[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for atum0:AAK86197.1

[Show Plain Result]


## Summary of Sequence Search
    1::294
    1::294     e-164 100%  294 aa  ARGB_AGRT5 RecName: Full=Acetylglutamate kinase;       
    1::295     e-151  92%  295 aa  ARGB_RHIE6 RecName: Full=Acetylglutamate kinase;       
    1::295     e-150  92%  295 aa  ARGB_RHIL3 RecName: Full=Acetylglutamate kinase;       
    1::295     e-150  92%  295 aa  ARGB_AGRVS RecName: Full=Acetylglutamate kinase;       
    1::295     e-150  92%  295 aa  ARGB_RHIEC RecName: Full=Acetylglutamate kinase;       
    1::295     e-149  91%  295 aa  ARGB_RHILW RecName: Full=Acetylglutamate kinase;       
    1::295     e-148  90%  295 aa  ARGB_RHIME RecName: Full=Acetylglutamate kinase;       
    1::295     e-148  90%  295 aa  ARGB_SINMW RecName: Full=Acetylglutamate kinase;       
    1::295     e-148  90%  295 aa  ARGB_RHISN RecName: Full=Acetylglutamate kinase;       
    1::295     e-148  90%  295 aa  ARGB_AGRRK RecName: Full=Acetylglutamate kinase;       
    5::297     e-143  86%  297 aa  ARGB_RHILO RecName: Full=Acetylglutamate kinase;       
   20::297     e-138  87%  297 aa  ARGB_MESSB RecName: Full=Acetylglutamate kinase;       
    1::296     e-135  83%  296 aa  ARGB_OCHA4 RecName: Full=Acetylglutamate kinase;       
    1::296     e-135  82%  296 aa  ARGB_BRUSU RecName: Full=Acetylglutamate kinase;       
    1::296     e-135  82%  296 aa  ARGB_BRUSI RecName: Full=Acetylglutamate kinase;       
    1::296     e-135  82%  296 aa  ARGB_BRUO2 RecName: Full=Acetylglutamate kinase;       
    1::296     e-135  82%  296 aa  ARGB_BRUC2 RecName: Full=Acetylglutamate kinase;       
    1::296     e-134  82%  296 aa  ARGB_BRUME RecName: Full=Acetylglutamate kinase;       
    1::296     e-134  82%  296 aa  ARGB_BRUMB RecName: Full=Acetylglutamate kinase;       
    1::296     e-134  82%  296 aa  ARGB_BRUAB RecName: Full=Acetylglutamate kinase;       
    1::296     e-134  82%  296 aa  ARGB_BRUA2 RecName: Full=Acetylglutamate kinase;       
    1::296     e-134  82%  296 aa  ARGB_BRUA1 RecName: Full=Acetylglutamate kinase;       
   13::300     e-132  82%  301 aa  ARGB_BART1 RecName: Full=Acetylglutamate kinase;       
   13::300     e-132  83%  301 aa  ARGB_BARQU RecName: Full=Acetylglutamate kinase;       
   13::300     e-131  82%  301 aa  ARGB_BARHE RecName: Full=Acetylglutamate kinase;       
   13::300     e-130  80%  301 aa  ARGB_BARBK RecName: Full=Acetylglutamate kinase;       
   12::296     e-102  64%  298 aa  ARGB_RHOPB RecName: Full=Acetylglutamate kinase;       
   12::296     e-102  63%  298 aa  ARGB_BRASO RecName: Full=Acetylglutamate kinase;       
    1::299     e-102  62%  304 aa  ARGB_METS4 RecName: Full=Acetylglutamate kinase;       
   12::296     e-101  63%  298 aa  ARGB_BRASB RecName: Full=Acetylglutamate kinase;       
   12::296     e-101  63%  298 aa  ARGB_RHOPA RecName: Full=Acetylglutamate kinase;       
   12::296     e-101  63%  298 aa  ARGB_RHOP5 RecName: Full=Acetylglutamate kinase;       
   12::296     e-101  63%  298 aa  ARGB_RHOPT RecName: Full=Acetylglutamate kinase;       
   12::296     e-101  63%  298 aa  ARGB_NITWN RecName: Full=Acetylglutamate kinase;       
    1::293     e-101  62%  295 aa  ARGB_OLICO RecName: Full=Acetylglutamate kinase;       
   12::296     e-101  62%  298 aa  ARGB_NITHX RecName: Full=Acetylglutamate kinase;       
   14::299     e-100  62%  304 aa  ARGB_METNO RecName: Full=Acetylglutamate kinase;       
   12::296     e-100  62%  298 aa  ARGB_RHOPS RecName: Full=Acetylglutamate kinase;       
   12::296     1e-99  62%  298 aa  ARGB_RHOP2 RecName: Full=Acetylglutamate kinase;       
   18::302     5e-99  62%  304 aa  ARGB_PARL1 RecName: Full=Acetylglutamate kinase;       
    1::293     2e-97  60%  295 aa  ARGB_BRAJA RecName: Full=Acetylglutamate kinase;       
   10::299     3e-94  60%  301 aa  ARGB_AZOC5 RecName: Full=Acetylglutamate kinase;       
   14::298     7e-94  58%  301 aa  ARGB_SPHWW RecName: Full=Acetylglutamate kinase;       
   18::302     6e-93  58%  305 aa  ARGB_RHOCS RecName: Full=Acetylglutamate kinase;       
   16::300     1e-91  61%  302 aa  ARGB_SPHAL RecName: Full=Acetylglutamate kinase;       
   22::306     4e-91  60%  310 aa  ARGB_RHORT RecName: Full=Acetylglutamate kinase;       
   12::296     6e-90  56%  298 aa  ARGB_GRABC RecName: Full=Acetylglutamate kinase;       
   12::293     6e-87  56%  295 aa  ARGB_GLUOX RecName: Full=Acetylglutamate kinase;       
   12::301     2e-86  57%  303 aa  ARGB_NOVAD RecName: Full=Acetylglutamate kinase;       
   13::297     2e-86  56%  299 aa  ARGB_ACICJ RecName: Full=Acetylglutamate kinase;       
    1::295     7e-85  53%  299 aa  ARGB_ERYLH RecName: Full=Acetylglutamate kinase;       
   11::294     2e-84  52%  300 aa  ARGB_SACD2 RecName: Full=Acetylglutamate kinase;       
    4::289     4e-84  55%  298 aa  ARGB_SYNFM RecName: Full=Acetylglutamate kinase;       
    3::296     5e-84  53%  297 aa  ARGB_HYPNA RecName: Full=Acetylglutamate kinase;       
    3::295     2e-83  51%  298 aa  ARGB_THICR RecName: Full=Acetylglutamate kinase;       
   11::294     2e-82  51%  302 aa  ARGB_HAHCH RecName: Full=Acetylglutamate kinase;       
   12::297     8e-82  51%  301 aa  ARGB_NITOC RecName: Full=Acetylglutamate kinase;       
   11::292     2e-81  52%  295 aa  ARGB_DECAR RecName: Full=Acetylglutamate kinase;       
    7::291     4e-81  51%  296 aa  ARGB_PELCD RecName: Full=Acetylglutamate kinase;       
    7::290     4e-81  53%  292 aa  ARGB_GEOMG RecName: Full=Acetylglutamate kinase;       
   12::295     4e-81  51%  301 aa  ARGB_CELJU RecName: Full=Acetylglutamate kinase;       
    7::290     5e-81  52%  292 aa  ARGB_GEOSL RecName: Full=Acetylglutamate kinase;       
    4::295     2e-80  50%  296 aa  ARGB_DESPS RecName: Full=Acetylglutamate kinase;       
   16::298     3e-80  51%  300 aa  ARGB_METCA RecName: Full=Acetylglutamate kinase;       
    7::290     5e-80  53%  292 aa  ARGB_GEOSM RecName: Full=Acetylglutamate kinase;       
   13::294     7e-80  52%  309 aa  ARGB_VESOH RecName: Full=Acetylglutamate kinase;       
    7::290     1e-79  53%  292 aa  ARGB_GEOBB RecName: Full=Acetylglutamate kinase;       
   10::291     2e-79  51%  295 aa  ARGB_NITEC RecName: Full=Acetylglutamate kinase;       
   15::292     3e-79  53%  296 aa  ARGB_RUTMC RecName: Full=Acetylglutamate kinase;       
    4::287     5e-79  49%  290 aa  ARGB_MARAV RecName: Full=Acetylglutamate kinase;       
   18::301     5e-79  50%  304 aa  ARGB_ALHEH RecName: Full=Acetylglutamate kinase;       
   10::293     1e-78  53%  303 aa  ARGB_ACIAD RecName: Full=Acetylglutamate kinase;       
    7::295     1e-78  48%  306 aa  ARGB_CHRSD RecName: Full=Acetylglutamate kinase;       
   20::310     2e-78  51%  313 aa  ARGB_GLUDA RecName: Full=Acetylglutamate kinase;       
   11::294     2e-78  53%  302 aa  ARGB_ACIBY RecName: Full=Acetylglutamate kinase;       
   11::294     2e-78  53%  302 aa  ARGB_ACIBT RecName: Full=Acetylglutamate kinase;       
   11::294     2e-78  53%  302 aa  ARGB_ACIBS RecName: Full=Acetylglutamate kinase;       
   11::294     2e-78  53%  302 aa  ARGB_ACIBC RecName: Full=Acetylglutamate kinase;       
   11::294     2e-78  53%  302 aa  ARGB_ACIB5 RecName: Full=Acetylglutamate kinase;       
   11::294     2e-78  53%  302 aa  ARGB_ACIB3 RecName: Full=Acetylglutamate kinase;       
   22::303     1e-77  51%  306 aa  ARGB_POLNA RecName: Full=Acetylglutamate kinase;       
   10::291     6e-77  50%  295 aa  ARGB_NITEU RecName: Full=Acetylglutamate kinase;       
   21::302     7e-77  51%  305 aa  ARGB_POLSJ RecName: Full=Acetylglutamate kinase;       
   14::297     7e-77  50%  300 aa  ARGB_AZOSB RecName: Full=Acetylglutamate kinase;       
   12::293     1e-76  51%  296 aa  ARGB_VEREI RecName: Full=Acetylglutamate kinase;       
   12::293     1e-76  51%  296 aa  ARGB_ACISJ RecName: Full=Acetylglutamate kinase;       
    7::298     2e-76  52%  299 aa  ARGB_PERMH RecName: Full=Acetylglutamate kinase;       
    9::293     2e-76  49%  294 aa  ARGB_MAGSM RecName: Full=Acetylglutamate kinase;       
    2::287     2e-76  48%  289 aa  ARGB_CHRVO RecName: Full=Acetylglutamate kinase;       
   12::293     3e-76  51%  296 aa  ARGB_DELAS RecName: Full=Acetylglutamate kinase;       
   12::293     4e-76  51%  296 aa  ARGB_ACIAC RecName: Full=Acetylglutamate kinase;       
    7::290     6e-76  48%  292 aa  ARGB_PELPD RecName: Full=Acetylglutamate kinase;       
   15::297     8e-76  50%  300 aa  ARGB_AZOSE RecName: Full=Acetylglutamate kinase;       
   15::297     1e-75  49%  300 aa  ARGB_POLSQ RecName: Full=Acetylglutamate kinase;       
   11::297     1e-75  47%  300 aa  ARGB_BORPD RecName: Full=Acetylglutamate kinase;       
   19::291     2e-75  50%  294 aa  ARGB_METFK RecName: Full=Acetylglutamate kinase;       
    1::292     2e-75  50%  296 aa  ARGB_LAWIP RecName: Full=Acetylglutamate kinase;       
    1::292     3e-75  53%  298 aa  ARGB_NOSP7 RecName: Full=Acetylglutamate kinase;       
    7::285     3e-75  53%  287 aa  ARGB_DESRM RecName: Full=Acetylglutamate kinase;       
   11::291     3e-75  52%  293 aa  ARGB_ANATD RecName: Full=Acetylglutamate kinase;       
   15::297     4e-75  49%  300 aa  ARGB_POLNS RecName: Full=Acetylglutamate kinase;       
   14::296     7e-75  49%  299 aa  ARGB_BURCM RecName: Full=Acetylglutamate kinase;       
   14::296     7e-75  49%  299 aa  ARGB_BURA4 RecName: Full=Acetylglutamate kinase;       
   14::296     1e-74  49%  299 aa  ARGB_BURS3 RecName: Full=Acetylglutamate kinase;       
   14::296     1e-74  49%  299 aa  ARGB_BURCH RecName: Full=Acetylglutamate kinase;       
   14::296     1e-74  49%  299 aa  ARGB_BURCC RecName: Full=Acetylglutamate kinase;       
   14::296     1e-74  49%  299 aa  ARGB_BURCA RecName: Full=Acetylglutamate kinase;       
   15::297     1e-74  48%  300 aa  ARGB_BORPA RecName: Full=Acetylglutamate kinase;       
   15::297     1e-74  48%  300 aa  ARGB_BORBR RecName: Full=Acetylglutamate kinase;       
   14::296     2e-74  48%  299 aa  ARGB_BURPS RecName: Full=Acetylglutamate kinase;       
   14::296     2e-74  48%  299 aa  ARGB_BURP6 RecName: Full=Acetylglutamate kinase;       
   14::296     2e-74  48%  299 aa  ARGB_BURP1 RecName: Full=Acetylglutamate kinase;       
   14::296     2e-74  48%  299 aa  ARGB_BURP0 RecName: Full=Acetylglutamate kinase;       
   14::296     2e-74  48%  299 aa  ARGB_BURMS RecName: Full=Acetylglutamate kinase;       
