELVERGMKLIADYD
HLDE_SALEP      A-----------RQAGVPVLIDPKGTDFERYRG-ATLLTPNLSEFEAVAGKCKSEDELVERGMKLIADYD
HLDE_SALCH      A-----------RQAGVPVLIDPKGTDFERYRG-ATLLTPNLSEFEAVAGKCKSEDELVERGMKLIADYD
HLDE_SALA4      A-----------RQAGVPVLIDPKGTDFERYRG-ATLLTPNLSEFEAVAGKCKSEDELVERGMKLIADYD
HLDE_SALAR      A-----------RQADVAVLIDPKGTDFERYRG-ATLLTPNLSEFEAVAGKCKSEDELVERGMKLIANYD
HLDE_EDWI9      QVGAVILSDYAKGALASVVLIDPKGTDFERYRG-ATLLTPNLSEFEAVVGRCH-SEQEIVDRGLALMERF
ADK_PHYPA       SMMTVAKHAAETGKYYMINLAAPFICQFFKLFPYVDFIFGNESEARAFAQVQGWETEDTKVKLAALPKAG
LACC_STRPF      ------------------------------------VIKPNLEELSQLLGKEMTKDFEALKEVLQDELFE
HLDE_PSESM      ALKNHQALIQAARKRGIPVLADPKGKDFAIYRG-ASLITPNLSEFEAIVGHCEDEAQLVTKGAQLMQELD
SCRK4_ARATH     ----------------------------------------------------------------------
HLDE_SHEHH      AIISPQSFIQAANAKGVKVLVDPKGSDFSKYRG-AYLLTPNMSEFEVVVGKV-----ESEADLVALEAYD
SCRK2_MAIZE     ----------------------------------------------------------------------
LACC_STRPC      DYYQKLIKIANLNGKKTVLDCSGNALEAVLKGDSKPTVIKNLEELSQLLGKEMTKDFEALKEVLQDELFE
LACC_STRPB      DYYQKLIKIANLNGKKTVLDCSGNALEAVLKGDSKPTVIKNLEELSQLLGKEMTKDFEALKEVLQDELFE
LACC_STRP1      DYYQKLIKIANLNGKKTVLDCSGNALEAVLKGDSKPTVIKNLEELSQLLGKEMTKDFDALKEVLQDELFD
KHK_HUMAN       RIDAHNTRQPPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHL----GFQSAEEA--LRGLYGRV
LACC_STRPM      DYYQKLIKIANLNGKKTVLDCSGNALEAVLKGDSKPTVIKNLEELSQLLGKEMTKDFEALKEVLQDELFE
LACC_STRPD      DYYQKLIKIANLNGKKTVLDCSGNALEAVLKGDSKPTVIKNLEELSQLLGKEMTKDFEALKEVLQDELFE
HLDE_PSEPF      VLVLSDYGKGALKNHQALIQAAPVLADPKSIYRGASLITPNLSEFEAIVGG---CADEHELVTKGMHDLD
Y057_BUCAP      ------------KKMSIPILIDPKGLDFKKYSG-ATLLTPNLSEFEQIVGKCHQEKQILQRGIKLVSELN
LACC_STRPZ      DYYQKLIGIANLNGKKTVLDCSGNALEAVLKGDSKPTVIKNLEELSQLLGKEMTKDFDALKEV--LQDKL
HLDE_VIBSL      ----------------------PKGADFERYRG-ATLLTPNMAEFELVAGKVKSEDEMIEKGLALIEEFD
HLDE_AERS4      ----------------------------------ATLLTPNMSEFEAVVGK---VKGEEDLVAKALVKRF
SCRK2_ORYSJ     ----------------------------------------------------------------------
SCRK2_ORYSI     ----------------------------------------------------------------------
FRLD_SHIFL      -------------------------------------------------------------KMKAIVARG
FRLD_ECOLI      -------------------------------------------------------------KMKAIVARG
ADK_MOUSE       SVLKVARYAAENNRVFTLNLSAPFISQFFKEALMVDILFGNETEAATFAREQGFETAKKAQALPKVNSKR
LACC_STRP3      DYYQKLIGIANLNGKKTVLDCSGNALEAVLKGDSKPTVIKNLEELSQLLGK------EMTKDFKALKAVL
LACC1_STRA3     ----------------------------------------------------------------------
KDGK_BACSU      ------------------------------LAGLADWFFPGIAEGELLTGEK-TPEGIADYYLK----KG
K1PF_BORBU      ----------------------------PNIYELEDLFNADSTKELIKIGKNLVESGV------------
IOLC_LACCA      ------------------------------VAQKADVIIGTRDEFDVLENHQGRTDQET---IATLFQYD
HLDE_PSEU2      ALKNHQALIQAARKRGIPVLADPKGKDFAIYRG-ASLITPNLSEFEAIVGHCVDEAQLVTKGAQLMQELD
ADK_RAT         SVLKVARYAAENNRTFTLNLSAPFISQFFKEALMVDILFGNETEAATFAREQGFETKDKTQALPKVNSKR
LACC_STRP6      ------------------------------------VIKPNLEELSQLLGKEMTKDFDALKEV--LQDKL
HLDE_ACIBL      ----------------------------------------------------------------------
YDJH_ECOLI      LDGKALTEIFTQAKARQMIICADMIK--PRLLSYVDYLFPNFAEAKLLTGKETLD------EIADCFLAC
HLDE_DICNV      SLHNVSALIAQAKAAGKWVLVDPKGTDFQRYRG-ADIVTPNVAELTAVVGHFADEKTMIAKARACLIDAG
HLDE_SHEPA      ALISPQSFIEAANAKGVKVLVDPKGSDFSKYRG-AYLLTPNMSEFEVVVGKV-----ESEADLVAKAQGL
IOLC_CLOPE      ----------------------------------SDIIMGSREEFDLMEGLIAKDSTDEETAKRWL-DYG
IOLC_CLOP1      ----------------------------------SDIIMGSREEFDLMEGLIAKDSTDEETAKRWL-DYG
HLDE_METCA      ----------------------PKGVDFDRYRG-ATLLTPNLSEFEAVVGAC-CDDAEIERKGRALMTRL
HLDE_CAMC1      ---------------------------------------------------------ELEKAIKQLKEEL
ADK_CRIGR       -----------------------------------DILFGNETEAATFAREQGFETAKKAQALAKVNSKR
Y060_BUCAI      TLANIQNIIDLAKKMSIPILIDPKGIDFKKYSG-ASLLTPNLFEFEKIVGKCYRENEILQRGIKXXXXXX
LACC_STRSV      ----------------------------------------------------------------------
LACC_STAHJ      ----------------------------------------------------------------------