   14::296     2e-74  48%  299 aa  ARGB_BURMA RecName: Full=Acetylglutamate kinase;       
   14::296     2e-74  48%  299 aa  ARGB_BURM9 RecName: Full=Acetylglutamate kinase;       
   14::296     2e-74  48%  299 aa  ARGB_BURM7 RecName: Full=Acetylglutamate kinase;       
   14::296     3e-74  49%  299 aa  ARGB_BURVG RecName: Full=Acetylglutamate kinase;       
   14::296     3e-74  48%  299 aa  ARGB_BURTA RecName: Full=Acetylglutamate kinase;       
   14::296     3e-74  49%  299 aa  ARGB_BURP8 RecName: Full=Acetylglutamate kinase;       
   14::296     3e-74  49%  299 aa  ARGB_BURCJ RecName: Full=Acetylglutamate kinase;       
   15::297     3e-74  48%  300 aa  ARGB_BORA1 RecName: Full=Acetylglutamate kinase;       
    1::290     4e-74  47%  293 aa  ARGB_THIDA RecName: Full=Acetylglutamate kinase;       
   12::295     6e-74  48%  301 aa  ARGB_PSEMY RecName: Full=Acetylglutamate kinase;       
   15::297     6e-74  47%  300 aa  ARGB_BORPE RecName: Full=Acetylglutamate kinase;       
    8::277     8e-74  54%  282 aa  ARGB_THENN RecName: Full=Acetylglutamate kinase;       
   12::295     8e-74  47%  301 aa  ARGB_PSEE4 RecName: Full=Acetylglutamate kinase;       
   11::289     8e-74  50%  292 aa  ARGB_LEPBA RecName: Full=Acetylglutamate kinase;       
   14::296     8e-74  48%  299 aa  ARGB_BURXL RecName: Full=Acetylglutamate kinase;       
   14::296     8e-74  48%  299 aa  ARGB_BURPP RecName: Full=Acetylglutamate kinase;       
    7::295     8e-74  50%  298 aa  ARGB_AQUAE RecName: Full=Acetylglutamate kinase;       
   12::295     1e-73  47%  301 aa  ARGB_PSEF5 RecName: Full=Acetylglutamate kinase;       
   12::295     1e-73  47%  301 aa  ARGB_PSEFS RecName: Full=Acetylglutamate kinase;       
    5::294     1e-73  47%  297 aa  ARGB_HERAR RecName: Full=Acetylglutamate kinase;       
    7::290     2e-73  50%  293 aa  ARGB_NITMU RecName: Full=Acetylglutamate kinase;       
   12::295     2e-73  47%  300 aa  ARGB_PSEU5 RecName: Full=Acetylglutamate kinase;       
    1::295     2e-73  50%  296 aa  ARGB_MOOTA RecName: Full=Acetylglutamate kinase;       
    5::294     2e-73  47%  297 aa  ARGB_JANMA RecName: Full=Acetylglutamate kinase;       
   13::302     2e-73  51%  304 aa  ARGB_CAUCR RecName: Full=Acetylglutamate kinase;       
   13::302     2e-73  51%  304 aa  ARGB_CAUCN RecName: Full=Acetylglutamate kinase;       
   16::292     3e-73  51%  297 aa  ARGB_ANAVT RecName: Full=Acetylglutamate kinase;       
   32::317     4e-73  49%  321 aa  ARGB_EHRCR RecName: Full=Acetylglutamate kinase;       
   14::284     4e-73  51%  287 aa  ARGB_DINSH RecName: Full=Acetylglutamate kinase;       
   12::295     5e-73  47%  301 aa  ARGB_PSEPK RecName: Full=Acetylglutamate kinase;       
   12::295     5e-73  47%  301 aa  ARGB_PSEP1 RecName: Full=Acetylglutamate kinase;       
    8::289     5e-73  52%  299 aa  ARGB_PETMO RecName: Full=Acetylglutamate kinase;       
    1::296     5e-73  48%  298 aa  ARGB_METST RecName: Full=Acetylglutamate kinase;       
   20::301     5e-73  49%  304 aa  ARGB_METPP RecName: Full=Acetylglutamate kinase;       
    7::283     6e-73  51%  295 aa  ARGB_THEEB RecName: Full=Acetylglutamate kinase;       
   12::295     6e-73  47%  301 aa  ARGB_PSEPG RecName: Full=Acetylglutamate kinase;       
   16::292     6e-73  51%  297 aa  ARGB_ANASP RecName: Full=Acetylglutamate kinase;       
   12::295     8e-73  47%  301 aa  ARGB_PSEPW RecName: Full=Acetylglutamate kinase;       
    3::292     8e-73  51%  304 aa  ARGB_CLOTH RecName: Full=Acetylglutamate kinase;       
   11::291     8e-73  51%  293 aa  ARGB_CALS8 RecName: Full=Acetylglutamate kinase;       
   25::307     1e-72  48%  310 aa  ARGB_RALSO RecName: Full=Acetylglutamate kinase;       
   24::306     1e-72  48%  309 aa  ARGB_RALME RecName: Full=Acetylglutamate kinase;       
   12::295     1e-72  47%  301 aa  ARGB_PSEPF RecName: Full=Acetylglutamate kinase;       
    7::287     1e-72  49%  290 aa  ARGB_HALOH RecName: Full=Acetylglutamate kinase;       
    7::294     1e-72  47%  308 aa  ARGB_DESVV RecName: Full=Acetylglutamate kinase;       
    7::294     1e-72  47%  308 aa  ARGB_DESVH RecName: Full=Acetylglutamate kinase;       
   14::298     2e-72  49%  301 aa  ARGB_ZYMMO RecName: Full=Acetylglutamate kinase;       
   12::295     2e-72  47%  301 aa  ARGB_PSEU2 RecName: Full=Acetylglutamate kinase;       
   12::295     2e-72  47%  301 aa  ARGB_PSESM RecName: Full=Acetylglutamate kinase;       
   12::295     2e-72  47%  301 aa  ARGB_PSE14 RecName: Full=Acetylglutamate kinase;       
    4::295     3e-72  49%  302 aa  ARGB_MARMS RecName: Full=Acetylglutamate kinase;       
    7::290     3e-72  47%  292 aa  ARGB_GEOLS RecName: Full=Acetylglutamate kinase;       
   34::318     3e-72  48%  322 aa  ARGB_EHRRG RecName: Full=Acetylglutamate kinase;       
    7::297     4e-72  52%  299 aa  ARGB_SULSY RecName: Full=Acetylglutamate kinase;       
   34::318     4e-72  48%  322 aa  ARGB_EHRRW RecName: Full=Acetylglutamate kinase;       
   12::295     5e-72  46%  301 aa  ARGB_PSEA7 RecName: Full=Acetylglutamate kinase;       
   24::302     7e-72  48%  305 aa  ARGB_RALEH RecName: Full=Acetylglutamate kinase;       
   12::295     7e-72  46%  301 aa  ARGB_PSEAE RecName: Full=Acetylglutamate kinase;       
   12::295     7e-72  46%  301 aa  ARGB_PSEAB RecName: Full=Acetylglutamate kinase;       
   12::295     7e-72  46%  301 aa  ARGB_PSEA8 RecName: Full=Acetylglutamate kinase;       
   35::319     7e-72  48%  323 aa  ARGB_EHRCJ RecName: Full=Acetylglutamate kinase;       
    6::281     9e-72  52%  286 aa  ARGB_CLOD6 RecName: Full=Acetylglutamate kinase;       
   13::302     2e-71  50%  304 aa  ARGB_CAUSK RecName: Full=Acetylglutamate kinase;       
   12::289     3e-71  50%  299 aa  ARGB_THETN RecName: Full=Acetylglutamate kinase;       
    7::294     5e-71  48%  303 aa  ARGB_PSYA2 RecName: Full=Acetylglutamate kinase;       
   11::297     5e-71  50%  300 aa  ARGB_METJA RecName: Full=Probable acetylglutamate kinase;       
    7::294     8e-71  48%  299 aa  ARGB_PSYCK RecName: Full=Acetylglutamate kinase;       
    4::295     8e-71  45%  300 aa  ARGB_HALHL RecName: Full=Acetylglutamate kinase;       
    7::288     2e-70  49%  295 aa  ARGB_METLZ RecName: Full=Acetylglutamate kinase;       
    7::282     2e-70  51%  283 aa  ARGB_CLOK5 RecName: Full=Acetylglutamate kinase;       
    7::282     2e-70  51%  283 aa  ARGB_CLOK1 RecName: Full=Acetylglutamate kinase;       
    7::282     3e-70  49%  284 aa  ARGB_ACAM1 RecName: Full=Acetylglutamate kinase;       
   13::289     4e-70  49%  301 aa  ARGB_SYNP6 RecName: Full=Acetylglutamate kinase;       
   13::289     4e-70  49%  301 aa  ARGB_SYNE7 RecName: Full=Acetylglutamate kinase;       
    7::293     4e-70  48%  295 aa  ARGB_PELTS RecName: Full=Acetylglutamate kinase;       
    1::296     4e-70  45%  299 aa  ARGB_ALCBS RecName: Full=Acetylglutamate kinase;       
   33::306     5e-70  48%  309 aa  ARGB_RALEJ RecName: Full=Acetylglutamate kinase;       
    6::290     5e-70  48%  292 aa  ARGB_METS3 RecName: Full=Acetylglutamate kinase;       
    8::285     7e-70  50%  287 aa  ARGB_SYNWW RecName: Full=Acetylglutamate kinase;       
    8::277     2e-69  52%  282 aa  ARGB_THESQ RecName: Full=Acetylglutamate kinase;       
    8::277     2e-69  52%  282 aa  ARGB_THEMA RecName: Full=Acetylglutamate kinase;       
    8::277     3e-69  52%  282 aa  ARGB_THEP1 RecName: Full=Acetylglutamate kinase;       
   13::283     3e-69  50%  285 aa  ARGB_JANSC RecName: Full=Acetylglutamate kinase;       
   10::295     3e-69  45%  296 aa  ARGB_SYNAS RecName: Full=Acetylglutamate kinase;       
    7::277     3e-69  49%  282 aa  ARGB_KOSOT RecName: Full=Acetylglutamate kinase;       
   16::291     3e-69  49%  297 aa  ARGB_DESMR RecName: Full=Acetylglutamate kinase;       
    7::294     3e-69  48%  294 aa  ARGB_CARHZ RecName: Full=Acetylglutamate kinase;       
   13::289     4e-69  50%  299 aa  ARGB_THEP3 RecName: Full=Acetylglutamate kinase;       
    6::294     7e-69  45%  303 aa  ARGB_PSYWF RecName: Full=Acetylglutamate kinase;       
    2::292     7e-69  46%  294 aa  ARGB_METM7 RecName: Full=Acetylglutamate kinase;       
    7::284     1e-68  51%  285 aa  ARGB_CLOB8 RecName: Full=Acetylglutamate kinase;       
   13::289     2e-68  49%  299 aa  ARGB_THEPX RecName: Full=Acetylglutamate kinase;       
   12::293     2e-68  46%  296 aa  ARGB_RHOFD RecName: Full=Acetylglutamate kinase;       
    3::282     4e-68  47%  284 aa  ARGB_PROMP RecName: Full=Acetylglutamate kinase;       
    2::292     4e-68  46%  294 aa  ARGB_METM6 RecName: Full=Acetylglutamate kinase;       
   20::297     5e-68  49%  312 aa  ARGB_SYNJB RecName: Full=Acetylglutamate kinase;       
   10::295     5e-68  49%  298 aa  ARGB_DESHY RecName: Full=Acetylglutamate kinase;       
    7::291     6e-68  46%  292 aa  ARGB_GEOUR RecName: Full=Acetylglutamate kinase;       
    7::294     8e-68  46%  295 aa  ARGB_HELMI RecName: Full=Acetylglutamate kinase;       
    6::291     1e-67  47%  293 aa  ARGB_METTH RecName: Full=Probable acetylglutamate kinase;       
   10::295     1e-67  48%  298 aa  ARGB_DESHD RecName: Full=Acetylglutamate kinase;       
    8::279     1e-67  49%  280 aa  ARGB_CAMFF RecName: Full=Acetylglutamate kinase;       
    8::285     1e-67  48%  300 aa  ARGB_SYNJA RecName: Full=Acetylglutamate kinase;       
    2::291     2e-67  44%  294 aa  ARGB_META3 RecName: Full=Acetylglutamate kinase;       
    9::291     5e-67  49%  292 aa  ARGB_TRIEI RecName: Full=Acetylglutamate kinase;       
    2::292     7e-67  46%  294 aa  ARGB_METM5 RecName: Full=Acetylglutamate kinase;       
   11::291     3e-66  48%  297 aa  ARGB_SYNY3 RecName: Full=Acetylglutamate kinase;       
    7::288     8e-66  47%  291 aa  ARGB_METB6 RecName: Full=Acetylglutamate kinase;       
    6::284     1e-65  48%  300 aa  ARGB_CLOPH RecName: Full=Acetylglutamate kinase;       
   11::282     2e-65  50%  284 aa  ARGB_NITSB RecName: Full=Acetylglutamate kinase;       
    9::282     1e-64  47%  283 aa  ARGB_PROM9 RecName: Full=Acetylglutamate kinase;       
    9::282     1e-64  48%  283 aa  ARGB_PROM0 RecName: Full=Acetylglutamate kinase;       
    8::279     1e-64  47%  283 aa  ARGB_CAMHC RecName: Full=Acetylglutamate kinase;       
    2::281     4e-64  47%  283 aa  ARGB_PROM5 RecName: Full=Acetylglutamate kinase;       
   14::284     5e-64  46%  286 aa  ARGB_SILST RecName: Full=Acetylglutamate kinase;       
    9::282     5e-64  47%  283 aa  ARGB_PROMS RecName: Full=Acetylglutamate kinase;       