K1PF_BACSU      ---------------------------------------------------------------KKLVEQG
HLDE_PSEPG      ALKNHQSLIQAARAKGIPVLADPKGKDFSIYRG-ASLITPNLSEFETIVGRCTDEADLVAKXXXXXXXXX
HLDE_PSEF5      ----------------------------------ASLITPNLSEFETIVGGCADEHELVSKGAQLMHDLE
HLDE_BLOPB      ----------------------------------ATLLTPNISEFESIVGRNEKILINRAQEI--IIDYN
LACC_STRMU      ----------------------------------------------------------------------
LACC_CLOPE      ----------------------------------------------------------------------
HLDE_SHEB8      ----------------------PKGSDFGRYQG-ASLITPNMSEFEAVVGTVTSEADLLEKARGLLKQHN
HLDE_VIBF1      A-----------RKVNVPVFIDPKGADFERYRG-ATLLTPNMLEFETVVGKVKDEDDLVAKGQQIIEEFD
HLDE_SHESW      ----------------------PKGSDFGRYHG-ASLITPNMSEFEAVVGTVTSEADLLEKARGLLKEHH
HLDE_SHEPC      ----------------------PKGSDFGRYHG-ASLITPNMSEFEAVVGTVTSEADLLEKARGLLKEHH
HLDE_SHEB9      ----------------------PKGSDFGRYQG-ASLITPNMSEFEAVVGTVTSEADLLEKARGLLKQHH
HLDE_SHEB5      ----------------------PKGSDFGRYQG-ASLITPNMSEFEAVVGTVTSEADLLEKARGLLKQHH
HLDE_SHEB2      ----------------------PKGSDFGRYQG-ASLITPNMSEFEAVVGTVTSEADLLEKARGLLKQHH
YIHV_ECOLI      --------------VMTVLDGDITPQDISELVALSDHAAFSEPGLARLTGVK-----EMASALKQAQTLT
YEGV_ECOLI      ----------ELQDVTPFIDFGPRIGDIPRIMACRPLVSLNRQEAEIAAERFALSA-EITTLGKQWQEKF
HLDE_VIBFM      ALEHVQSMIQEARKVNVPVFIDPKGADFERYRG-ATLLTPNMLEFETVVGKVKDEDDLVAKGQQIIEEFD
HLDE_HAHCH      AFIQLARS----KQIPVLVD--PKGSDFEKYRG-ATLITPNLSEFEAVVGHCTSEAELVQRGXXXXXXXX
ADK_HUMAN       -----------------------------------DILFGNETEAATFAREQGFETAKKTQALPKMNSKR
Y1459_PYRHO     TVMKVIKKIKGSSLIAFDVNLRLDLWRGQESIKLADIVKASEEEVLYL-------------ENQGVEVKG
KHK_PONAB       -----------------------------QLFGYGDVVFVSKDVAKHL----GFQSAE--AALRGLYGRV
HLDE_VIBCM      ----------------------PKGSDFERYRG-ASLLTPNMSEFEAVVGKVKSEQELVEKGFALIEKFD
HLDE_VIBC3      ----------------------PKGSDFERYRG-ASLLTPNMSEFEAVVGKVKSEQELVEKGFALIEKFD
THIED_CORGL     -----------------------------RLAVHVDVVTPNIPELAVLCDSAPAITMDEAIAQAQGFART
HLDE_PSYIN      SLADVQKMIQLAKKFNSVVLVDPKGSEFEKYRG-ATLLTPNLAEFEAVVGKCHSEKELVERGLALIKELD
HLDE_PSEPW      ----------------------------------ASLITPNLSEFETIVGRCADEAEXXXXXXXXXXXXX
PDXK_RAT        -----------------------------KVVPMADIITPNQFEAELLSGRKIHSQEEAFAVMDVLHRMG
PDXK_PIG        -----------------------------KVVPVADIITPNQFEAELLTGRRIHSEEEALAVMDMLHAMG
LACC_STRU0      ----------------------------------------------------------------------
KHK_RAT         ------------------------------------------------------SAGEA---LKGLYSRV
HLDE_VIBVY      ----------------------------------ATLLTPNMSEFEAVVGKVTSDDDLVEKALGLIEKFE
HLDE_VIBVU      ----------------------------------ATLLTPNMSEFEAVVGKVTSDDDLVEKALGLIEKFE
HLDE_PSEU5      ----------------------------------ASLITPNLGEFEAIVGHCADEAELVAKGAELMRQLE
HLDE_PSEPK      ALKNHQNLIQAARAKGIPVLADPKGKDFSIYRG-ASLITPNLSEFETIVGRCVDEAELVAKXXXXXXXXX
HLDE_PSEP1      ALKNHQNLIQAARAKGIPVLADPKGKDFSIYRG-ASLITPNLSEFETIVGRCVDEAELVAKXXXXXXXXX
Y406_METJA      ----------------------------------------------------------------------
PDXK_SHIDS      ------------------------------LLPLAQGITPNIFELEILTGKNCRDLDSAIAAAKSLLSDT
LACC_STAAR      ----------------------------------------------------------------------
HLDE_PSEE4      ----------------------------------ASLITPNLSEFEAIVGRCADEAELVXXXXXXXXXXX


                         .         .         .         +         .         .         .:280
query           GQTLIVTLGADGVIAMRNGKVFSASGLKIEPVDTVGAGDTFCGYLAASLDQGMDFEKALKRAAVAGSLAC
RBSK_ECOLI      IRTVLITLGSRGVWASVNGEGQRVPGFRVQAVDTIAAGDTFNGALITALLEEKPLPEXXXXXXXXXXXXV
RBSK_ECO57      IRTVLITLGSRGVWASVNGEGQRVPGFRVQAVDTIAAGDTFNGALITALLEEKPLPEXXXXXXXXXXXXV
RBSK_BACHD      -QKLIMTKGADGVQFYENDEQVQVESFRVEPVDTTGAGDTFNGAFAVALGGG-TVKEAVRFANAAAALSV
RBSK_BACSU      -AKLFITEGKQGVRYSAGSKEVLIPSFPVEPVDTTGAGDTFNAAFAVALAEGKDIEAALRFANRAASLSV
RBSK_LACLA      ---LIVTLGSEGVIFHDGETLQKIPAIKAKVVDTTGAGDTFNGAFAFGLTENLSISDSIRLAVVASHLSI
RBSK_HAEIN      IETVMITLGAKGVFVSRKGKSRIIKGFCVQAIDTTAAGDTFNGGFVTALLEEKSFDEAIRFGQAAAAISV
RBSK_SCHPO      RKAVIITLGSQGAYKSANGESALVSACKVKAVDTTAAGDTFIGAFSNSIAHGQPLKDSLEFAAKCSAITV
RBSK_YEAST      RGIVVMTLGSRGVLFCSHESQFLPAIQNVSVVDTTGAGDTFLGGLVTQLYQGETLSTAIKFSTLASSLTI