    9::282     5e-64  47%  283 aa  ARGB_PROM2 RecName: Full=Acetylglutamate kinase;       
    2::284     5e-64  47%  285 aa  ARGB_PORYE RecName: Full=Acetylglutamate kinase;       
    9::281     2e-63  49%  283 aa  ARGB_SULNB RecName: Full=Acetylglutamate kinase;       
   14::292     2e-63  46%  294 aa  ARGB_LEPIN RecName: Full=Acetylglutamate kinase;       
   14::292     2e-63  46%  294 aa  ARGB_LEPIC RecName: Full=Acetylglutamate kinase;       
    8::279     3e-63  49%  281 aa  ARGB_CAMC5 RecName: Full=Acetylglutamate kinase;       
    4::295     4e-63  42%  300 aa  ARGB_AZOVD RecName: Full=Acetylglutamate kinase;       
   11::281     6e-63  49%  283 aa  ARGB_SULDN RecName: Full=Acetylglutamate kinase;       
    6::289     8e-63  44%  289 aa  ARGB_METPE RecName: Full=Acetylglutamate kinase;       
   18::298     1e-62  44%  303 aa  ARGB_GLOVI RecName: Full=Acetylglutamate kinase;       
   12::288     2e-62  45%  295 aa  ARGB_MICAN RecName: Full=Acetylglutamate kinase;       
    6::292     3e-62  44%  294 aa  ARGB_METVS RecName: Full=Acetylglutamate kinase;       
    6::287     3e-62  42%  294 aa  ARGB_METHJ RecName: Full=Acetylglutamate kinase;       
    2::282     3e-62  45%  304 aa  ARGB_CYACA RecName: Full=Acetylglutamate kinase;       
   18::300     4e-62  44%  306 aa  ARGB_STRCO RecName: Full=Acetylglutamate kinase;       
    2::292     4e-62  43%  294 aa  ARGB_METMP RecName: Full=Acetylglutamate kinase;       
   11::289     5e-62  45%  291 aa  ARGB_LEPBJ RecName: Full=Acetylglutamate kinase;       
    8::276     7e-62  46%  279 aa  ARGB_THELT RecName: Full=Acetylglutamate kinase;       
    8::294     7e-62  42%  295 aa  ARGB_SALAI RecName: Full=Acetylglutamate kinase;       
   11::289     7e-62  45%  291 aa  ARGB_LEPBL RecName: Full=Acetylglutamate kinase;       
    6::290     9e-62  44%  290 aa  ARGB_ARCFU RecName: Full=Probable acetylglutamate kinase;       
   14::296     1e-61  44%  304 aa  ARGB_STRAW RecName: Full=Acetylglutamate kinase;       
   41::322     1e-61  43%  343 aa  ARGB_FRAAA RecName: Full=Acetylglutamate kinase;       
   10::282     2e-61  47%  284 aa  ARGB_WOLSU RecName: Full=Acetylglutamate kinase;       
    9::277     3e-61  48%  280 aa  ARGB_NAUPA RecName: Full=Acetylglutamate kinase;       
    2::274     3e-61  46%  280 aa  ARGB_HELHP RecName: Full=Acetylglutamate kinase;       
   11::299     4e-61  44%  317 aa  ARGB_CORJK RecName: Full=Acetylglutamate kinase;       
   24::301     6e-61  45%  304 aa  ARGB_PROMA RecName: Full=Acetylglutamate kinase;       
    9::280     2e-60  47%  293 aa  ARGB_RHOSK RecName: Full=Acetylglutamate kinase;       
    9::280     2e-60  47%  293 aa  ARGB_RHOS4 RecName: Full=Acetylglutamate kinase;       
    9::280     2e-60  47%  293 aa  ARGB_RHOS1 RecName: Full=Acetylglutamate kinase;       
   14::284     2e-60  45%  287 aa  ARGB_ROSDO RecName: Full=Acetylglutamate kinase;       
   10::294     3e-60  42%  317 aa  ARGB_CORGB RecName: Full=Acetylglutamate kinase;       
    1::279     4e-60  43%  302 aa  ARGB_COREF RecName: Full=Acetylglutamate kinase;       
   17::282     6e-60  47%  283 aa  ARGB_PORUM RecName: Full=Acetylglutamate kinase;       
   17::282     6e-60  47%  283 aa  ARGB_PORPU RecName: Full=Acetylglutamate kinase;       
   49::329     6e-60  43%  362 aa  ARGB_FRASC RecName: Full=Acetylglutamate kinase;       
    7::290     8e-60  42%  295 aa  ARGB_DESDG RecName: Full=Acetylglutamate kinase;       
   11::298     1e-59  44%  312 aa  ARGB_NOCSJ RecName: Full=Acetylglutamate kinase;       
    9::280     2e-59  47%  292 aa  ARGB_RHOS5 RecName: Full=Acetylglutamate kinase;       
    7::278     1e-58  49%  279 aa  ARGB_CAMJR RecName: Full=Acetylglutamate kinase;       
    5::293     2e-58  42%  302 aa  ARGB_THEFY RecName: Full=Acetylglutamate kinase;       
    7::285     2e-58  45%  287 aa  ARGB_HYDS0 RecName: Full=Acetylglutamate kinase;       
   13::290     3e-58  45%  296 aa  ARGB_SYNR3 RecName: Full=Acetylglutamate kinase;       
   16::297     3e-58  43%  308 aa  ARGB_RHOSR RecName: Full=Acetylglutamate kinase;       
   12::292     3e-58  42%  298 aa  ARGB_NEIM0 RecName: Full=Acetylglutamate kinase;       
   12::292     6e-58  42%  298 aa  ARGB_NEIG2 RecName: Full=Acetylglutamate kinase;       
    4::300     6e-58  42%  300 aa  ARGB_KINRD RecName: Full=Acetylglutamate kinase;       
   12::292     8e-58  42%  298 aa  ARGB_NEIG1 RecName: Full=Acetylglutamate kinase;       
   26::286     1e-57  45%  288 aa  ARGB_PELUB RecName: Full=Acetylglutamate kinase;       
    7::278     1e-57  48%  279 aa  ARGB_CAMJ8 RecName: Full=Acetylglutamate kinase;       
   18::297     2e-57  43%  304 aa  ARGB_CORU7 RecName: Full=Acetylglutamate kinase;       
   12::292     3e-57  42%  298 aa  ARGB_NEIMA RecName: Full=Acetylglutamate kinase;       
   12::294     4e-57  39%  312 aa  ARGB_STRGG RecName: Full=Acetylglutamate kinase;       
   12::292     4e-57  42%  298 aa  ARGB_NEIMB RecName: Full=Acetylglutamate kinase;       
   19::301     6e-57  42%  304 aa  ARGB_PROM1 RecName: Full=Acetylglutamate kinase;       
   12::292     6e-57  42%  298 aa  ARGB_NEIMF RecName: Full=Acetylglutamate kinase;       
   19::301     8e-57  42%  304 aa  ARGB_PROMT RecName: Full=Acetylglutamate kinase;       
    8::292     1e-56  41%  293 aa  ARGB_SYMTH RecName: Full=Acetylglutamate kinase;       
    7::290     2e-56  44%  301 aa  ARGB_SYNS9 RecName: Full=Acetylglutamate kinase;       
   14::285     3e-56  44%  304 aa  ARGB_PARDP RecName: Full=Acetylglutamate kinase;       
   16::289     3e-56  45%  290 aa  ARGB_CYAME RecName: Full=Acetylglutamate kinase;       
   10::292     1e-55  41%  302 aa  ARGB_STRCL RecName: Full=Acetylglutamate kinase;       
   31::314     1e-55  43%  322 aa  ARGB_METBF RecName: Full=Acetylglutamate kinase;       
    1::271     2e-55  42%  294 aa  ARGB_CORGL RecName: Full=Acetylglutamate kinase;       
    7::285     3e-55  44%  287 aa  ARGB_RHOBA RecName: Full=Acetylglutamate kinase;       
   13::296     3e-55  46%  305 aa  ARGB_RENSM RecName: Full=Acetylglutamate kinase;       
   14::285     3e-55  42%  286 aa  ARGB_CHLCH RecName: Full=Acetylglutamate kinase;       
    2::282     3e-55  43%  301 aa  ARGB_ARCB4 RecName: Full=Acetylglutamate kinase;       
   10::294     4e-55  39%  295 aa  ARGB_SALTO RecName: Full=Acetylglutamate kinase;       
   21::292     8e-55  41%  303 aa  ARGB_CHLPD RecName: Full=Acetylglutamate kinase;       
   15::283     1e-54  42%  295 aa  ARGB_CLOAB RecName: Full=Acetylglutamate kinase;       
    7::284     2e-54  42%  285 aa  ARGB_GRATL RecName: Full=Acetylglutamate kinase;       
    7::278     5e-54  46%  279 aa  ARGB_CAMJD RecName: Full=Acetylglutamate kinase;       
   14::284     7e-54  43%  287 aa  ARGB_SILPO RecName: Full=Acetylglutamate kinase;       
   23::305     9e-54  41%  308 aa  ARGB_PROMM RecName: Full=Acetylglutamate kinase;       
    7::278     9e-54  45%  279 aa  ARGB_CAMJE RecName: Full=Acetylglutamate kinase;       
    1::284     1e-53  43%  288 aa  ARGB_BRAHW RecName: Full=Acetylglutamate kinase;       
    7::290     1e-53  41%  292 aa  ARGB_GEOSF RecName: Full=Acetylglutamate kinase;       
   25::296     2e-53  41%  305 aa  ARGB_PELLD RecName: Full=Acetylglutamate kinase;       
    7::278     2e-53  45%  279 aa  ARGB_CAMJJ RecName: Full=Acetylglutamate kinase;       
   22::293     3e-53  41%  304 aa  ARGB_CHLL2 RecName: Full=Acetylglutamate kinase;       
    6::287     4e-53  39%  289 aa  ARGB_METMJ RecName: Full=Acetylglutamate kinase;       
   23::305     6e-53  41%  308 aa  ARGB_PROM3 RecName: Full=Acetylglutamate kinase;       
   23::293     6e-53  41%  304 aa  ARGB_PELPB RecName: Full=Acetylglutamate kinase;       
    3::293     1e-52  41%  305 aa  ARGB_BIFLI RecName: Full=Acetylglutamate kinase;       
   22::293     2e-52  41%  302 aa  ARGB_PROVI RecName: Full=Acetylglutamate kinase;       
    3::293     3e-52  40%  305 aa  ARGB_BIFLO RecName: Full=Acetylglutamate kinase;       
   19::295     4e-52  42%  300 aa  ARGB_UNCMA RecName: Full=Acetylglutamate kinase;       
    7::290     4e-52  42%  293 aa  ARGB_SYNPX RecName: Full=Acetylglutamate kinase;       
    8::291     4e-52  40%  292 aa  ARGB_METMA RecName: Full=Acetylglutamate kinase;       
   16::299     5e-52  39%  304 aa  ARGB_METBU RecName: Full=Acetylglutamate kinase;       
    8::291     5e-52  38%  299 aa  ARGB_METAC RecName: Full=Acetylglutamate kinase;       
   12::302     8e-52  40%  314 aa  ARGB_BIFLD RecName: Full=Acetylglutamate kinase;       
    2::282     1e-51  41%  285 aa  ARGB_SYNS3 RecName: Full=Acetylglutamate kinase;       
    8::290     1e-51  41%  293 aa  ARGB_SYNSC RecName: Full=Acetylglutamate kinase;       
   12::303     1e-51  39%  310 aa  ARGB_PROAC RecName: Full=Acetylglutamate kinase;       
    8::282     1e-51  42%  316 aa  ARGB_ALKMQ RecName: Full=Acetylglutamate kinase;       
    2::281     4e-51  39%  283 aa  ARGB_LACLS RecName: Full=Acetylglutamate kinase;       
   19::302     9e-51  37%  312 aa  ARGB_BEUC1 RecName: Full=Acetylglutamate kinase;       
    9::292     2e-50  39%  294 aa  ARGB_MYCTU RecName: Full=Acetylglutamate kinase;       
    9::292     2e-50  39%  294 aa  ARGB_MYCTA RecName: Full=Acetylglutamate kinase;       
    9::292     2e-50  39%  294 aa  ARGB_MYCBT RecName: Full=Acetylglutamate kinase;       
    9::292     2e-50  39%  294 aa  ARGB_MYCBP RecName: Full=Acetylglutamate kinase;       
    9::292     2e-50  39%  294 aa  ARGB_MYCBO RecName: Full=Acetylglutamate kinase;       
    5::291     5e-50  39%  293 aa  ARGB_MYCS2 RecName: Full=Acetylglutamate kinase;       
    3::281     5e-50  39%  283 aa  ARGB_LACLM RecName: Full=Acetylglutamate kinase;       
   10::290     8e-50  39%  293 aa  ARGB_SYNPW RecName: Full=Acetylglutamate kinase;       
    9::296     1e-49  38%  296 aa  ARGB_ACIC1 RecName: Full=Acetylglutamate kinase;       
   10::294     4e-49  38%  310 aa  ARGB_CORDI RecName: Full=Acetylglutamate kinase;       
   16::297     5e-49  37%  303 aa  ARGB_SACEN RecName: Full=Acetylglutamate kinase;       
    1::271     5e-49  40%  285 aa  ARGB_CHLTE RecName: Full=Acetylglutamate kinase;       
    5::285     8e-49  38%  289 aa  ARGB_METTP RecName: Full=Acetylglutamate kinase;       
    1::280     1e-48  42%  284 aa  ARGB_ACTP7 RecName: Full=Acetylglutamate kinase;       
   12::293     2e-48  38%  303 aa  ARGB_NOCFA RecName: Full=Acetylglutamate kinase;       
    4::238     2e-48  43%  258 aa  ARGB_GEOTN RecName: Full=Acetylglutamate kinase;       
    3::281     2e-48  38%  283 aa  ARGB_LACLA RecName: Full=Acetylglutamate kinase;       
   18::273     2e-48  42%  284 aa  ARGB_HAEDU RecName: Full=Acetylglutamate kinase;       
    5::247     3e-48  42%  260 aa  ARGB_BACHD RecName: Full=Acetylglutamate kinase;       
    1::280     4e-48  42%  284 aa  ARGB_ACTPJ RecName: Full=Acetylglutamate kinase;       
   12::293     6e-48  38%  295 aa  ARGB_MYCPA RecName: Full=Acetylglutamate kinase;       
    8::291     7e-48  38%  293 aa  ARGB_MYCUA RecName: Full=Acetylglutamate kinase;       
    1::280     7e-48  42%  284 aa  ARGB_ACTP2 RecName: Full=Acetylglutamate kinase;       
   12::293     1e-47  38%  295 aa  ARGB_MYCA1 RecName: Full=Acetylglutamate kinase;       
    8::291     5e-47  37%  293 aa  ARGB_MYCMM RecName: Full=Acetylglutamate kinase;       
   12::295     5e-47  38%  297 aa  ARGB_MYCLE RecName: Full=Acetylglutamate kinase;       
    3::264     6e-47  40%  272 aa  ARGB_DEHSC RecName: Full=Acetylglutamate kinase;       
    3::264     6e-47  40%  272 aa  ARGB_DEHSB RecName: Full=Acetylglutamate kinase;       
   22::292     6e-47  39%  301 aa  ARGB_CHLP8 RecName: Full=Acetylglutamate kinase;       
    6::235     8e-47  43%  249 aa  ARGB_UNCTG RecName: Full=Acetylglutamate kinase;       
    2::236     8e-47  43%  258 aa  ARGB_BACP2 RecName: Full=Acetylglutamate kinase;       
   11::293     8e-47  38%  297 aa  ARGB_AKKM8 RecName: Full=Acetylglutamate kinase;       
    3::238     1e-46  42%  257 aa  ARGB_GEOSW RecName: Full=Acetylglutamate kinase;       
    1::288     7e-46  37%  291 aa  ARGB_MYCVP RecName: Full=Acetylglutamate kinase;       
   22::301     2e-45  37%  302 aa  ARGB_LEIXX RecName: Full=Acetylglutamate kinase;       
   12::304     4e-45  39%  310 aa  ARGB_ARTS2 RecName: Full=Acetylglutamate kinase;       
    3::255     1e-44  42%  257 aa  ARGB_SOLUE RecName: Full=Acetylglutamate kinase;       
    2::288     1e-44  35%  290 aa  ARGB_MYCSJ RecName: Full=Acetylglutamate kinase;       
    8::288     1e-44  37%  290 aa  ARGB_MYCGI RecName: Full=Acetylglutamate kinase;       
    3::235     1e-44  43%  261 aa  ARGB_ACIBL RecName: Full=Acetylglutamate kinase;       
    3::237     8e-44  40%  258 aa  ARGB_GEOKA RecName: Full=Acetylglutamate kinase;       
   14::310     2e-43  39%  316 aa  ARGB_ARTAT RecName: Full=Acetylglutamate kinase;       
   10::293     9e-43  37%  305 aa  ARGB_BIFA0 RecName: Full=Acetylglutamate kinase;       
   17::302     2e-42  35%  303 aa  ARGB_CLAMS RecName: Full=Acetylglutamate kinase;       
   12::313     2e-42  37%  319 aa  ARGB_ARTCA RecName: Full=Acetylglutamate kinase;       
    3::265     3e-42  36%  272 aa  ARGB_DEHE1 RecName: Full=Acetylglutamate kinase;       
   19::302     6e-42  35%  303 aa  ARGB_CLAM3 RecName: Full=Acetylglutamate kinase;       
   16::306     1e-41  36%  318 aa  ARGB_BIFAA RecName: Full=Acetylglutamate kinase;       
    4::241     2e-41  41%  260 aa  ARGB_ACIC5 RecName: Full=Acetylglutamate kinase;       
    3::237     2e-41  39%  258 aa  ARGB_BACST RecName: Full=Acetylglutamate kinase;       
    3::245     1e-40  40%  246 aa  ARGB_METKA RecName: Full=Acetylglutamate kinase;       
    2::288     2e-40  33%  290 aa  ARGB_MYCSS RecName: Full=Acetylglutamate kinase;       
    2::288     2e-40  33%  290 aa  ARGB_MYCSK RecName: Full=Acetylglutamate kinase;       
   11::296     2e-39  33%  308 aa  ARGB_MYXXD RecName: Full=Acetylglutamate kinase;       
    3::257     5e-39  39%  265 aa  ARGB_OCEIH RecName: Full=Acetylglutamate kinase;       
    2::270     8e-39  38%  271 aa  ARGB_ANADF RecName: Full=Acetylglutamate kinase;       
    3::236     1e-38  39%  258 aa  ARGB_BACSU RecName: Full=Acetylglutamate kinase;       
    3::236     1e-38  39%  258 aa  ARGB_BACAM RecName: Full=Acetylglutamate kinase;       
    3::236     3e-38  41%  258 aa  ARGB_BACA2 RecName: Full=Acetylglutamate kinase;       
    4::273     4e-38  34%  284 aa  ARGB_CLONN RecName: Full=Acetylglutamate kinase;       
   10::251     1e-37  40%  259 aa  ARGB_ROSCS RecName: Full=Acetylglutamate kinase;       
   17::284     2e-37  37%  284 aa  ARGB_SORC5 RecName: Full=Acetylglutamate kinase;       
    5::258     3e-37  38%  265 aa  ARGB_BREBN RecName: Full=Acetylglutamate kinase;       
    3::253     3e-37  39%  261 aa  ARGB_BACFR RecName: Full=Acetylglutamate kinase;       
    3::253     3e-37  39%  261 aa  ARGB_BACFN RecName: Full=Acetylglutamate kinase;       
    6::236     3e-37  41%  254 aa  ARGB_CHLAD RecName: Full=Acetylglutamate kinase;       
    4::241     6e-37  42%  257 aa  ARGB_BACTN RecName: Full=Acetylglutamate kinase;       
    3::236     6e-37  38%  258 aa  ARGB_BACLD RecName: Full=Acetylglutamate kinase;       
    2::255     2e-36  41%  257 aa  ARGB_BACV8 RecName: Full=Acetylglutamate kinase;       
    2::248     4e-36  40%  255 aa  ARGB_BACAH RecName: Full=Acetylglutamate kinase;       
    3::247     8e-36  38%  255 aa  ARGB_PARD8 RecName: Full=Acetylglutamate kinase;       
    5::244     2e-35  40%  255 aa  ARGB_BACCZ RecName: Full=Acetylglutamate kinase;       
    2::244     2e-35  40%  255 aa  ARGB_BACC3 RecName: Full=Acetylglutamate kinase;       
    3::247     3e-35  38%  257 aa  ARGB_BACSK RecName: Full=Acetylglutamate kinase;       
    5::248     3e-35  39%  255 aa  ARGB_BACCQ RecName: Full=Acetylglutamate kinase;       
    5::248     3e-35  39%  255 aa  ARGB_BACC7 RecName: Full=Acetylglutamate kinase;       
    2::269     3e-35  36%  270 aa  ARGB_ANADE RecName: Full=Acetylglutamate kinase;       
    2::244     5e-35  39%  255 aa  ARGB_BACC0 RecName: Full=Acetylglutamate kinase;       
    2::244     5e-35  39%  255 aa  ARGB_BACAN RecName: Full=Acetylglutamate kinase;       
    2::244     5e-35  39%  255 aa  ARGB_BACAA RecName: Full=Acetylglutamate kinase;       
    2::244     2e-34  39%  255 aa  ARGB_BACHK RecName: Full=Acetylglutamate kinase;       
    2::270     2e-34  35%  272 aa  ARGB_ANASK RecName: Full=Acetylglutamate kinase;       
    5::248     3e-34  40%  255 aa  ARGB_BACC1 RecName: Full=Acetylglutamate kinase;       
    2::270     3e-34  35%  272 aa  ARGB_ANAD2 RecName: Full=Acetylglutamate kinase;       
    2::231     5e-34  39%  255 aa  ARGB_BACAC RecName: Full=Acetylglutamate kinase;       
    3::262     2e-33  37%  264 aa  ARGB_CYTH3 RecName: Full=Acetylglutamate kinase;       
    5::248     2e-33  39%  255 aa  ARGB_BACCR RecName: Full=Acetylglutamate kinase;       
    2::264     3e-33  37%  264 aa  ARGB_IGNH4 RecName: Full=Acetylglutamate/acetylaminoadipate kinase;
    6::236     4e-33  39%  254 aa  ARGB_CHLSY RecName: Full=Acetylglutamate kinase;       
    6::236     4e-33  39%  254 aa  ARGB_CHLAA RecName: Full=Acetylglutamate kinase;       
    2::252     1e-32  38%  256 aa  ARGB_STAAR RecName: Full=Acetylglutamate kinase;       
    5::248     1e-32  37%  255 aa  ARGB_BACC4 RecName: Full=Acetylglutamate kinase;       
    5::248     2e-32  36%  255 aa  ARGB_BACC2 RecName: Full=Acetylglutamate kinase;       
    5::248     3e-32  38%  255 aa  ARGB_BACWK RecName: Full=Acetylglutamate kinase;       
    2::252     4e-32  38%  254 aa  ARGB_STAAW RecName: Full=Acetylglutamate kinase;       
    2::252     4e-32  38%  254 aa  ARGB_STAAT RecName: Full=Acetylglutamate kinase;       
    2::252     4e-32  38%  254 aa  ARGB_STAAS RecName: Full=Acetylglutamate kinase;       
    2::252     4e-32  38%  254 aa  ARGB_STAAN RecName: Full=Acetylglutamate kinase;       
    2::252     4e-32  38%  254 aa  ARGB_STAAM RecName: Full=Acetylglutamate kinase;       
    2::252     4e-32  38%  254 aa  ARGB_STAAE RecName: Full=Acetylglutamate kinase;       
    2::252     4e-32  38%  254 aa  ARGB_STAAC RecName: Full=Acetylglutamate kinase;       
    2::252     4e-32  37%  256 aa  ARGB_STAAB RecName: Full=Acetylglutamate kinase;       
    2::252     4e-32  38%  254 aa  ARGB_STAA9 RecName: Full=Acetylglutamate kinase;       
    2::252     4e-32  38%  254 aa  ARGB_STAA8 RecName: Full=Acetylglutamate kinase;       
    2::252     4e-32  38%  254 aa  ARGB_STAA3 RecName: Full=Acetylglutamate kinase;       
    2::252     4e-32  38%  254 aa  ARGB_STAA2 RecName: Full=Acetylglutamate kinase;       
    2::252     4e-32  38%  254 aa  ARGB_STAA1 RecName: Full=Acetylglutamate kinase;       
    2::252     9e-32  33%  267 aa  ARGB_NITMS RecName: Full=Acetylglutamate/acetylaminoadipate kinase;
    4::232     9e-32  38%  250 aa  ARGB_LISMF RecName: Full=Acetylglutamate kinase;       
    4::232     2e-31  38%  250 aa  ARGB_LISMC RecName: Full=Acetylglutamate kinase;       
    9::260     3e-31  38%  261 aa  ARGB_ROSS1 RecName: Full=Acetylglutamate kinase;       
    2::257     4e-31  35%  257 aa  ARGB_ACTSZ RecName: Full=Acetylglutamate kinase;       
    4::252     1e-30  37%  253 aa  ARGB_STAS1 RecName: Full=Acetylglutamate kinase;       
    5::234     2e-30  34%  245 aa  ARGB_STAES RecName: Full=Acetylglutamate kinase;       
    5::234     2e-30  34%  245 aa  ARGB_STAEQ RecName: Full=Acetylglutamate kinase;       
    4::234     2e-30  36%  250 aa  ARGB_LISMH RecName: Full=Acetylglutamate kinase;       
    1::291     2e-30  32%  292 aa  ARGB_OPITP RecName: Full=Acetylglutamate kinase;       
    5::232     4e-30  34%  245 aa  ARGB_STRSV RecName: Full=Acetylglutamate kinase;       
    6::241     4e-30  35%  258 aa  ARGB_AZOPC RecName: Full=Acetylglutamate kinase;       
    4::232     5e-30  36%  250 aa  ARGB_LISMO RecName: Full=Acetylglutamate kinase;       
    2::257     9e-30  34%  257 aa  ARGB_PASMU RecName: Full=Acetylglutamate kinase;       
    4::234     1e-29  36%  250 aa  ARGB_LISIN RecName: Full=Acetylglutamate kinase;       
    2::260     3e-29  35%  261 aa  ARGB_SULAC RecName: Full=Acetylglutamate/acetylaminoadipate kinase;
    1::249     3e-29  39%  249 aa  ARGB_DEIRA RecName: Full=Acetylglutamate/acetylaminoadipate kinase;
    5::232     7e-29  32%  245 aa  ARGB_STRGC RecName: Full=Acetylglutamate kinase;       
   63::258     7e-29  35%  266 aa  ARGB_CENSY RecName: Full=Acetylglutamate/acetylaminoadipate kinase;
    2::232     7e-29  36%  256 aa  ARGB_BACCN RecName: Full=Acetylglutamate kinase;       
    7::259     5e-28  32%  260 aa  ARGB_COLP3 RecName: Full=Acetylglutamate kinase;       
   17::237     6e-28  34%  245 aa  ARGB_LEUCK RecName: Full=Acetylglutamate kinase;       
    2::244     8e-28  34%  244 aa  ARGB_LEUMM RecName: Full=Acetylglutamate kinase;       
    5::232     1e-27  36%  250 aa  ARGB_LISW6 RecName: Full=Acetylglutamate kinase;       