RBSK_HUMAN      CQVVIITLGAEGVLSQTEPEPKHIPTEKVKAVDTTGAGDSFVGALAFYLAPNLSLEDMLNRSNFIAAVSV
RBSK_MOUSE      CQVVVITLGASGCVILSQAEPVHIPTEAVKAVDTTGAGDSFVGALAFYLAPNLSLEEMLKRSNFIAAVSV
RBSK_DICDI      FENIIVTLGGNGQLLVNNKNCHIELKEKVKVVDTSGAGDSFIGSFAHYLTENKPLKDSIESASKVASISV
SCRK2_SOLLC     -KLLLVTLGEKGCNYYTKKFHGTVGGFHVKTVDTTGAGDSFVGALLTKLEDEARLKEVLRFSCACGAITT
SCRK2_SOLHA     -KLLLVTLGEKGCNYYTKKFHGTVGGFHVKTVDTTGAGDSFVGALLTKIDQTILADEALRFSCACGAITT
SCRK1_ORYSJ     MKLLLVTLGDQGCKYYARDFRGAVPSYKVQQVDTTGAGDAFVGALLSSLQDQKKLEEAIKFANACGAITA
SCRK1_ORYSI     MKLLLVTLGDQGCKYYARDFRGAVPSYKVQQVDTTGAGDAFVGALLSSLQDQKKLEEAIKFANACGAITA
HLDE_MANSM      LSALLVTRSEKGMTLLRPGQAYHLPTEAKEVFDVTGAGDTVISVLATALADGRSFEEACFLSNVAAGIVV
SCRK1_MAIZE     MKLLLVTLGDQGCKYYARDFHGAVPSFKVQQVDTTGAGDAFVGALLSSLQDEKKLVESIKFANACGAITT
SCRK_SOLTU      -KLLLVTLGEKGCNYYTKKFHGSVGGFHVKTVDTTGAGDSFVGALQAILEDEARLKEVLRFSCACGAITT
IOLC_LISIN      AEIIVIKHGVEGSFAYKAGETFRAQAYKTKVLKTFGAGDSYASAFLYGLFSGENIETALKFGSAAASIVV
IOLC_LISMH      AEIVVIKHGVEGSFAYKAGETFQAKAYKTKVLKTFGAGDSYASAFLYGLFSGESIETALKYGSAAASIVV
IOLC_LISMF      AEIVVIKHGVEGSFAYKAGETFQAKAYKTKVLKTFGAGDSYASAFLYGLFSGESIETALKYGSAAASIVV
IOLC_LISMC      AEIVVIKHGVEGSFAYKAGETFQAKAYKTKVLKTFGAGDSYASAFLYGLFSGESIETALKYGSAAASIVV
YDJE_BACSU      ANIVAVTLGKSGTL-LSNGKDREIPSIPVTSIDSTGAGDAFVGYQLANTDQDADFVKLREIVAFAGALVC
SCRK_VIBAL      SMAVLVTQGAKGVWRVFESQSELITGQVVSPIDTTGAGDAFVGGLLACLSRHADWKSAIQWANGCGALAT
IOLC_BACLD      ADLVVIKHGVEGSYAYKSGDVFRAKAYKTKVLKTFGAGDSYASAFLYGLVSGKDIETALKYGXXXXXXXX
HLDE_THICR      IDALLVTRSEHGMALIE--KDAGATILKSEVFDVTGAGDTVIATLATAFGSGLSMPKSVKLANEAASIVV
YURL_BACSU      AKMVCMTRGGQGAILSAGDRVYHQPIVEADIIDTLGAGDSFIAGFLTAFCVKQDITYALRQAAETAAKTC
Y356_ARCFU      -EIVAVKLGSEGCWIKKGDREVTVKPVSTKVVDTTGAGDAFAGFLYGYL-KGKDIEECGRLGNFVAAKCI
HLDE_HAES1      LSALLVTRSEKGMTLLRNNAPFHLPTEAKEVFDVTGAGDTVISVLATALADGRSYEEACYLANVAAGIVV
HLDE_COXBN      FEAILITRGKQGMMLIKEGAAINLVAHAREVYDVTGAGDTVIAVMAASLAAGGDFYEAAQLANLAAGLVV
SCRK3_ARATH     AMSLLVTLGEKGCTYFTKKFHGSVETFHVDAVDTTGAGDSFVGALQSVLEDEARLRKVLRFANACGAITT
IOLC_LISMO      AKIVVIKHGVEGSFAYKAGETFQAQAYKTKVLKTFGAGDSYASAFLYGLFSDESIETALKYGSAAASIVV
Y1544_METTH     PGVVVKTYGKEGSI-IYSDDVIKIDAIPREAVDPTGAGDSYAGFMRAYL-RGADLKTCGRFASAVASFIV
IOLC_BACA2      ADLVVIKHGVDGSYAYRSGEVFRAHAYKTKVLKTFGAGDSYASAFIYGLVSGRDIETALKYGXXXXXXXX
HLDE_HAEIE      LTALLVTRSEKGMTLLRNQEPYHLPTVAKEVFDVTGAGDTVISVLATALADGRSFEESCYLANVAAGIVV
HLDE_HAEI8      LTALLVTRSEKGMTLLRNQEPYHLPTVAKEVFDVTGAGDTVISVLATALADGRSFEESCYLANVAAGIVV
YZ37_SYNY3      AKNFALTRGGAGSLIFDGENLLTIGTPKVQPIDTVGAGDMYAGGFLYGLTHGMDYEKAGQLASETAAKVV
SCRK_ECOLX      IAMLLVTKGAEGVVVCYRGQVHHFAGMSVNCVDSTGAGDAFVAXXXXXXXDEREMRRIIDLAQRCGALAV
IOLC_BACSU      ADLVVIKHGVEGSYAYKSGEVFRAQAYKTKVLKTFGAGDSYASAFIYGLVSGKDIETALKYGXXXXXXXX
HLDE_HAEIN      LTALLVTRSEKGMTLLRNQEPYHLPTVAKEVFDVTGAGDTVISVLATALADGRSFEESCYLANVAAGIVV
HLDE_HAEIG      LTALLVTRSEKGMTLLRNQEPYHLPTVAKEVFDVTGAGDTVISVLATALADGRSFEESCYLANVAAGIVV
HLDE_COXBU      FEAILITRGKQGMMLIKEGAAINLVAHAREVYDVTGAGDTVIAVMAASLAAGGDFYEAAQLANLAAGLVV
HLDE_COXBR      FEAILITRGKQGMMLIKEGAAINLVAHAREVYDVTGAGDTVIAVMAASLAAGGDFYEAAQLANLAAGLVV
HLDE_CITK8      FSALLVTRSEQGMTLLQPGKAPLHMPTQAQEVDVTGAGDTVIGVLAATLAAGNSLEEACYFANAAAGVVV
SCRK1_ARATH     -KLLLVTLGEKGCRYYTKTFKGAVDPFHVNAVDTTGAGDSFVGALRSVLEDEERLRKVLRFANACGAITT
IOLC_BACSK      PELVVIKHGVDGSYALPSGETFRAGVYKTNVLKTFGAGDSYASAFLYGLLRGYDIDQALRFGXXXXXXXX
K6PF2_ECOLI     AKRVVVSLGPQGALGVDSENCIQVVPPPVKSQSTVGAGDSMVGAMTLKLAENASLEEMVRFGVAAGSAAT
HLDE_ENT38      FSALLVTRSEQGMTLLQPGKPPLHMPTQAQEVDVTGAGDTVIGVLAATLAAGNSLEEACYFANAAAGVVV
ADK_DICDI       TRTVVFTQGPDATLVFQNGVLTKYNPIKVATEDILAAGDSFCGGFLAAYSNGQEIAKCVE----------
SCRK2_ARATH     -KLLLVTLGENGCRYYTKDFHGSVETFHVDAVDTTGAGDSFVG---ALLNQIVDDQSXXXXANACGAITT
IOLC_PHOPR      ANTQVVIVKAGELVYCKDGHKFQQGIFRVEVKKPFGSGDSFAGGLIWTLVNGGELEDGVKHGSAAAAISC
HLDE_ECOHS      LSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVDVTGAGDTVIGVLAATLAAGNSLEEA------------
ADK1_ARATH      KRTTVITQGADPVVVAEDGKVKKYPVIKEKLVDTNGAGDAFVGGFLSQLVHGKGIEECVRAGCYASNVVI
HLDE_ENTS8      LSALLVTRSEQGMTLLQPGKAFHLPTQAQEVYDVTGAGDTVIGVLAATLASGNSLEEA------------
IOLC_BACHD      PELIVIKHGVEGSFAYKAGEAYRGYAYKTKVLKTFGAGDSYASAFLYALISGKGIETALKYGXXXXXXXX