    6::259     3e-27  35%  260 aa  ARGB_PSYIN RecName: Full=Acetylglutamate kinase;       
   26::299     9e-27  28%  451 aa  ARGA_RALSO RecName: Full=Amino-acid acetyltransferase;       
    2::240     1e-26  36%  261 aa  ARGB_PYRAR RecName: Full=Acetylglutamate/acetylaminoadipate kinase;
    3::233     2e-26  35%  248 aa  ARGB_LACPL RecName: Full=Acetylglutamate kinase;       
    2::258     3e-26  35%  261 aa  ARGB_PYRAE RecName: Full=Acetylglutamate/acetylaminoadipate kinase;
    2::257     3e-26  33%  257 aa  ARGB_MANSM RecName: Full=Acetylglutamate kinase;       
    2::265     3e-26  31%  269 aa  ARBL_THET2 RecName: Full=Putative acetylglutamate kinase-like
   21::294     5e-26  29%  445 aa  ARGA_SHEON RecName: Full=Amino-acid acetyltransferase;       
   14::270     1e-25  34%  426 aa  ARGB_XANCP RecName: Full=Acetylglutamate kinase;       
   28::257     4e-25  32%  258 aa  ARGB_CALMQ RecName: Full=Acetylglutamate/acetylaminoadipate kinase;
   11::220     7e-25  35%  264 aa  ARGB_MORPR RecName: Full=Acetylglutamate kinase;       
   30::244     1e-24  37%  264 aa  ARGB_SULSO RecName: Full=Acetylglutamate/acetylaminoadipate kinase;
    2::262     1e-24  37%  264 aa  ARGB_SULIY RecName: Full=Acetylglutamate/acetylaminoadipate kinase;
    2::262     1e-24  37%  264 aa  ARGB_SULIN RecName: Full=Acetylglutamate/acetylaminoadipate kinase;
    2::262     1e-24  37%  264 aa  ARGB_SULIM RecName: Full=Acetylglutamate/acetylaminoadipate kinase;
    2::262     1e-24  37%  264 aa  ARGB_SULIL RecName: Full=Acetylglutamate/acetylaminoadipate kinase;
    2::262     1e-24  37%  264 aa  ARGB_SULIK RecName: Full=Acetylglutamate/acetylaminoadipate kinase;
    2::262     1e-24  37%  264 aa  ARGB_SULIA RecName: Full=Acetylglutamate/acetylaminoadipate kinase;
    4::225     1e-24  33%  257 aa  ARGB_PROMH RecName: Full=Acetylglutamate kinase;       
   14::294     1e-24  29%  446 aa  ARGA_VIBFM RecName: Full=Amino-acid acetyltransferase;       
   14::294     1e-24  29%  446 aa  ARGA_VIBF1 RecName: Full=Amino-acid acetyltransferase;       
    1::249     4e-24  36%  249 aa  ARGB_DEIGD RecName: Full=Acetylglutamate/acetylaminoadipate kinase;
    4::226     9e-24  32%  257 aa  ARGB_ERWCT RecName: Full=Acetylglutamate kinase;       
    2::258     1e-23  34%  260 aa  ARGB_THENV RecName: Full=Acetylglutamate/acetylaminoadipate kinase;
   11::219     2e-23  34%  263 aa  ARGB_MORAB RecName: Full=Acetylglutamate kinase;       
   16::291     3e-23  28%  443 aa  ARGA_SHIFL RecName: Full=Amino-acid acetyltransferase;       
    4::226     4e-23  32%  257 aa  ARGB_PECCP RecName: Full=Acetylglutamate kinase;       
   14::270     6e-23  32%  426 aa  ARGB_XANAC RecName: Full=Acetylglutamate kinase;       
   16::291     6e-23  27%  443 aa  ARGA_SALAR RecName: Full=Amino-acid acetyltransferase;       
    2::258     8e-23  33%  261 aa  ARGB_PYRIL RecName: Full=Acetylglutamate/acetylaminoadipate kinase;
   16::291     8e-23  28%  443 aa  ARGA_ESCF3 RecName: Full=Amino-acid acetyltransferase;       
   16::291     8e-23  28%  443 aa  ARGA_ECOLI RecName: Full=Amino-acid acetyltransferase;       
   16::291     8e-23  28%  443 aa  ARGA_ECOL6 RecName: Full=Amino-acid acetyltransferase;       
   16::291     8e-23  28%  443 aa  ARGA_ECO57 RecName: Full=Amino-acid acetyltransferase;       
   14::294     1e-22  28%  445 aa  ARGA_VIBPA RecName: Full=Amino-acid acetyltransferase;       
   15::290     2e-22  29%  448 aa  ARGA_PHOLL RecName: Full=Amino-acid acetyltransferase;       
   16::291     3e-22  27%  443 aa  ARGA_SALTI RecName: Full=Amino-acid acetyltransferase;       
   15::290     3e-22  27%  444 aa  ARGA_PROMH RecName: Full=Amino-acid acetyltransferase;       
   14::294     4e-22  28%  445 aa  ARGA_VIBVY RecName: Full=Amino-acid acetyltransferase;       
   14::294     4e-22  28%  445 aa  ARGA_VIBVU RecName: Full=Amino-acid acetyltransferase;       
   16::291     4e-22  28%  443 aa  ARGA_ENT38 RecName: Full=Amino-acid acetyltransferase;       
    3::260     5e-22  32%  260 aa  ARGB_SHEDO RecName: Full=Acetylglutamate kinase;       
    2::257     7e-22  30%  259 aa  ARGB_AERS4 RecName: Full=Acetylglutamate kinase;       
    9::262     9e-22  32%  263 aa  ARGB_SHESH RecName: Full=Acetylglutamate kinase;       
   14::290     9e-22  28%  441 aa  ARGA_PHOPR RecName: Full=Amino-acid acetyltransferase;       
   14::294     1e-21  28%  445 aa  ARGA_VIBSL RecName: Full=Amino-acid acetyltransferase;       
   16::291     1e-21  27%  443 aa  ARGA_SALTY RecName: Full=Amino-acid acetyltransferase;       
    8::280     1e-21  29%  432 aa  ARGA_PSEF5 RecName: Full=Amino-acid acetyltransferase;       
   15::290     2e-21  28%  441 aa  ARGA_YERPY RecName: Full=Amino-acid acetyltransferase;       
   15::290     2e-21  28%  441 aa  ARGA_YERPS RecName: Full=Amino-acid acetyltransferase;       
   15::290     2e-21  28%  441 aa  ARGA_YERPN RecName: Full=Amino-acid acetyltransferase;       
   15::290     2e-21  28%  441 aa  ARGA_YERPG RecName: Full=Amino-acid acetyltransferase;       
   15::290     2e-21  28%  441 aa  ARGA_YERPE RecName: Full=Amino-acid acetyltransferase;       
   15::290     2e-21  28%  441 aa  ARGA_YERPB RecName: Full=Amino-acid acetyltransferase;       
   15::290     2e-21  28%  441 aa  ARGA_YERPA RecName: Full=Amino-acid acetyltransferase;       
   15::290     2e-21  28%  441 aa  ARGA_YERP3 RecName: Full=Amino-acid acetyltransferase;       
   15::290     2e-21  28%  441 aa  ARGA_YERE8 RecName: Full=Amino-acid acetyltransferase;       
    5::260     2e-21  30%  260 aa  ARGB_SHEON RecName: Full=Acetylglutamate kinase;       
   14::270     3e-21  31%  421 aa  ARGB_XYLFA RecName: Full=Acetylglutamate kinase;       
   12::281     3e-21  28%  437 aa  ARGA_ACTP7 RecName: Full=Amino-acid acetyltransferase;       
    2::243     3e-21  36%  261 aa  ARGB_SULTO RecName: Full=Acetylglutamate/acetylaminoadipate kinase;
    4::225     3e-21  32%  257 aa  ARGB_PHOLL RecName: Full=Acetylglutamate kinase;       
   14::294     3e-21  28%  445 aa  ARGA_VIBCH RecName: Full=Amino-acid acetyltransferase;       
   15::290     4e-21  28%  441 aa  ARGA_SERP5 RecName: Full=Amino-acid acetyltransferase;       
   11::267     6e-21  32%  267 aa  ARGB_SHEPA RecName: Full=Acetylglutamate kinase;       
    6::260     6e-21  32%  261 aa  ARGB_SHELP RecName: Full=Acetylglutamate kinase;       
    2::222     6e-21  32%  261 aa  ARGB_PYRCJ RecName: Full=Acetylglutamate/acetylaminoadipate kinase;
    4::259     7e-21  28%  260 aa  ARGB_VIBFM RecName: Full=Acetylglutamate kinase;       
    4::259     7e-21  28%  260 aa  ARGB_VIBF1 RecName: Full=Acetylglutamate kinase;       
    5::260     7e-21  30%  260 aa  ARGB_SHESR RecName: Full=Acetylglutamate kinase;       
   15::267     7e-21  32%  270 aa  ARGB_SHEHH RecName: Full=Acetylglutamate kinase;       
    5::227     7e-21  29%  258 aa  ARGB_KLEP7 RecName: Full=Acetylglutamate kinase;       
   12::281     7e-21  28%  437 aa  ARGA_ACTP2 RecName: Full=Amino-acid acetyltransferase;       
    1::223     1e-20  29%  254 aa  ARGB_YERE8 RecName: Full=Acetylglutamate kinase;       
   14::270     1e-20  30%  421 aa  ARGB_XYLFT RecName: Full=Acetylglutamate kinase;       
    8::280     1e-20  28%  432 aa  ARGA_PSEPG RecName: Full=Amino-acid acetyltransferase;       
   96::349     1e-20  29%  847 aa  ARG56_DICDI RecName: Full=Bifunctional protein argC,
    4::226     2e-20  29%  257 aa  ARGB_KLEP3 RecName: Full=Acetylglutamate kinase;       
    8::280     2e-20  28%  432 aa  ARGA_PSEPU RecName: Full=Amino-acid acetyltransferase;       
    8::280     2e-20  28%  432 aa  ARGA_PSEPK RecName: Full=Amino-acid acetyltransferase;       
   80::342     2e-20  28%  885 aa  ARG56_SCHPO RecName: Full=Protein arg11, mitochondrial;Contains:
    5::232     2e-20  28%  245 aa  ARGB_STRMU RecName: Full=Acetylglutamate kinase;       
   12::281     2e-20  28%  437 aa  ARGA_ACTPJ RecName: Full=Amino-acid acetyltransferase;       
    5::260     3e-20  30%  260 aa  ARGB_SHESA RecName: Full=Acetylglutamate kinase;       
    5::260     4e-20  30%  260 aa  ARGB_SHESM RecName: Full=Acetylglutamate kinase;       
   15::290     4e-20  27%  441 aa  ARGA_PECCP RecName: Full=Amino-acid acetyltransferase;       
   12::281     4e-20  25%  440 aa  ARGA_PASMU RecName: Full=Amino-acid acetyltransferase;       
   15::290     4e-20  27%  441 aa  ARGA_ERWCT RecName: Full=Amino-acid acetyltransferase;       
    5::227     5e-20  28%  258 aa  ARGB_YERPY RecName: Full=Acetylglutamate kinase;       
    5::227     5e-20  28%  258 aa  ARGB_YERPS RecName: Full=Acetylglutamate kinase;       
    5::227     5e-20  28%  258 aa  ARGB_YERPP RecName: Full=Acetylglutamate kinase;       
    5::227     5e-20  28%  258 aa  ARGB_YERPN RecName: Full=Acetylglutamate kinase;       
    5::227     5e-20  28%  258 aa  ARGB_YERPG RecName: Full=Acetylglutamate kinase;       
    5::227     5e-20  28%  258 aa  ARGB_YERPE RecName: Full=Acetylglutamate kinase;       
    5::227     5e-20  28%  258 aa  ARGB_YERPB RecName: Full=Acetylglutamate kinase;       
    5::227     5e-20  28%  258 aa  ARGB_YERPA RecName: Full=Acetylglutamate kinase;       
    5::227     5e-20  28%  258 aa  ARGB_YERP3 RecName: Full=Acetylglutamate kinase;       
    5::226     5e-20  29%  258 aa  ARGB_ENTS8 RecName: Full=Acetylglutamate kinase;       
   12::281     5e-20  28%  440 aa  ARGA_ACTSZ RecName: Full=Amino-acid acetyltransferase;       
    5::226     6e-20  29%  258 aa  ARGB_ECOL6 RecName: Full=Acetylglutamate kinase;       
    5::226     6e-20  29%  258 aa  ARGB_ECOL5 RecName: Full=Acetylglutamate kinase;       
    5::226     8e-20  29%  258 aa  ARGB_SHISS RecName: Full=Acetylglutamate kinase;       
    5::226     8e-20  29%  258 aa  ARGB_SHIDS RecName: Full=Acetylglutamate kinase;       
    4::226     8e-20  30%  257 aa  ARGB_SALSV RecName: Full=Acetylglutamate kinase;       
    5::226     8e-20  29%  258 aa  ARGB_CITK8 RecName: Full=Acetylglutamate kinase;       
    5::226     1e-19  29%  258 aa  ARGB_SHIFL RecName: Full=Acetylglutamate kinase;       
    5::226     1e-19  29%  258 aa  ARGB_SHIBS RecName: Full=Acetylglutamate kinase;       
    4::225     1e-19  29%  257 aa  ARGB_SHIB3 RecName: Full=Acetylglutamate kinase;       
    5::226     1e-19  29%  258 aa  ARGB_ECOUT RecName: Full=Acetylglutamate kinase;       
    4::225     1e-19  29%  257 aa  ARGB_ECOSE RecName: Full=Acetylglutamate kinase;       
    5::226     1e-19  29%  258 aa  ARGB_ECOLI RecName: Full=Acetylglutamate kinase;       
    4::225     1e-19  29%  257 aa  ARGB_ECOLC RecName: Full=Acetylglutamate kinase;       
    5::226     1e-19  29%  258 aa  ARGB_ECOK1 RecName: Full=Acetylglutamate kinase;       
    4::225     1e-19  29%  257 aa  ARGB_ECOHS RecName: Full=Acetylglutamate kinase;       
    4::225     1e-19  29%  257 aa  ARGB_ECODH RecName: Full=Acetylglutamate kinase;       
    5::226     1e-19  29%  258 aa  ARGB_ECOBW RecName: Full=Acetylglutamate kinase;       
    4::225     1e-19  29%  257 aa  ARGB_ECO8A RecName: Full=Acetylglutamate kinase;       
    4::225     1e-19  29%  257 aa  ARGB_ECO5E RecName: Full=Acetylglutamate kinase;       
    5::226     1e-19  29%  258 aa  ARGB_ECO57 RecName: Full=Acetylglutamate kinase;       
    4::225     1e-19  29%  257 aa  ARGB_ECO55 RecName: Full=Acetylglutamate kinase;       
    4::225     1e-19  29%  257 aa  ARGB_ECO45 RecName: Full=Acetylglutamate kinase;       
    4::225     1e-19  29%  257 aa  ARGB_ECO24 RecName: Full=Acetylglutamate kinase;       
    2::257     1e-19  29%  259 aa  ARGB_AERHH RecName: Full=Acetylglutamate kinase;       
   12::281     1e-19  26%  437 aa  ARGA_HAEDU RecName: Full=Amino-acid acetyltransferase;       
    5::260     1e-19  29%  260 aa  ARGB_SHESW RecName: Full=Acetylglutamate kinase;       
    5::260     1e-19  29%  260 aa  ARGB_SHEPC RecName: Full=Acetylglutamate kinase;       
    4::226     1e-19  29%  257 aa  ARGB_SALA4 RecName: Full=Acetylglutamate kinase;       
    4::226     2e-19  29%  257 aa  ARGB_SALPB RecName: Full=Acetylglutamate kinase;       
    8::281     2e-19  27%  433 aa  ARGA_PSEFS RecName: Full=Amino-acid acetyltransferase;       
    5::227     2e-19  29%  258 aa  ARGB_SALTY RecName: Full=Acetylglutamate kinase;       
    5::227     2e-19  29%  258 aa  ARGB_SALTI RecName: Full=Acetylglutamate kinase;       
    4::226     2e-19  29%  257 aa  ARGB_SALPK RecName: Full=Acetylglutamate kinase;       
    5::227     2e-19  29%  258 aa  ARGB_SALPC RecName: Full=Acetylglutamate kinase;       
    5::227     2e-19  29%  258 aa  ARGB_SALPA RecName: Full=Acetylglutamate kinase;       
    4::226     2e-19  29%  257 aa  ARGB_SALNS RecName: Full=Acetylglutamate kinase;       
    4::226     2e-19  29%  257 aa  ARGB_SALHS RecName: Full=Acetylglutamate kinase;       
    5::227     2e-19  29%  258 aa  ARGB_SALG2 RecName: Full=Acetylglutamate kinase;       
    5::227     2e-19  29%  258 aa  ARGB_SALEP RecName: Full=Acetylglutamate kinase;       
    4::226     2e-19  29%  257 aa  ARGB_SALDC RecName: Full=Acetylglutamate kinase;       
    5::227     2e-19  29%  258 aa  ARGB_SALCH RecName: Full=Acetylglutamate kinase;       
   27::245     2e-19  31%  292 aa  ARBL_DEIRA RecName: Full=Putative acetylglutamate kinase-like
    5::226     3e-19  29%  258 aa  ARGB_SHIF8 RecName: Full=Acetylglutamate kinase;       
   33::260     3e-19  31%  262 aa  ARGB_SHEAM RecName: Full=Acetylglutamate kinase;       
    8::280     3e-19  27%  432 aa  ARGA_PSEPF RecName: Full=Amino-acid acetyltransferase;       
   77::334     3e-19  27%  857 aa  ARG56_CANAL RecName: Full=Protein ARG5,6, mitochondrial;Contains:
    4::225     4e-19  29%  257 aa  ARGB_ENT38 RecName: Full=Acetylglutamate kinase;       
   13::281     4e-19  29%  436 aa  ARGA_NEIMA RecName: Full=Amino-acid acetyltransferase;       
   15::290     7e-19  26%  441 aa  ARGA_EDWI9 RecName: Full=Amino-acid acetyltransferase;       
    5::260     9e-19  29%  260 aa  ARGB_SHEB9 RecName: Full=Acetylglutamate kinase;       
    5::260     9e-19  29%  260 aa  ARGB_SHEB8 RecName: Full=Acetylglutamate kinase;       
    5::260     9e-19  29%  260 aa  ARGB_SHEB5 RecName: Full=Acetylglutamate kinase;       
    5::260     9e-19  29%  260 aa  ARGB_SHEB2 RecName: Full=Acetylglutamate kinase;       
    8::280     1e-18  29%  432 aa  ARGA_PSEAE RecName: Full=Amino-acid acetyltransferase;       
    8::280     1e-18  29%  432 aa  ARGA_PSEAB RecName: Full=Amino-acid acetyltransferase;       
    8::280     1e-18  29%  432 aa  ARGA_PSEA8 RecName: Full=Amino-acid acetyltransferase;       
    1::262     2e-18  27%  263 aa  ARGB_VIBHB RecName: Full=Acetylglutamate kinase;       
    8::280     2e-18  27%  432 aa  ARGA_PSEMY RecName: Full=Amino-acid acetyltransferase;       
   15::290     2e-18  25%  442 aa  ARGA_BUCAI RecName: Full=Amino-acid acetyltransferase;       
    8::280     3e-18  29%  432 aa  ARGA_PSEA7 RecName: Full=Amino-acid acetyltransferase;       
   13::281     3e-18  29%  436 aa  ARGA_NEIMB RecName: Full=Amino-acid acetyltransferase;       
    2::250     1e-17  29%  262 aa  ARGB_METS5 RecName: Full=Acetylglutamate/acetylaminoadipate kinase;
   12::281     1e-17  26%  439 aa  ARGA_MANSM RecName: Full=Amino-acid acetyltransferase;       
   91::348     1e-17  28%  863 aa  ARG56_YEAST RecName: Full=Protein ARG5,6, mitochondrial;Contains:
    9::262     3e-17  27%  262 aa  ARGB_VIBCM RecName: Full=Acetylglutamate kinase;       
    9::262     3e-17  27%  262 aa  ARGB_VIBCH RecName: Full=Acetylglutamate kinase;       
    9::262     3e-17  27%  262 aa  ARGB_VIBC3 RecName: Full=Acetylglutamate kinase;       
   15::290     3e-17  26%  442 aa  ARGA_BUCAP RecName: Full=Amino-acid acetyltransferase;       
   14::290     7e-17  25%  442 aa  ARGA_AERHH RecName: Full=Amino-acid acetyltransferase;       
    6::255     1e-16  27%  260 aa  ARGB_PHOPR RecName: Full=Acetylglutamate kinase;       
    4::225     1e-16  29%  257 aa  ARGB_SERP5 RecName: Full=Acetylglutamate kinase;       
    5::227     2e-16  28%  258 aa  ARGB_SALAR RecName: Full=Acetylglutamate kinase;       
   14::290     2e-16  25%  442 aa  ARGA_AERS4 RecName: Full=Amino-acid acetyltransferase;       
   83::329     2e-16  27%  871 aa  ARG56_NEUCR RecName: Full=Protein arg-6, mitochondrial;Contains:
    9::262     3e-16  26%  263 aa  ARGB_VIBVU RecName: Full=Acetylglutamate kinase;       
    8::280     4e-16  24%  432 aa  ARGA_PSESM RecName: Full=Amino-acid acetyltransferase;       
    9::262     6e-16  26%  263 aa  ARGB_VIBVY RecName: Full=Acetylglutamate kinase;       
    4::214     6e-16  28%  257 aa  ARGB_BUCAT RecName: Full=Acetylglutamate kinase;       
    8::280     6e-16  25%  432 aa  ARGA_PSEU2 RecName: Full=Amino-acid acetyltransferase;       
    8::280     6e-16  25%  432 aa  ARGA_PSESY RecName: Full=Amino-acid acetyltransferase;       
    8::280     2e-15  28%  432 aa  ARGA_AZOVD RecName: Full=Amino-acid acetyltransferase;       
    1::262     3e-15  25%  263 aa  ARGB_VIBPA RecName: Full=Acetylglutamate kinase;       
    4::225     6e-15  27%  257 aa  ARGB_EDWI9 RecName: Full=Acetylglutamate kinase;       
   45::254     8e-15  29%  267 aa  ARGB_ALTMD RecName: Full=Acetylglutamate kinase;       
    4::225     2e-14  27%  257 aa  ARGB_SODGM RecName: Full=Acetylglutamate kinase;       
    8::244     4e-14  28%  270 aa  ARGB_AERPE RecName: Full=Acetylglutamate/acetylaminoadipate kinase;
    4::214     3e-13  27%  257 aa  ARGB_BUCAI RecName: Full=Acetylglutamate kinase;       
    4::214     3e-13  27%  257 aa  ARGB_BUCA5 RecName: Full=Acetylglutamate kinase;       
    5::226     1e-12  24%  258 aa  ARGB_BUCAP RecName: Full=Acetylglutamate kinase;       
    8::246     2e-12  33%  249 aa  ARGB_PYRHO RecName: Full=Acetylglutamate/acetylaminoadipate kinase;
   17::246     5e-12  30%  249 aa  ARGB_PYRFU RecName: Full=Acetylglutamate/acetylaminoadipate kinase;
    4::289     8e-12  30%  309 aa  ARCC_STAHJ RecName: Full=Carbamate kinase;         EC=2.7.2.2;
   40::147     1e-10  35%  253 aa  ARGB_RUBXD RecName: Full=Acetylglutamate kinase;       
   39::248     2e-10  29%  249 aa  ARGB_THET8 RecName: Full=Acetylglutamate/acetylaminoadipate kinase;
  194::313     4e-09  36%  314 aa  CBK_TRIVA RecName: Full=Carbamate kinase;         EC=2.7.2.2;
    4::301     9e-09  27%  310 aa  ARCC_STAEQ RecName: Full=Carbamate kinase;         EC=2.7.2.2;
    4::301     9e-09  27%  310 aa  ARCC1_STAES RecName: Full=Carbamate kinase 1;         EC=2.7.2.2;
   29::197     2e-08  29%  248 aa  ARGB_PYRAB RecName: Full=Acetylglutamate/acetylaminoadipate kinase;
    4::301     3e-08  27%  310 aa  ARCC1_STAAB RecName: Full=Carbamate kinase 1;         EC=2.7.2.2;
    4::301     7e-08  27%  310 aa  ARCC1_STAAR RecName: Full=Carbamate kinase 1;         EC=2.7.2.2;
    4::301     1e-07  27%  310 aa  ARCC1_STAAW RecName: Full=Carbamate kinase 1;         EC=2.7.2.2;
    4::301     1e-07  27%  310 aa  ARCC1_STAAS RecName: Full=Carbamate kinase 1;         EC=2.7.2.2;
    4::301     1e-07  27%  310 aa  ARCC1_STAAN RecName: Full=Carbamate kinase 1;         EC=2.7.2.2;
    4::301     1e-07  27%  310 aa  ARCC1_STAAM RecName: Full=Carbamate kinase 1;         EC=2.7.2.2;
    4::301     1e-07  27%  310 aa  ARCC1_STAAC RecName: Full=Carbamate kinase 1;         EC=2.7.2.2;
    4::301     1e-07  27%  310 aa  ARCC1_STAA8 RecName: Full=Carbamate kinase 1;         EC=2.7.2.2;
    4::301     1e-07  27%  310 aa  ARCC1_STAA3 RecName: Full=Carbamate kinase 1;         EC=2.7.2.2;
    4::289     2e-07  28%  309 aa  ARCC2_STAES RecName: Full=Carbamate kinase 2;         EC=2.7.2.2;
    5::308     4e-07  28%  312 aa  ARCC2_ENTFA RecName: Full=Carbamate kinase 2;         EC=2.7.2.2;
  118::223     4e-06  32%  225 aa  PYRH_METS3 RecName: Full=Uridylate kinase;         Short=UK;       
   32::262     4e-06  27%  267 aa  PROB_STRT2 RecName: Full=Glutamate 5-kinase;       
   32::262     4e-06  27%  267 aa  PROB_STRT1 RecName: Full=Glutamate 5-kinase;       
   32::262     5e-06  26%  267 aa  PROB_STRTD RecName: Full=Glutamate 5-kinase;       
  148::250     5e-06  39%  369 aa  PROB_GLOVI RecName: Full=Glutamate 5-kinase;       
    3::257     2e-05  27%  369 aa  PROB_CYAP8 RecName: Full=Glutamate 5-kinase;       
    2::259     3e-05  28%  371 aa  PROB_ACAM1 RecName: Full=Glutamate 5-kinase;       
    4::289     3e-05  26%  309 aa  ARCC3_STAA3 RecName: Full=Carbamate kinase 3;         EC=2.7.2.2;
    4::312     3e-05  30%  314 aa  ARCC_LACSK RecName: Full=Carbamate kinase;         EC=2.7.2.2;
  117::236     4e-05  36%  379 aa  PROB_ANADE RecName: Full=Glutamate 5-kinase;       
  147::244     8e-05  29%  353 aa  PROB_THEMA RecName: Full=Glutamate 5-kinase;       
  155::262     8e-05  35%  373 aa  PROB_DEHE1 RecName: Full=Glutamate 5-kinase;       
    5::256     8e-05  29%  372 aa  PROB_BACSK RecName: Full=Glutamate 5-kinase;       
  119::254     1e-04  38%  372 aa  PROB_OCEIH RecName: Full=Glutamate 5-kinase;       
   25::263     1e-04  28%  374 aa  PROB_METCA RecName: Full=Glutamate 5-kinase;       