HLDE_SHIFL      LSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVDVTGAGDTVIGVLAATLAAGNSLEEA------------
HLDE_SHIF8      LSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVDVTGAGDTVIGVLAATLAAGNSLEEA------------
HLDE_SHIDS      LSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVDVTGAGDTVIGVLAATLAAGNSLEEA------------
HLDE_SHIBS      LSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVDVTGAGDTVIGVLAATLAAGNSLEEA------------
HLDE_SHIB3      LSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVDVTGAGDTVIGVLAATLAAGNSLEEA------------
HLDE_SALDC      LSALLVTRSEQGMTLLQPNKAPLHMPTQAQEVDVTGAGDTVIGVLAATLAAGNTLEEACYFANAAAGVVV
HLDE_ECOUT      LSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVDVTGAGDTVIGVLAATLAAGNSLEEA------------
HLDE_ECOSM      LSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVDVTGAGDTVIGVLAATLAAGNSLEEA------------
HLDE_ECOSE      LSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVDVTGAGDTVIGVLAATLAAGNSLEEA------------
HLDE_ECOLU      LSALLVTRSEQGMSLLQPGKTPLHMPTQAQEVDVTGAGDTVIGVLAATLAAGNSLEEA------------
HLDE_ECOLI      LSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVDVTGAGDTVIGVLAATLAAGNSLEEA------------
HLDE_ECOLC      LSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVDVTGAGDTVIGVLAATLAAGNSLEEA------------
HLDE_ECOL6      LSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVDVTGAGDTVIGVLAATLAAGNSLEEA------------
HLDE_ECOL5      LSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVDVTGAGDTVIGVLAATLAAGNSLEEA------------
HLDE_ECOK1      LSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVDVTGAGDTVIGVLAATLAAGNSLEEA------------
HLDE_ECODH      LSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVDVTGAGDTVIGVLAATLAAGNSLEEA------------
HLDE_ECOBW      LSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVDVTGAGDTVIGVLAATLAAGNSLEEA------------
HLDE_ECO8A      LSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVDVTGAGDTVIGVLAATLAAGNSLEEA------------
HLDE_ECO81      LSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVDVTGAGDTVIGVLAATLAAGNSLEEA------------
HLDE_ECO7I      LSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVDVTGAGDTVIGVLAATLAAGNSLEEA------------
HLDE_ECO55      LSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVDVTGAGDTVIGVLAATLAAGNSLEEA------------
HLDE_ECO45      LSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVDVTGAGDTVIGVLAATLAAGNSLEEA------------
HLDE_ECO27      LSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVDVTGAGDTVIGVLAATLAAGNSLEEA------------
HLDE_ECO24      LSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVDVTGAGDTVIGVLAATLAAGNSLEEA------------
HLDE_SHISS      LSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVDVTGAGDTVIGVLAATLAAGNSLEEA------------
HLDE_ECO5E      LSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVDVTGAGDTVIGVLAATLAAGNSLEEA------------
HLDE_ECO57      LSALLVTRSEQGMSLLQPGKAPLHMPTQAQEVDVTGAGDTVIGVLAATLAAGNSLEEA------------
SCRK_SALTY      PELLLVTRGKAGVLAAFQQKFTHFNARPVASVDTTGAGDAFAGLLASLAANGMPLEPTLTLAQTCGALAT
SCRK_SALTH      PELLLVTRGKAGVLAAFQQKFTHFNARPVASVDTTGAGDAFAGLLASLAANGMPLEPTLTLAQTCGALAT
IOLC2_BACCZ     AKIVVIKHGGDGSIAYRDGQSHRGGIFKTKVLKTFGAGDSYASAFIYGLMQGLEIPQAMRLGGASASIVI
HLDE_ESCF3      LSALLVTRSEQGMSLLQPGKEPLHMPTQAQEVDVTGAGDTVIGVLAATLAAGNSLEEA------------
YEII_ECOLI      VQQLFVYLPDESVCSEKDGEQFLLTAPAHTTVDSFGADDGFMAGLVYSFLEGYSFRDSARFAVACAAIS-
LACC_STRPG      GEWIIVSLGADGVFAKHNDTFYNVDIPKIEIVSAVGSGDSTVAGIASGLANDEDDRALLTKANVLGML--
IOLC1_BACCZ     AKIVVIKHGGDGSIAYRDGQSHRGGIFKTKVLKTFGAGDSYASAFIYGLIQGLEIPQAMRLGGASASIVI
HLDE_VIBPA      FEALLVTRSEHGMTLIRRGQEFHLPTQAKEVYDVTGAGDTVISVLAASVAAGKSFEE-------------
HLDE_KLEP7      LSALLVTRSEQGMTLLQPGRPPLHMPTQAQEVDVTGAGDTVIGVLAATLASGNTLEEACYFANAAAGVVV
HLDE_KLEP3      LSALLVTRSEQGMTLLQPGRPPLHMPTQAQEVDVTGAGDTVIGVLAATLASGNTLEEACYFANAAAGVVV
LACC_STRA1      IDWVIVSLGAKGAFAKHGNHYYQVTIPKIEVINPVGSGDATVAGIASALEHQLDDTNLLKRANVLGML--
IOLC_BACHK      AKIVVIKHGGDGSIAYRDGQSHRGGIFKTKVLKTFGAGDSYASAFIYGLMQGLEIPQAMRLGGASASIVI
IOLC_BACC3      AKIVVIKHGGDGSIAYRDGQSHRGGIFKTKVLKTFGAGDSYASAFIYGLMQGLEIPQAMRLGGASASIVI
IOLC_BACAN      AKIVVIKHGGDGSIAYRDGQSHRGGIFKTKVLKTFGAGDSYASAFIYGLMQGLEIPQAMRLGGASASIVI