  157::264     1e-04  36%  385 aa  PROB_SYNAS RecName: Full=Glutamate 5-kinase;       
  155::262     1e-04  34%  373 aa  PROB_DEHSC RecName: Full=Glutamate 5-kinase;       
  155::262     1e-04  34%  373 aa  PROB_DEHSB RecName: Full=Glutamate 5-kinase;       
   32::310     1e-04  29%  318 aa  ARCC_LACHI RecName: Full=Carbamate kinase;         EC=2.7.2.2;
  157::264     2e-04  36%  376 aa  PROB_THICR RecName: Full=Glutamate 5-kinase;       
   66::131     2e-04  41%  601 aa  LEPA_POLSQ RecName: Full=GTP-binding protein lepA;
   70::221     2e-04  30%  223 aa  PYRH_METST RecName: Full=Uridylate kinase;         Short=UK;       
  119::258     3e-04  31%  373 aa  PROB2_BACLD RecName: Full=Glutamate 5-kinase 2;       
  236::312     3e-04  27%  534 aa  NAGS_HUMAN RecName: Full=N-acetylglutamate synthase, mitochondrial;
   66::147     3e-04  39%  598 aa  LEPA_RALSO RecName: Full=GTP-binding protein lepA;
   66::131     4e-04  39%  599 aa  LEPA_RALPJ RecName: Full=GTP-binding protein lepA;
   66::131     4e-04  39%  597 aa  LEPA_RALME RecName: Full=GTP-binding protein lepA;
   66::131     4e-04  39%  597 aa  LEPA_RALEJ RecName: Full=GTP-binding protein lepA;
   66::131     4e-04  39%  597 aa  LEPA_RALEH RecName: Full=GTP-binding protein lepA;
   66::131     4e-04  39%  597 aa  LEPA_CUPTR RecName: Full=GTP-binding protein lepA;
   66::131     4e-04  39%  597 aa  LEPA_BURVG RecName: Full=GTP-binding protein lepA;
   66::131     4e-04  39%  597 aa  LEPA_BURTA RecName: Full=GTP-binding protein lepA;
   66::131     4e-04  39%  597 aa  LEPA_BURS3 RecName: Full=GTP-binding protein lepA;
   66::131     4e-04  39%  597 aa  LEPA_BURPS RecName: Full=GTP-binding protein lepA;
   66::131     4e-04  39%  597 aa  LEPA_BURP6 RecName: Full=GTP-binding protein lepA;
   66::131     4e-04  39%  597 aa  LEPA_BURP1 RecName: Full=GTP-binding protein lepA;
   66::131     4e-04  39%  597 aa  LEPA_BURP0 RecName: Full=GTP-binding protein lepA;
   66::131     4e-04  39%  597 aa  LEPA_BURMS RecName: Full=GTP-binding protein lepA;
   66::131     4e-04  39%  597 aa  LEPA_BURMA RecName: Full=GTP-binding protein lepA;
   66::131     4e-04  39%  597 aa  LEPA_BURM9 RecName: Full=GTP-binding protein lepA;
   66::131     4e-04  39%  597 aa  LEPA_BURM7 RecName: Full=GTP-binding protein lepA;
   66::131     4e-04  39%  597 aa  LEPA_BURM1 RecName: Full=GTP-binding protein lepA;
   66::131     4e-04  39%  597 aa  LEPA_BURCM RecName: Full=GTP-binding protein lepA;
   66::131     4e-04  39%  597 aa  LEPA_BURCH RecName: Full=GTP-binding protein lepA;
   66::131     4e-04  39%  597 aa  LEPA_BURCC RecName: Full=GTP-binding protein lepA;
   66::131     4e-04  39%  597 aa  LEPA_BURCA RecName: Full=GTP-binding protein lepA;
   66::131     4e-04  39%  597 aa  LEPA_BURA4 RecName: Full=GTP-binding protein lepA;
  205::293     4e-04  27%  313 aa  ARCC2_STAAB RecName: Full=Carbamate kinase 2;         EC=2.7.2.2;
  149::257     5e-04  31%  369 aa  PROB_THEEB RecName: Full=Glutamate 5-kinase;       
  152::259     5e-04  34%  371 aa  PROB_SYNJB RecName: Full=Glutamate 5-kinase;       
  127::262     6e-04  30%  273 aa  PROB_STRP6 RecName: Full=Glutamate 5-kinase;       
  229::305     6e-04  25%  527 aa  NAGS_MOUSE RecName: Full=N-acetylglutamate synthase, mitochondrial;
   54::147     6e-04  33%  597 aa  LEPA_NITMU RecName: Full=GTP-binding protein lepA;
  205::293     6e-04  27%  313 aa  ARCC2_STAAC RecName: Full=Carbamate kinase 2;         EC=2.7.2.2;
  205::293     6e-04  27%  313 aa  ARCC2_STAA8 RecName: Full=Carbamate kinase 2;         EC=2.7.2.2;
  205::293     6e-04  27%  313 aa  ARCC2_STAA3 RecName: Full=Carbamate kinase 2;         EC=2.7.2.2;
  113::226     8e-04  29%  241 aa  PYRH_HALSA RecName: Full=Uridylate kinase;         Short=UK;       
  113::226     8e-04  29%  241 aa  PYRH_HALS3 RecName: Full=Uridylate kinase;         Short=UK;       
  118::233     8e-04  36%  367 aa  PROB_KLEP7 RecName: Full=Glutamate 5-kinase;       
  118::233     8e-04  36%  367 aa  PROB_KLEP3 RecName: Full=Glutamate 5-kinase;       
  119::254     8e-04  33%  365 aa  PROB_BACSU RecName: Full=Glutamate 5-kinase 1;       
  119::254     8e-04  30%  367 aa  PROB_BACCR RecName: Full=Glutamate 5-kinase;       
   73::132     8e-04  35%  598 aa  LEPA_NITEU RecName: Full=GTP-binding protein lepA;
   73::132     8e-04  35%  598 aa  LEPA_NITEC RecName: Full=GTP-binding protein lepA;
   66::131     8e-04  38%  597 aa  LEPA_BURP8 RecName: Full=GTP-binding protein lepA;
    1::294

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTSSESEIQARLLAQALPFMQKYENKTIVVKYGGHAMGDSTLGKAFAEDIALLKQSGINPIVVHGGGPQI
ARGB_AGRT5      MTSSESEIQARLLAQALPFMQKYENKTIVVKYGGHAMGDSTLGKAFAEDIALLKQSGINPIVVHGGGPQI
ARGB_RHIE6      MNESESEIQARLLAQALPFMQRYENKTIVVKYGGHAMGNPELGKAFASDIALLKQSGVNPIVVHGGGPQI
ARGB_RHIL3      MNETESEMQARLLAKALPFMQRYENKTIVVKYGGHAMGNPELGKAFASDIALLKQSGVNPIVVHGGGPQI
ARGB_AGRVS      MSASESQTQARLLAQALPFMQRYENKTIVVKYGGHAMGDAELGRAFAADIALLKQSGVNPIVVHGGGPQI
ARGB_RHIEC      MNESESEIQARLLAQALPFMQRYENKTIVVKYGGHAMGNPELGKAFASDIALLKQSGVNPIVVHGGGPQI
ARGB_RHILW      MNESESELQARLLAKALPFMQRYENKTIVVKYGGHAMGNPELGKAFASDIALLKQSGVNPIVVHGGGPQI
ARGB_RHIME      MSASESEIQARLLAQALPYMQRYEHKTIVVKYGGHAMGNAELGRAFASDIALLKQSGVNPIVVHGGGPQI
ARGB_SINMW      MSASESEIQARLLAQALPYMQRYENKTIVVKYGGHAMGNAELGRAFASDVALLKQSGVNPIVVHGGGPQI
ARGB_RHISN      MSASESEIQARLLAQALPYMQRYENKTIVVKYGGHAMGNPELGRAFASDIALLKQSGVNPIVVHGGGPQI
ARGB_AGRRK      MSEAQSELQASLLAKALPYMQRYENKTIVVKYGGHAMGNAELGKAFAADIALLKQSGVNPIVVHGGGPQI
ARGB_RHILO      --AATAEMQAALLSRALPYMQRYEHKTVVVKYGGHAMGDIELGKAFARDIALLKQSGVNPIVVHGGGPQI
ARGB_MESSB      -----------------PYMQRYENKTVVIKYGGHAMGDIALGRAFARDVALLKQSGVNPIVVHGGGPQI
ARGB_OCHA4      MTTLENEMQAQLLSAALPYMQRYENKHVVVKYGGHAMGNPELGKAFARDIALLKQSGINPIVVHGGGPQI
ARGB_BRUSU      MTTLENEMQAQLLSAALPYMQRYENKHVVVKYGGHAMGNPELGKAFARDVALLKQSGVNPIVVHGGGPQI
ARGB_BRUSI      MTTLENEMQAQLLSAALPYMQRYENKHVVVKYGGHAMGNPELGKAFARDVALLKQSGVNPIVVHGGGPQI
ARGB_BRUO2      MTTLENEMQAQLLSAALPYMQRYENKHVVVKYGGHAMGNPELGKAFARDVALLKQSGVNPIVVHGGGPQI
ARGB_BRUC2      MTTLENEMQAQLLSAALPYMQRYENKHVVVKYGGHAMGNPELGKAFARDVALLKQSGVNPIVVHGGGPQI
ARGB_BRUME      MTTLENEMQAQLLSAALPYMQRYENKHVVVKYGGHAMGNPELGKAFARDVALLKQSGVNPIVVHGGGPQI
ARGB_BRUMB      MTTLENEMQAQLLSAALPYMQRYENKHVVVKYGGHAMGNPELGKAFARDVALLKQSGVNPIVVHGGGPQI
ARGB_BRUAB      MTTLENEMQAQLLSAALPYMQRYENKHVVVKYGGHAMGNPELGKAFARDVALLKQSGVNPIVVHGGGPQI
ARGB_BRUA2      MTTLENEMQAQLLSAALPYMQRYENKHVVVKYGGHAMGNPELGKAFARDVALLKQSGVNPIVVHGGGPQI
ARGB_BRUA1      MTTLENEMQAQLLSAALPYMQRYENKHVVVKYGGHAMGNPELGKAFARDVALLKQSGVNPIVVHGGGPQI
ARGB_BART1      ------EKQAAFLSSALPYMQKYENETVVVKYGGHAMGDPALGRAFARDIALLKQSGINPVVVHGGGPQI
ARGB_BARQU      ------ERQAAFLSSALPYMQKYENETVVVKYGGHAMGDSTLGRAFARDIALLKQSGINPVVVHGGGPQI
ARGB_BARHE      ------EKQAAFLSSALPYMQKYENETVVVKYGGHAMGDPALGRAFARDIALLKQSGINPVVVHGGGPQI
ARGB_BARBK      ------EKQAAFLSSALPYMQKYENETVVIKYGGHAMGNLALGQAFARDIALLKQSGVNPIVVHGGGPRI
ARGB_RHOPB      --------QARILSEALPHMQEYDEETIVIKYGGHAMGAEDLAKAFARDIVLLEQTAINPVVVHGGGPQI
ARGB_BRASO      --------QARILSEALPHMQEYDDETIVIKYGGHAMGDEDTAKAFARDIVLLEQTAINPVVVHGGGPQI
ARGB_METS4      MSQSETDVRAEVLVQALPHMQRYDEEIVVIKYGGHAMGDRAAAEDFAEDVVLLEQSGLKPVIVHGGGPQI
ARGB_BRASB      --------QARILSEALPHMQEYDDETIVIKYGGHAMGDEDTAKAFARDIVLLEQTAINPVVVHGGGPQI
ARGB_RHOPA      --------QARILSEALPHMQRYDEETIVIKYGGHAMGAEDTAKAFARDIVLLEQTAVNPVVVHGGGPQI
ARGB_RHOP5      --------QARILSEALPHMQRYDEETIVIKYGGHAMGAEETAKAFARDIVLLEQTAINPVVVHGGGPQI
ARGB_RHOPT      --------QARILSEALPHMQRYDEETIVIKYGGHAMGAEDTAKAFARDIVLLEQTAVNPVVVHGGGPQI
ARGB_NITWN      --------QARILSEALPHMQRYDEETIVIKYGGHAMGSENVARQFASDIVLLEQTAINPVVVHGGGPQI
ARGB_OLICO      MSDISPQDQARILSEALPHMQQYDEETIVIKYGGHAMGEEHLAREFARDIVLLEQTAINPVVVHGGGPQI
ARGB_NITHX      --------QARILSEALPHMQQYDEETIVIKYGGHAMGAEDVARQFARDIVLLEQTAINPVVVHGGGPQI
ARGB_METNO      -------VRAEVLVQALPHMQRYDEEIVVIKYGGHAMGDRAAAEDFAEDIVLLEQSGLKPVIVHGGGPQI
ARGB_RHOPS      --------QARILSEALPHMQRYDEETIVIKYGGHAMGAENDAKAFARDIVLLEQTAVNPVVVHGGGPQI
ARGB_RHOP2      --------QARILSEALPHMQRYDEETIVIKYGGHAMGAEDDAKAFARDIVLLEQTAVNPVVVHGGGPQI
ARGB_PARL1      --------RARILSEALPFMQRYDKRTVVVKYGGHAMGDEELGAEFARDIVLLKQAGLNPIVVHGGGPQI
ARGB_BRAJA      MTDISPLDQARILSEALPHMQQYDEETIVIKYGGHAMGDEETAKNFARDIVLLEQTAINPVVVHGGGPQI
ARGB_AZOC5      ---AEAQLQAEVLTKALPHMQRYDDAIVVVKYGGHAMGNDELARHFAQDIVLLEQSXXXXXXXXXXXXQI
ARGB_SPHWW      --------KAETLVEALPYMQRYAGETFVVKYGGHAMGDPEAARDFAEDIVLLKAVGINPVVVHGGGPQI
ARGB_RHOCS      --------KARTLSEALPFMRRYAGRTVVVKYGGHAMGDESLGRRFANDIVLMKQMGISPVVVHGGGPQI
ARGB_SPHAL      --------KAETLVEALPYLQRYAGQTFVIKYGGHAMGDPEAQRDFAEDVVLLKAVGINPVVVHGGGPQI
ARGB_RHORT      --------KAKTLSEALPYMRRFAGLTIVIKYGGHAMGDPELAKTFARDVVLLKQVGMNPVVVHGGGPQI
ARGB_GRABC      --------QARILAHALPFMRRYAGATVVVKYGGHAMGDERLAEQFGADIALLKQVGINPVVVHGGGPQI
ARGB_GLUOX      -----------ILSSALPFLRRYAGDTIVVKYGGHAMGEGKLAHAFGYDISLLKLVGINPIVVHGGGPQI
ARGB_NOVAD      --------KAETLTEALPYLQRYAGKTFVVKYGGHAMGDPELAQDFAEDIVLLKAVGINPVVVHGGGPQI
ARGB_ACICJ      --------QARIVALALPYLRRYAGATIVVKYGGHAMGEESLAEEFGRDIALLKQVGINPVVVHGGGPQI
ARGB_ERYLH      MTATEKTAKAEVLIEALPYFQRYAGRTFVVKYGGHAMGDPKAAREFAEDIVLLKAVGINPVVVHGGGPQI
ARGB_SACD2      ---------AKVLTEALPYIQRFTGKTIVVKFGGNAMTDTELQNSFARDIVLMKLVGMNPIVVHGGGPQI
ARGB_SYNFM      --------KAGILIEALPYIRRFYGKTVVIKYGGNAMVAEELKESFAKDIVLMKYIGINPVVVHGGGPQI
ARGB_HYPNA      -TQSDAQFTARTLSEALPYIQRYAGQTIVVKYGGHAMGDASLALSFARDVVLLKALGLNPVIVHGGGPQI
ARGB_THICR      LNKAQAQNIASVLAEALPYIQRFSGKTIVVKYGGNAMTEEALKNGFARDIVLMKLVGMNPVVVHGGGPQI
ARGB_HAHCH      ---------AAVLSKALPYIQRFAGKTIVIKYGGNAMTDEELKNSFARDVVMMKLVGINPIVVHGGGPQI
ARGB_NITOC      ---------AQVLTESLPYIQRFAGKTVVIKYGGNAMVDDDLKNSFSRDVVLMKLVGINPVVIHGGGPQI
ARGB_DECAR      --------KAAVLAEALPYIKRFHGKTIVVKYGGNAMTDEHLKSCFARDVVLLELVGFNIVVVHGGGPQI
ARGB_PELCD      --------KANVLMEALPYIQRFNNKTIVIKYGGHAMVDGRLKHEFARDVVLLKYIGLNPVIVHGGGPQI
ARGB_GEOMG      --------KANTLMEALPYIRRFSGKTIVIKYGGHAMSDEALKKSFALDVILLKSLGINTVVVHGGGPQI
ARGB_CELJU      ---------ANVLTEALPYIQRFTGKTVVVKFGGNAMEGEALQNSFARDIVLMKLVGMNPVVVHGGGPQI
ARGB_GEOSL      --------KANTLMEALPYIRRFSGKTIVIKYGGHAMADEALKESFALDVIMLKSLGINPVVVHGGGPQI
ARGB_DESPS      -TVEKSIERAKVLIESLPYMQEFRHKTIVIKYGGHAMVDEALKKQFALDVILLKQIGINPIIVHGGGPQI
ARGB_METCA      ---------AHVLTEALPYIRRFKGRTIVVKYGGNAMIDDHLKNSFARDVVLLKLVGINPVVVHGGGPQI
ARGB_GEOSM      --------KASTLMEALPYIRRFSGKTIVIKYGGHAMADEKLRKSFALDVILLKYIGINTVVVHGGGPQI
ARGB_VESOH      ---------ASVLTESLSYFQKFQGKTIVIKYGGNAMVDEALKSSFARDIVLMKSVGMNPIVVHGGGPQI
ARGB_GEOBB      --------KASTLMEALPYIRRFSGKTIVIKYGGHAMADEKLRKSFALDVILLKYIGINTVVVHGGGPQI
ARGB_NITEC      --------KVEILAEALPYIRRFHNKTIVIKYGGNAMTEEILKQSFAKDVVLLKLVGMNPVIVHGGGPQI
ARGB_RUTMC      -----------VLTESLPYIKKFQGKTIVIKYGGNAMVDEALKSSFARDIVLMKLVGMNPIVVHGGGPQI