IOLC_BACAH      AKIVVIKHGGDGSIAYRDGQSHRGGIFKTKVLKTFGAGDSYASAFIYGLMQGLEIPQAMRLGGASASIVI
IOLC_BACAC      AKIVVIKHGGDGSIAYRDGQSHRGGIFKTKVLKTFGAGDSYASAFIYGLMQGLEIPQAMRLGGASASIVI
IOLC_BACAA      AKIVVIKHGGDGSIAYRDGQSHRGGIFKTKVLKTFGAGDSYASAFIYGLMQGLEIPQAMRLGGASASIVI
HLDE_PASMU      LSALLVTRSEKGMTLLRNQPAFHLATEAKEVFDVTGAGDTVISVLATGLADGRSFEEACYLANVAAGIVV
ADK2_ARATH      GRTTVITQGADPVVVAEDGKVKKYPVIKEKLVDTNGAGDAFVGGFMSQLVKEKSIEECVKAGCYASNVVI
LACC_STRA5      IDWVIVSLGARGAFAKHGNHYYQVTIPKIEVINPVGSGDATVAGIASALEHQLDDTNLLKRANVLGML--
LACC2_STRA3     IDWVIVSLGARGAFAKHGNHYYQVTIPKIEVINPVGSGDATVAGIASALEHQLDDTNLLKRANVLGML--
HLDE_PSE14      LGALLVTRGEHGMTLLRDQQALHLPARAREVFDVTGAGDTVISTLAAAIAAGEELPHAVALANLAAGIVV
SCRK5_ARATH     -KLLIVTDGEKGCRYYTKKFKGRVPGYAVKAVDTTGAGDSFVGAFLVSLDDEGKLKEALAFANACGAVCT
LACC_STRP8      GEWIIVSLGADGVFAKHNDTFYNVDIPKIEIVSAVGSGDSTVAGIASGLANDEDDRALLTKANVLGML--
HLDE_SALTY      LSALLVTRSEQGMTLLQPNKAPLHMPTQAQEVDVTGAGDTVIGVLAATLAAGNTLEEACYFANAAAGVVV
HLDE_SALTI      LSALLVTRSEQGMTLLQPNKAPLHMPTQAQEVDVTGAGDTVIGVLAATLAAGNTLEEACYFANAAAGVVV
HLDE_SALSV      LSALLVTRSEQGMTLLQPNKAPLHMPTQAQEVDVTGAGDTVIGVLAATLAAGNTLEEACYFANAAAGVVV
HLDE_SALPK      LSALLVTRSEQGMTLLQPNKAPLHMPTQAQEVDVTGAGDTVIGVLAATLAAGNTLEEACYFANAAAGVVV
HLDE_SALPC      LSALLVTRSEQGMTLLQPNKAPLHMPTQAQEVDVTGAGDTVIGVLAATLAAGNTLEEACYFANAAAGVVV
HLDE_SALPB      LSALLVTRSEQGMTLLQPNKAPLHMPTQAQEVDVTGAGDTVIGVLAATLAAGNTLEEACYFANAAAGVVV
HLDE_SALPA      LSALLVTRSEQGMTLLQPNKAPLHMPTQAQEVDVTGAGDTVIGVLAATLAAGNTLEEACYFANAAAGVVV
HLDE_SALNS      LSALLVTRSEQGMTLLQPNKAPLHMPTQAQEVDVTGAGDTVIGVLAATLAAGNTLEEACYFANAAAGVVV
HLDE_SALHS      LSALLVTRSEQGMTLLQPNKAPLHMPTQAQEVDVTGAGDTVIGVLAATLAAGNTLEEACYFANAAAGVVV
HLDE_SALG2      LSALLVTRSEQGMTLLQPNKAPLHMPTQAQEVDVTGAGDTVIGVLAATLAAGNTLEEACYFANAAAGVVV
HLDE_SALEP      LSALLVTRSEQGMTLLQPNKAPLHMPTQAQEVDVTGAGDTVIGVLAATLAAGNTLEEACYFANAAAGVVV
HLDE_SALCH      LSALLVTRSEQGMTLLQPNKAPLHMPTQAQEVDVTGAGDTVIGVLAATLAAGNTLEEACYFANAAAGVVV
HLDE_SALA4      LSALLVTRSEQGMTLLQPNKAPLHMPTQAQEVDVTGAGDTVIGVLAATLAAGNTLEEACYFANAAAGVVV
HLDE_SALAR      LSALLVTRSEQGMTLLQPNKAPLHMPTQAQEVDVTGAGDTVIGVLAATLAAGNTLEEACYFANAAAGVVV
HLDE_EDWI9      DLTLLVTRSEQGMTLLQRGIAPLHMPTQAQEVDVTGAGDTVIGMLAASIAAGASLDEACFLANAAAGVVV
ADK_PHYPA       GRVAVITQGTDPTIVAEDGKVFPVTPIPKEKVDTNAAGDSFVGGFLSQLVLGKDIAQCVRAGNYAASVII
LACC_STRPF      GEWIIVSLGADGVFAKHNDTFYNVDIPKIEIVSAVGSGDSTVAGIASGLANDEDDRALLTKANVLGML--
HLDE_PSESM      LGALLVTRGEHGMTLLRDQQALHLPARAREVFDVTGAGDTVISTLAAAIAAGEELPHAVALANLAAGIVV
SCRK4_ARATH     -----VTLGEKGCRYYTKSFRGSVDPFHVDAVDTTGAGDSFVGALRAVLEDEARLREVLRLANACGAITT
HLDE_SHEHH      FTAMLVTRSEKGMLITRDQPELHIPTVAREVFDVTGAGDTVISALATAIAAGSDLPQACAIANTAAGIVV
SCRK2_MAIZE     ---LVVTDGDKGCRYFTKDFKGSVPGFKVDTVDTTGAGDAFVGSLLVNVAKDEKLREALKFSNACGAICT
LACC_STRPC      GEWIIVSLGADGVFAKHKDTFYNVDIPKIKIVSAVGSGDSTVAGIASGLANDEDDRALLTKANVLGML--
LACC_STRPB      GEWIIVSLGADGVFAKHKDTFYNVDIPKIKIVSAVGSGDSTVAGIASGLANDEDDRALLTKANVLGML--
LACC_STRP1      GEWIIVSLGADGVFAKHKDTFYNVDIPKIKIVSAVGSGDSTVAGIASGLANDEDDRALLTKANVLGML--
KHK_HUMAN       GAVLVCAWAEEGADALGDGKLLHSDAFPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVAGKKC
LACC_STRPM      GEWIIVSLGADGVFAKHKDTFYNVDIPKIKIVSAVGSGDSTVAGIASGLANDEDDRALLTKANVLGML--
LACC_STRPD      GEWIIVSLGADGVFAKHKDTFYNVDIPKIKIVSAVGSGDSTVAGIASGLANDEDDRALLTKANVLGML--
HLDE_PSEPF      LGALLVTRGEHGMTLLRDHPALHLPARAREVFDVTGAGDTVISTLAAAIAAGEELPHAVALANLAAGIVV
Y057_BUCAP      LSALLVTRSKNGMTLFQPEKPIHFPALSKTASDVTGAGDTVISIIASSLATGYSLEEACFYANVGASIVI
LACC_STRPZ      FEWIIVSLGADGVFAKHKDTFYNVDIPKIKIVSAVGSGDSTVAGIASGLANDEDDRALLTKANVLGML--
HLDE_VIBSL      FEALLVTRSEHGMTLLRKGEPFHLPTQAKEVYDVTGAGDTVISVLAASVAAG------------------
HLDE_AERS4      EEALLVTRSENGMTLIREGQPLHLPAQAHEVYDVTGAGDTVISTLATSLAAGMSLDEACALANTAAGIVV
SCRK2_ORYSJ     ---LIVTDGEKGCRYFTKDFKGSVPGFSVNTVDTTGAGDAFVGSLLVNVAKDEKLREALKFSNACGAICT
SCRK2_ORYSI     ---LIVTDGEKGCRYFTKDFKGSVPGFSVNTVDTTGAGDAFVGSLLVNVAKDEKLREALKFSNACGAICT
FRLD_SHIFL      AGTVIVTLGENGSIAWDGAQFWRQAPEPVTVIDTMGAGDSFIAGFLCGWSAGMTLPQAMAQGTACAAKTI
FRLD_ECOLI      AGTVIVTLGENGSIAWDGAQFWRQAPEPVTVIDTMGAGDSFIAGFLCGWSAGMTLPQAIAQGTACAAKTI
ADK_MOUSE       QRTVIFTQGRDDTIVAAENDVTAFPVLQEEIIDTNGAGDAFVGGFLSQLVSDKPLTECIRAGHYAASVII
LACC_STRP3      QDELIVSLGADGVFAKHKDTFYNVDIPKIKIVSAVGSGDSTVAGIASGLANDEDDRALLTKANVLGML--
LACC1_STRA3     ---IIVSLGADGAFAKHWDTFYKVDIPKIEVVNPVGSGDSTVAGISSALSHQVDDYSLLKKANVLGML--
KDGK_BACSU      ASFVAIKLGKEGAYFKTGTSEGFLEGCRVDRVDTVGAGDGFAVGVISGILDGLSYKDAVQRGNAIGALQV
K1PF_BORBU      -QNIIISMGSDGAIFIGGKNVFRAFVPKINFVSTIGAGDSVIAGFVYAFDNGSTLEDSFKFGVAAGT---
IOLC_LACCA      ANLIVIKSGIQGSNAYKAGETYHFGVFKTKVLKSFGAGDSFAAGFLYAYQHQLGLETALKYGSAAASIVI
HLDE_PSEU2      LGALLVTRGEHGMTLLRDQQALHLPARAREVFDVTGAGDTVISTLAAAIAAGEELPHAVALANLAAGIVV
ADK_RAT         QRTVIFTQGRDDTIVATGNDVTAFPVLQEEIVDTNGAGDAFVGGFLSQLVSNKPLTECIRAGHYAASVII
LACC_STRP6      FEWIIVSLGADGVFAKHKDTFYKVDIPKIKIVSAVGSGDSTVAGIASGLANDEDDRALLTKANVLGML--
HLDE_ACIBL      ---LTATLGEKGIALVTRDKTTISAAVARQVFDVSGAGDAVIATLSLSLASGLDPELGVHLANLAGAIVV
YDJH_ECOLI      GKTVVIKTGKDGCFIKRGDMTMKVPAVAITAIDTIGAGDNFASGFIAALLEGKNLRECARFANATAAISV
HLDE_DICNV      ISAFLITQSEKGMTYVTAQQHYHLPAQAREVFDVTGAGDTVIATLACALASGYDCESAMIFANAAASVVV
HLDE_SHEPA      LQAMLVTRSEKGMLITKDQPELHIPTVAREVYDVTGAGDTVISALATAIAAGSDLPQACAIANTAAGIVV
IOLC_CLOPE      NKIVVIKHGKDGSTAYRDGKAYRIKPFPVKLLKSFGGGDAYASAFIYGILEGWDMMDALEFGSASAAMLV
IOLC_CLOP1      NKIVVIKHGKDGSTAYRDGKAYRIKPFPVKLLKSFGGGDAYASAFIYGILEGWDMMDALEFGSASAAMLV
HLDE_METCA      DEALLVTRGEHGMSLLRP----TAGALHLEVYDVTGAGDTVISVLAAALAVGRPLTDAVALANLAAGIVV
HLDE_CAMC1      NLTYIITISEEG-IALYDDKLHIFAAKAKEVFDVTGAGDTVLATLGYMLANGADIKEAIKIANLAAAVVV
ADK_CRIGR       PRTVVFTQGRDDTVVATENEVMAFAVLQKEIIDTNGAGDAFVGGFLSQLVYNKPLTECIRAGHYAASVII
Y060_BUCAI      XXXXXVTRSKNGMTLFQKEKIHFPAASKIAS-DVTGAGDTVIAIIAASLATGYSLEEACFYANIGASIVI
LACC_STRSV      ---IIVSLGADGAFAKHWETFYKVDIPKIQVVNPVGSGDSTVAGISSALSHQADDVSLLKKANVLGML--
LACC_STAHJ      ---IIVSLGGDGAFAKHHQTFYKVNIPKIEVVNPVGSGDSTVAGIASGLVHQQSDEDLLKKANAFGML--
K1PF_BACSU      AEHVIVSMAGDGALLFTNEAVYFANVPKGKLVNSVGAGDSVVAGFLAGISKQLPLEEAFRLGVTSGS---
HLDE_PSEPG      XXXXXVTRGEHGMTLLRVGQALHLPARAREVFDVTGAGDTVISTLAAAIAAGEDLPHAVALANLAAGIVV
HLDE_PSEF5      LGALLVTRGEHGMTLLRDHPAMHLPARAREVFDVTGAGDTVISTLAAAIAAGEELPHAVGLANLAAGIVV
HLDE_BLOPB      LSALLITRSERGMLCTRYAAPLYFSTQKKKVYHVTGAGDTVVGVLSAALSSGKSLEKACFLANLAASAVI
LACC_STRMU      ---IIVSLGSQGAFAKHGQTFYKVTIPKIAVVNPVGSGDSTVAGITSALAAGASDEKLLKKANTLGML--
LACC_CLOPE      ---IVISMGAKGSFAKHNDKFYRVIIPKIQVVNPVGSGDSTIAGLTKGLNDGETDENVLKIANTLGML--
HLDE_SHEB8      FDAILVTRSEKGMLVTANAPELHIPTVAREVYDVTGAGDTVISALATSLAAGADLPQACAIANTAAGVVV
HLDE_VIBF1      FEALLVTRSEHGMTLLRNMEPLHLPTQAREVFDVTGAGDTVISVLAASVSTG------------------
HLDE_SHESW      FDAILVTRSEKGMLVTANAPELHIPTVAREVYDVTGAGDTVISALATSLAAGADLPQACAIANTAAGVVV
HLDE_SHEPC      FDAILVTRSEKGMLVTANAPELHIPTVAREVYDVTGAGDTVISALATSLAAGADLPQACAIANTAAGVVV
HLDE_SHEB9      FDAILVTRSEKGMLVTANAPELHIPTVAREVYDVTGAGDTVISALATSLAAGADLPQACAIANTAAGVVV
HLDE_SHEB5      FDAILVTRSEKGMLVTTNAPELHIPTVAREVYDVTGAGDTVISALATSLAAGADLPQACAIANTAAGVVV
HLDE_SHEB2      FDAILVTRSEKGMLVTANAPELHIPTVAREVYDVTGAGDTVISALATSLAAGADLPQACAIANTAAGVVV
YIHV_ECOLI      NGHVYVTQGSAGCDWLENGGRQHQPAFKXXXXXXXXXXXXFHGALAVALATSGDLAESVRFASGVAALKC
YEGV_ECOLI      AAPLIVRLDKEGAWYFSNDASGCIPAFPTQVVDTIGAGDS------------------------------
HLDE_VIBFM      FEALLVTRSEHGMTLLRNMEPLHLPTQAREVFDVTGAGDTVISVLAASVSTG------------------
HLDE_HAHCH      XXXXXVTRSEQGMTLLRAGRSLHLPAQAKEVFDVTGAGDTVISVLAAALAAGSEMGQAVALANIAAGIVV
ADK_HUMAN       QRIVIFTQGRDDTIMATESEVTAFAVLQKEIIDTNGAGDAFVGGFLSQLVSDKPLTECIRAGHYAASIII
Y1459_PYRHO     SMLTAITLGPKGCRLIKNETVVDVPSYNVNPLDTTGAGDAF-----------------------------
KHK_PONAB       GAVLVCAWAEEGADALGDDKLFHSDAFPPRVVDTLGAGDTFNASVIFSLSQGRSMQEALRFGCQVAGKKC
HLDE_VIBCM      LGALLVTRSEHGMTLLRRGEPFHLPTQAKEVYDVTGAGDTVISVLAASVAAG------------------
HLDE_VIBC3      LGALLVTRSEHGMTLLRRGEPFHLPTQAKEVYDVTGAGDTVISVLAASVAAG------------------
THIED_CORGL     HDTIVIVKGADNAVVRPDGSVFQVENLRVNTTNSHGTGCSLSASLATKIAAGESVEKALE----------
HLDE_PSYIN      LDALLVTRSEHGMTLLREGQEPLHLPTQAQEVDVTGAGDTVIXXXXXXXXXXXXFEQACTLANAAAGVVV
HLDE_PSEPW      XXXXXXTRGEHGMTLLRTGQALHLPARAREVFDVTGAGDTVISTLAAAIAAGEDLPHAVGLANLAAGIVV
PDXK_RAT        PDTVVITKGSDYLMALGSQRMRKPDGRKVDPV-FVGTGDLFAAMLLA-----------------------
PDXK_PIG        PDTVVITRGKDYLIALGSQRTRSPDGMEICKVDAVGTGDLFAAMLLA-----------------------
LACC_STRU0      ---VIVSLGSKGAFAKHIDSYYQVTIPKIEVVNPVGSGDSTVAGITSALYHAESDEELLKKANCLGML--
KHK_RAT         GATLICAWAEEGADALGDGQLLHSDAFPPRVVDTLGAGDTFNASVIFSLSKGNSMQEALRFGCQVAGKKC
HLDE_VIBVY      LGALLVTRSEHGMTLVRDQKPFHLPTQAKEVYDVTGAGDTVISVLAASVAAG------------------
HLDE_VIBVU      LGALLVTRSEHGMTLVRDQKPFHLPTQAKEVYDVTGAGDTVISVLAASVAAG------------------
HLDE_PSEU5      LGALLVTRGEHGMTLLRPEHALHLPARAREVFDVTGAGDTVISTLAASLAAGEELPQAVALANLAAGIVV
HLDE_PSEPK      XXXXXVTRGEHGMTLLRVGQALHLPARAREVFDVTGAGDTVISTLAAAIAAGEDLPHAVALANLAAGIVV
HLDE_PSEP1      XXXXXVTRGEHGMTLLRVGQALHLPARAREVFDVTGAGDTVISTLAAAIAAGEDLPHAVALANLAAGIVV
Y406_METJA      ---LIVTKGSKGSVIYTKDKKIEIPCIKAKVIDPTGAGDSYAGFLSAYV-KGYDLEKCGLIGAATASFVV
PDXK_SHIDS      LKWVVITSASGNVVSADSVNVISHSRVK---TDLKGTGDLFCAQLISGLLKGKALNDAVHRAGL------
LACC_STAAR      ---IIVSLGAQGAFAKHNHTFYRVNIPKISVLNPVGSGDTVAGITSAILNHENDHD-LLKKANTLGMLNA
HLDE_PSEE4      XXXXXVTRGEHGMTLLRVGHALHLPARAREVFDVTGAGDTVISTLAAAIAAGEDLPHAVALANLAAGIVV


                         .         *         .         .         .         .         +:350
query           TRAGAQPSIPQAAEVDAAL
RBSK_ECOLI      TRKGAQPSVPWREEIDAFL
RBSK_ECO57      TRKGAQPSVPWREEIDAFL
RBSK_BACHD      QSFGAQGGMPTKAQVQSFL
RBSK_BACSU      CSFGAQGGMPTRNEVEELL
RBSK_LACLA      QKFGAQGGMPKLSEVKAKL
RBSK_HAEIN      TKKGAQSSIPTRQE-----
RBSK_SCHPO      QRKGAASSIPSLLEVDGS-
RBSK_YEAST      QRKGAAESMPLYKDV----
RBSK_HUMAN      QAAGTQSSYPYKKDLPLTL
RBSK_MOUSE      QATGTQSSYPYKKDLPLAL
RBSK_DICDI      TRHGTQTSYPKSNEIN---
SCRK2_SOLLC     TKKGAIPALPTASE-----
SCRK2_SOLHA     TKKGAIPALPTASE-----
SCRK1_ORYSJ     TKKGAIPSLPTEVEV----
SCRK1_ORYSI     TKKGAIPSLPTEVEV----
HLDE_MANSM      GKLG---------------
SCRK1_MAIZE     TKKGAIPSLPTEAEV----
SCRK_SOLTU      TKKGAIPALPTESE-----
IOLC_LISIN      SKHSSSDAMPTADEIKALI
IOLC_LISMH      SKHSSSDAMPTADEIKALI
IOLC_LISMF      SKHSSSDAMPTADEIKALI
IOLC_LISMC      SKHSSSDAMPTADEIKALI
YDJE_BACSU      TKIGAIDALPSLDEIGVSL
SCRK_VIBAL      TQKGAMTALPTQTEL----
IOLC_BACLD      XXXXXXEAMPTVAEIE---
HLDE_THICR      RKVG---------------
YURL_BACSU      GVYGA--------------
Y356_ARCFU      EKYGAREGLPRSVD-----
HLDE_HAES1      GKLG---------------
HLDE_COXBN      RKLGA--------------
SCRK3_ARATH     TKKGAIPALPTDIE-----
IOLC_LISMO      SKHSSSDAMPTADEIKALI
Y1544_METTH     EDEGTQTNIPDTGE-----
IOLC_BACA2      XXXXXXEAMPAAGEI----
HLDE_HAEIE      GKLG---------------
HLDE_HAEI8      GKLG---------------
YZ37_SYNY3      TCYG---------------
SCRK_ECOLX      TAKGAMTALPCRQELES--
IOLC_BACSU      XXXXXXEAMPTAEEIE---
HLDE_HAEIN      GKLG---------------
HLDE_HAEIG      GKLG---------------
HLDE_COXBU      RKLGA--------------
HLDE_COXBR      RKLGA--------------
HLDE_CITK8      GKLGTSTVSP---------
SCRK1_ARATH     TKKGAIPALPSDAEVRSFL
IOLC_BACSK      XXXXXXEAMPTLSEIKA--
K6PF2_ECOLI     LNQGTR-------------
HLDE_ENT38      GKLGTSTVSP---------
ADK_DICDI       -------------------
SCRK2_ARATH     TKKGAIPALPTDCE-----
IOLC_PHOPR      TEA----------------
HLDE_ECOHS      -------------------
ADK1_ARATH      QRSG---------------
HLDE_ENTS8      -------------------
IOLC_BACHD      XXXXXXDAMPSVEEIEALI
HLDE_SHIFL      -------------------
HLDE_SHIF8      -------------------
HLDE_SHIDS      -------------------
HLDE_SHIBS      -------------------
HLDE_SHIB3      -------------------
HLDE_SALDC      GKLGTSTVSP---------
HLDE_ECOUT      -------------------
HLDE_ECOSM      -------------------
HLDE_ECOSE      -------------------
HLDE_ECOLU      -------------------
HLDE_ECOLI      -------------------
HLDE_ECOLC      -------------------
HLDE_ECOL6      -------------------
HLDE_ECOL5      -------------------
HLDE_ECOK1      -------------------
HLDE_ECODH      -------------------
HLDE_ECOBW      -------------------
HLDE_ECO8A      -------------------
HLDE_ECO81      -------------------
HLDE_ECO7I      -------------------
HLDE_ECO55      -------------------
HLDE_ECO45      -------------------
HLDE_ECO27      -------------------
HLDE_ECO24      -------------------
HLDE_SHISS      -------------------
HLDE_ECO5E      -------------------
HLDE_ECO57      -------------------
SCRK_SALTY      TAKGAMTALPYQRDLN---
SCRK_SALTH      TAKGAMTALPYQRDLN---
IOLC2_BACCZ     SKHSCSDAMPTRAEISA--
HLDE_ESCF3      -------------------
YEII_ECOLI      -------------------
LACC_STRPG      -------------------
IOLC1_BACCZ     SKHSCSDAMPTRAEISA--
HLDE_VIBPA      -------------------
HLDE_KLEP7      GKLGTSTVSPVELE-----
HLDE_KLEP3      GKLGTSTVSPVELE-----
LACC_STRA1      -------------------
IOLC_BACHK      SKHSCSDAMPTRAEISA--
IOLC_BACC3      SKHSCSDAMPTRAEISA--
IOLC_BACAN      SKHSCSDAMPTRAEISA--
IOLC_BACAH      SKHSCSDAMPTRAEISA--
IOLC_BACAC      SKHSCSDAMPTRAEISA--
IOLC_BACAA      SKHSCSDAMPTRAEISA--
HLDE_PASMU      GKLG---------------
ADK2_ARATH      QRSG---------------
LACC_STRA5      -------------------
LACC2_STRA3     -------------------
HLDE_PSE14      GKLG---------------
SCRK5_ARATH     TQKGAIPALPTPAD-----
LACC_STRP8      -------------------
HLDE_SALTY      GKLGTSTVSP---------
HLDE_SALTI      GKLGTSTVSP---------
HLDE_SALSV      GKLGTSTVSP---------
HLDE_SALPK      GKLGTSTVSP---------
HLDE_SALPC      GKLGTSTVSP---------
HLDE_SALPB      GKLGTSTVSP---------
HLDE_SALPA      GKLGTSTVSP---------
HLDE_SALNS      GKLGTSTVSP---------
HLDE_SALHS      GKLGTSTVSP---------
HLDE_SALG2      GKLGTSTVSP---------
HLDE_SALEP      GKLGTSTVSP---------
HLDE_SALCH      GKLGTSTVSP---------
HLDE_SALA4      GKLGTSTVSP---------
HLDE_SALAR      GKLGTSTVSPVELE-----
HLDE_EDWI9      GKLGTSTVSP---------
ADK_PHYPA       QRSGCTPSKP---------
LACC_STRPF      -------------------
HLDE_PSESM      GKLG---------------
SCRK4_ARATH     TKKGAIPALPTESEVQSLL
HLDE_SHEHH      AKLG---------------
SCRK2_MAIZE     TKKGAIPALPTVA------
LACC_STRPC      -------------------
LACC_STRPB      -------------------
LACC_STRP1      -------------------
KHK_HUMAN       GLQG---------------
LACC_STRPM      -------------------
LACC_STRPD      -------------------
HLDE_PSEPF      GKLG---------------
Y057_BUCAP      QKIGTE-------------
LACC_STRPZ      -------------------
HLDE_VIBSL      -------------------
HLDE_AERS4      GKLGTSTVSP---------
SCRK2_ORYSJ     TKKGAIPALPTVA------
SCRK2_ORYSI     TKKGAIPALPTVA------
FRLD_SHIFL      QYHGA--------------
FRLD_ECOLI      QYHGA--------------
ADK_MOUSE       RRTG---------------
LACC_STRP3      -------------------
LACC1_STRA3     -------------------
KDGK_BACSU      QAPGDMDGLP---------
K1PF_BORBU      -------------------
IOLC_LACCA      SQLSSSEAMPNLDQLTA--
HLDE_PSEU2      GKLG---------------
ADK_RAT         RRTG---------------
LACC_STRP6      -------------------
HLDE_ACIBL      SKVGTAP------------
YDJH_ECOLI      LSVGATTGVKNRKLVEQLL
HLDE_DICNV      GKLGTATLTP---------
HLDE_SHEPA      AKLG---------------
IOLC_CLOPE      ASHSCSEDMP---------
IOLC_CLOP1      ASHSCSEDMP---------
HLDE_METCA      GKLGTASVSPE--------
HLDE_CAMC1      AKIGS--------------
ADK_CRIGR       RRTG---------------
Y060_BUCAI      QKIGTE-------------
LACC_STRSV      -------------------
LACC_STAHJ      -------------------
K1PF_BACSU      -------------------
HLDE_PSEPG      GKLG---------------
HLDE_PSEF5      GKLG---------------
HLDE_BLOPB      KKSGTSTS-----------
LACC_STRMU      -------------------
LACC_CLOPE      -------------------
HLDE_SHEB8      GKLG---------------
HLDE_VIBF1      -------------------
HLDE_SHESW      GKLG---------------
HLDE_SHEPC      GKLG---------------
HLDE_SHEB9      GKLG---------------
HLDE_SHEB5      GKLG---------------
HLDE_SHEB2      GKLG---------------
YIHV_ECOLI      TRPGGRAGIPDCDQTRSFL
YEGV_ECOLI      -------------------
HLDE_VIBFM      -------------------
HLDE_HAHCH      GKLGASVSAPE--------
ADK_HUMAN       RRTG---------------
Y1459_PYRHO     -------------------
KHK_PONAB       GLQG---------------
HLDE_VIBCM      -------------------
HLDE_VIBC3      -------------------
THIED_CORGL     -------------------
HLDE_PSYIN      GKIG---------------
HLDE_PSEPW      GKLG---------------
PDXK_RAT        -------------------
PDXK_PIG        -------------------
LACC_STRU0      -------------------
KHK_RAT         GLQG---------------
HLDE_VIBVY      -------------------
HLDE_VIBVU      -------------------
HLDE_PSEU5      GKLG---------------
HLDE_PSEPK      GKLG---------------
HLDE_PSEP1      GKLG---------------
Y406_METJA      EAKGCQTNLP---------
PDXK_SHIDS      -------------------
LACC_STAAR      QEA----------------
HLDE_PSEE4      GKLG---------------