ARGB_MARAV      ---------ASVLSRGLPYIQRFTGKTVVIKYGGNAMENEDLKSSFARDVVLMKLVGINPIVVHGGGPQI
ARGB_ALHEH      ---------ARVLNEALPYIRRFSGKTIVVKFGGNAMVDDALKQSFARDIVLMKLVGFNPVVVHGGGPQI
ARGB_ACIAD      --------KAKILTEALPYIQRFSGKTLVVKYGGNAMTDPELESSFARDIVLLKTVGLNPIVVHGGGPQV
ARGB_CHRSD      ----DPRLVVEILSEALPYIQRFSGKTVVVKYGGNAMTEDTLIDSFARDMVLMKEVGINPVVVHGGGPQI
ARGB_GLUDA      -TMQEAQERAAVLAQALPFLRRYAGDTIVVKYGGHAMVDDSLSNAFGHDIALLKLVGVNPVIVHGGGPQI
ARGB_ACIBY      --------KAKILIEALPYIQRFSGKTLVVKYGGNAMTDPELESSFARDIVLLKTVGLNPIVVHGGGPQV
ARGB_ACIBT      --------KAKILIEALPYIQRFSGKTLVVKYGGNAMTDPELESSFARDIVLLKTVGLNPIVVHGGGPQV
ARGB_ACIBS      --------KAKILIEALPYIQRFSGKTLVVKYGGNAMTDPELESSFARDIVLLKTVGLNPIVVHGGGPQV
ARGB_ACIBC      --------KAKILIEALPYIQRFSGKTLVVKYGGNAMTDPELESSFARDIVLLKTVGLNPIVVHGGGPQV
ARGB_ACIB5      --------KAKILIEALPYIQRFSGKTLVVKYGGNAMTDPELESSFARDIVLLKTVGLNPIVVHGGGPQV
ARGB_ACIB3      --------KAKILIEALPYIQRFSGKTLVVKYGGNAMTDPELESSFARDIVLLKTVGLNPIVVHGGGPQV
ARGB_POLNA      --------KAEILAQALPYIRKFHGKTLVIKYGGNAMTDPALQADFAEDVVLLKLVGMNPVVVHGGGPQI
ARGB_NITEU      --------KVNILAEALPYIRRFHDKTIVIKYGGNAMIEEALKQGFARDVVLLKLVGMNPVIIHGGGPQI
ARGB_POLSJ      --------KAEILAQALPYIRKFHGKTMVIKYGGNAMTDPALQADFAEDVVLLKLVGMNPVVVHGGGPQI
ARGB_AZOSB      -------LKAEILAEALPYIKRFFDKTIVIKYGGNAMTDPHLKDCFARDVVLLKLVGLNPVVVHGGGPQI
ARGB_VEREI      --------QAEILARALPYIRRFHGKTMVIKYGGNAMTDPALQADFAEDVVLLKLVGMNPVVVHGGGPQI
ARGB_ACISJ      --------KAEILAQALPYIRKFHGKTMVIKYGGNAMTDPALQADFAEDVVLLKLVGMNPVVVHGGGPQI
ARGB_PERMH      --------KAEILMEALPFITKFRGKTFVIKYGGNAMAKADLKVAFAQDILMLKYIGINPVIVHGGGPQI
ARGB_MAGSM      --------KVKVLIEALPYMRRFEGKTFVIKYGGNAMVDEDLKSAFAQDVILMRQVGINPIIVHGGGPQI
ARGB_CHRVO      --ATDAAEKANILAEALPYIREFAGKTIVIKYGGNAMTDDALKEGFAKDVVLLKLVGMNPVVVHGGGPQI
ARGB_DELAS      --------KAEILAQALPYIRKFHGKTMVIKYGGNAMTDPALQADFAEDVVLLKLVGMNPVVVHGGGPQI
ARGB_ACIAC      --------KAEILAQALPYIRKFHGKTIVIKYGGNAMTDPALQADFAEDVVLLKLVGMNPVVVHGGGPQI
ARGB_PELPD      --------KANNLMEALPYIRRFAGKTFVIKYGGHAMSDEKLKESFALDVIMLRSLGINAVIVHGGGPQI
ARGB_AZOSE      --------KAEILAEALPYIKRFFDKTVVIKYGGNAMTDPHLKDCFARDVVLLKLVGLNPVVVHGGGPQI
ARGB_POLSQ      -------LKAEILAEALPYIRAYHGKTIVIKYGGNAMVEERLKESFARDVILLKLVGMNPVVVHGGGPQI
ARGB_BORPD      ---SSPAIKAAVLSEALPYIRRFHGKTIVVKYGGNAMTEERLQRSFAHDVVLLKLVGLNPVVVHGGGPQI
ARGB_METFK      -----------------PYIKRFFDKTIVIKYGGNAMTDPHLKECFASDVVLLKLVGMNPVVVHGGGPQI
ARGB_LAWIP      MDMEKARLRSHMLIESLPYLQKFQGKVIVIKYGGHAMKDTLLKQSFAQSIALLNLXXXXXXXXXXXXXQI
ARGB_NOSP7      MTDNDSEYRVRVLSEALPYIQQFAGRTVVVKYGGAAMKDSTLKDKVIRDIVFLSCVGLRPIVVHGGGPEI
ARGB_DESRM      --------KAGILVEALPYIKKFSGKTIVIKYGGHAMLNADLKKAVMTDLVLMKFVGINPVVVHGGGPEI
ARGB_ANATD      --------KASILIEALPYIQKLYGKTVVIKYGGNAMINEKLKNWVMEDITLLKYIGVNPIVVHGGGPDI
ARGB_POLNS      -------LKAEILAEALPYIRSYHGKTIVIKYGGNAMVEERLKESFARDVILLKLVGMNPVVVHGGGPQI
ARGB_BURCM      -------LKAEILAEALPYIRRYHGKTVVIKYGGNAMTEERLKQGFARDVILLKLVGINPVIVHGGGPQI
ARGB_BURA4      -------LKAEILAEALPYIRRYHGKTVVIKYGGNAMTEERLKQGFARDVILLKLVGINPVIVHGGGPQI
ARGB_BURS3      -------LKAEILAEALPYIRRYHGKTVVIKYGGNAMTEERLKQGFARDVILLKLVGINPVIVHGGGPQI
ARGB_BURCH      -------LKAEILAEALPYIRRYHGKTVVIKYGGNAMTEERLKQGFARDVILLKLVGINPVIVHGGGPQI
ARGB_BURCC      -------LKAEILAEALPYIRRYHGKTVVIKYGGNAMTEERLKQGFARDVILLKLVGINPVIVHGGGPQI
ARGB_BURCA      -------LKAEILAEALPYIRRYHGKTVVIKYGGNAMTEERLKQGFARDVILLKLVGINPVIVHGGGPQI
ARGB_BORPA      -------VKAAVLSEALPYIRRFHGKTIVVKYGGNAMTEERLQRSFAHDVVLLKLVGLNPVVVHGGGPQI
ARGB_BORBR      -------VKAAVLSEALPYIRRFHGKTIVVKYGGNAMTEERLQRSFAHDVVLLKLVGLNPVVVHGGGPQI
ARGB_BURPS      -------LKAEILAEALPYIRRYHGKTVVIKYGGNAMTEERLKQGFARDVILLKLVGINPVIVHGGGPQI
ARGB_BURP6      -------LKAEILAEALPYIRRYHGKTVVIKYGGNAMTEERLKQGFARDVILLKLVGINPVIVHGGGPQI
ARGB_BURP1      -------LKAEILAEALPYIRRYHGKTVVIKYGGNAMTEERLKQGFARDVILLKLVGINPVIVHGGGPQI
ARGB_BURP0      -------LKAEILAEALPYIRRYHGKTVVIKYGGNAMTEERLKQGFARDVILLKLVGINPVIVHGGGPQI
ARGB_BURMS      -------LKAEILAEALPYIRRYHGKTVVIKYGGNAMTEERLKQGFARDVILLKLVGINPVIVHGGGPQI
ARGB_BURMA      -------LKAEILAEALPYIRRYHGKTVVIKYGGNAMTEERLKQGFARDVILLKLVGINPVIVHGGGPQI
ARGB_BURM9      -------LKAEILAEALPYIRRYHGKTVVIKYGGNAMTEERLKQGFARDVILLKLVGINPVIVHGGGPQI
ARGB_BURM7      -------LKAEILAEALPYIRRYHGKTVVIKYGGNAMTEERLKQGFARDVILLKLVGINPVIVHGGGPQI
ARGB_BURVG      -------LKAEILAEALPYIRRYHGKTVVIKYGGNAMTEERLKQGFARDVILLKLVGINPVIVHGGGPQI
ARGB_BURTA      -------LKAEILAEALPYIRRYHGKTVVIKYGGNAMTEERLKQGFARDVILLKLVGINPVIVHGGGPQI
ARGB_BURP8      -------LKAEILAEALPYIRQYHGKTVVIKYGGNAMTEERLKQGFARDVILLKLVGINPVIVHGGGPQI
ARGB_BURCJ      -------LKAEILAEALPYIRRYHGKSVVIKYGGNAMTEERLKQGFARDVILLKLVGINPVIVHGGGPQI
ARGB_BORA1      -------VKAAILSEALPYIRRFHGKTIVVKYGGNAMTEERLQRSFAHDVVLLKLVGLNPVVVHGGGPQI
ARGB_THIDA      MTVHTAAEKAYILSEALPYIQRFYDKTIVIKYGGNAMTERHLMEAFAKDVVLLKLVGMNPVVVHGGGPQI
ARGB_PSEMY      ---------AKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKQGFARDIVLMKAVGINPVVVHGGGPQI
ARGB_BORPE      -------VKAAVLSEALPYIRRFHGKTIVVKYGGNAMTEERLQRSFAHDVVLLKLVGLNPVVVHGGGPQI
ARGB_THENN      -----------VLLEALPYIKEFYGKTFVIKFGGSAMKEEKAKKAFIQDIILLKYTGIKPVIVHGGGPAI
ARGB_PSEE4      ---------AEVLSEALPYIRRFVGKTLVIKYGGNAMESEELKTGFARDIVLMKAVGINPVVVHGGGPQI
ARGB_LEPBA      ------------ILEALPYLINYSGKTIVIKYGGAAMVEEELKASFAEDIVLLKYLGINPVVVHGGGPEI
ARGB_BURXL      -------LKAEILAEALPYIRQYHGKTVVIKYGGNAMTEERLKQGFARDVILLKLVGINPVIVHGGGPQI
ARGB_BURPP      -------LKAEILAEALPYIRQYHGKTVVIKYGGNAMTEERLKQGFARDVILLKLVGINPVIVHGGGPQI
ARGB_AQUAE      --------KAKVLQEALPYIREFHGKVFVIKYGGSAMHDEELRESFARDVVLLKYVGINPVIVHGGGPQI
ARGB_PSEF5      ---------AKVLSEALPYIRRYVGKTLVIKYGGNAMESEELKTGFARDIVLMKAVGINPVVVHGGGPQI
ARGB_PSEFS      ---------AKVLSEALPYIRRYVGKTLVIKYGGNAMESDELKTGFARDIVLMKAVGINPVVVHGGGPQI
ARGB_HERAR      LTVVSPQIQAQILAEALPYIRKFHGKTIVVKYGGNAMTEERLKHSFARDVILLKLVGMNPVVVHGGGPQI
ARGB_NITMU      -----SQDKAKILAEALPYIQRFHGKTIVIKYGGNAMTEENLKKCFAHDVALLKVVGMNPVIVHGGGPQI
ARGB_PSEU5      ---------AKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKTGFARDIVLMKAVGINPVVVHGGGPQI
ARGB_MOOTA      MTLSPLE-KTGILIEALPYIRQFYGKTVVIKYGGHAMVNCELKKAVMQDAVLMHLVGMRPVIVHGGGPEI
ARGB_JANMA      LTVVSPQIQAQILAEALPYIRKFHGKTIVVKYGGNAMTEERLKHGFARDVILLKLVGMNPVVVHGGGPQI
ARGB_CAUCR      ---------AKTLAEALPYIQIYDRETVVIKYGGHAMGQEDVAKVFAADAXXXXXXXXXXXXXXXXXXQI
ARGB_CAUCN      ---------AKTLAEALPYIQIYDRETVVIKYGGHAMGQEDVAKVFAADAXXXXXXXXXXXXXXXXXXQI
ARGB_ANAVT      --------RVQVLSEALPYIQQFAGRTVVVKYGGAAMKDSHLKDQVIRDIVFLSCVGLRPILVHGGGPEI
ARGB_EHRCR      ---------ARVLSESLPYIQQFSGETFIIKYGGAAMKDRKLAENFAHDIVLLKQLGINPIVVHGGGSKI
ARGB_DINSH      ---------ARTLSEAVPFLRRYDDAIVVIKFGGHAMGDAEAMASFARDIVLMRQVGVNPVIVHGGGPMI
ARGB_PSEPK      ---------AEVLSEALPYIRRFVGKTLVIKYGGNAMESEELKTGFARDIVLMKAVGINPVVVHGGGPQI
ARGB_PSEP1      ---------AEVLSEALPYIRRFVGKTLVIKYGGNAMESEELKTGFARDIVLMKAVGINPVVVHGGGPQI
ARGB_PETMO      ---SDEISKAEVLVEALPYIKKFAGSIAVIKFGGNAMKDPQIKSMVAEDIVLMKYVGLNPVIVHGGGPDI
ARGB_METST      MVDQEQFDISNVLIEALPYIKKFHNKKIMIKYGGHAMIDENAMSSTARDTVLLKYVGMQPIVVHGGGPEI
ARGB_METPP      --------KAEILAQALPYIRKFHGKTLVIKYGGNAMTDPALQQDFAEDIVLLKLVGMNPVVVHGGGPQI
ARGB_THEEB      --------RVRVLSEALPYLQAFAGRTFVVKYGGAAMKEEQLKDSVIRDIVFLSYVGIRPVVVHGGGPEI
ARGB_PSEPG      ---------AEVLSEALPYIRRFVGKTLVIKYGGNAMESEELKTGFARDIVLMKAVGINPVVVHGGGPQI
ARGB_ANASP      --------RVQVLSEALPYIQQFAGRTVVVKYGGAAMKDSHLKDQVIRDIVFLSCVGLRPILVHGGGPEI
ARGB_PSEPW      ---------AEVLSEALPYIRRFVGKTLVIKYGGNAMESEELKTGFARDIVLMKAVGINPVVVHGGGPQI
ARGB_CLOTH      -TSMETVIKAEILIEALPYIQKLYGKTVVIKYGGNAMINEELKTSVMEDITLLKYIGMNPVVVHGGGPDI
ARGB_CALS8      --------KASILIEALPYIQKLYGKTVVIKYGGNAMINDKLKNWVMEDITLLKYIGVNPIVVHGGGPEI
ARGB_RALSO      -------LKAEILAQALPYIRKFHGKTIVIKYGGNAMTEEKLKHGFARDVILLKLVGMNPVVVHGGGPQI
ARGB_RALME      -------LKAEILAEALPYIRKFHGKTIVVKYGGNAMTEEKLKHGFARDVILLKLVGMNPVVVHGGGPQI
ARGB_PSEPF      ---------AKVLSEALPYIRRYVGKTLVIKYGGNAMESEELKTGFARDIVLMKAVGINPVVVHGGGPQI
ARGB_HALOH      --------KAQTLVEALPYIRNFYGKTFVIKYGGSTMGDKRLKEKIMEDITLLKYVGVNPVLIHGGGPAI
ARGB_DESVV      -----ARLQSKVLIESLPYLRQFHGETVVIKYGGHAMKDEALKKAFALNVALLKLVGINPVIVHGGGPQI
ARGB_DESVH      -----ARLQSKVLIESLPYLRQFHGETVVIKYGGHAMKDEALKKAFALNVALLKLVGINPVIVHGGGPQI
ARGB_ZYMMO      --------KAETLSEALPYIQRYAGKIFVVKYGGHAMGNPDAAQDFAEDIVLLKAXXXXXXXXXXXXXXX
ARGB_PSEU2      ---------AKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKTGFARDIVLMKAVGINPVVVHGGGPQI
ARGB_PSESM      ---------AKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKTGFARDIVLMKAVGINPVVVHGGGPQI
ARGB_PSE14      ---------AKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKTGFARDIVLMKAVGINPVVVHGGGPQI
ARGB_MARMS      --SRESALDAKVLSESLPYIQRFAGKTLVIKYGGNAMTDENLQAGFARDIVLMKAIGINPIVVHGGGPQI
ARGB_GEOLS      --------KANTLMEALPYIRRFSGRTFVIKYGGHAMSDERLKESFALDVIMLKSLGINAVIVHGGGPQI
ARGB_EHRRG      ----------KTLSESLPYIQQFSGETFIIKYGGAAMTDKKLAESFAHDVVLLKQLGINPIVVHGGGNKI
ARGB_SULSY      --------KAEILLEALPFIRNFRGKTFVIKYGGNAMDKADLRDAFAQDIIMLKYIGINPVIVHGGGPQI
ARGB_EHRRW      ----------KTLSESLPYIQQFSGETFIIKYGGAAMTDKKLAESFAHDVVLLKQLGINPIVVHGGGNKI
ARGB_PSEA7      ---------AKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKAGFARDVVLMKAVGINPVVVHGGGPQI
ARGB_RALEH      -----------ILAEALPYIRKFHGKTIVVKYGGNAMTEEKLKHGFARDVILLKLVGMNPVVVHGGGPQI
ARGB_PSEAE      ---------AKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKAGFARDVVLMKAVGINPVVVHGGGPQI
ARGB_PSEAB      ---------AKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKAGFARDVVLMKAVGINPVVVHGGGPQI
ARGB_PSEA8      ---------AKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKAGFARDVVLMKAVGINPVVVHGGGPQI
ARGB_EHRCJ      ----------KVLSECLPYIQQFSGETFVIKYGGAAMTDRKLAESFAHDIVLLKQLGINPIVVHGGGNKI
ARGB_CLOD6      --------KANTLIEALPYIEKHQGKTIVVKYGGSAMKKDGLKESVMEDLVLMSYVGINIVLVHGGGAEI
ARGB_CAUSK      ---------AKTLAEALPYIQIYDRETVVIKYGGHAMGQEQVAKLFAADAXXXXXXXXXXXXXXXXXXQI
ARGB_THETN      -------LKAHILVEALPYIKKFSGKTVVIKYGGSAMLDCNLKKMVMQDVVLMKFVGLNPVIVHGGGPEI
ARGB_PSYA2      ----DAKITAEVLTTALPYIQRFVDKLIVVKYGGNAMTDPALESSFARDIVLLKTXXXXXXXXXXXXXQV
ARGB_METJA      --------KAEILMEALPFIQKFYGKIFVIKYGGHAMIDEKAKNWTAQDVVLLKYVGINPVVVHGGGPEI
ARGB_PSYCK      ----EAKITAEVLTTALPYIQRFVDKIIVVKYGGNAMTDPALESSFARDIVLLKTXXXXXXXXXXXXXQV
ARGB_HALHL      -TPIDPDLTAQVLVEALPYIRRFRGKTIVVKFGGNAMVDEALKVAFARDIVLMRLXXXXXXXXXXXXPQI
ARGB_METLZ      -----------VLMEALPYIRKFHKKTIVIKLGGHAMVDSAIMNSVVQDAVLLHYVGMRVVLVHGGGPEI
ARGB_CLOK5      ---------AKILAESLPYIQKYRGKTIVVKYGGSAMLDEQLKKYVINDLVLMKCVGINLVVVHGGGPFI
ARGB_CLOK1      ---------AKILAESLPYIQKYRGKTIVVKYGGSAMLDEQLKKYVINDLVLMKCVGINLVVVHGGGPFI
ARGB_ACAM1      --------RVQVLSEALPYIQSFAGRTVVVKYGGAAMKDSTLKATVIRDVVFMACVGLRPVLVHGGGPEI
ARGB_SYNP6      --------RVRILSEALPYLQQFAGRTVVVKYGGAAMKQEELKEAVMRDIVFLACVGMRPVVVHGGGPEI
ARGB_SYNE7      --------RVRILSEALPYLQQFAGRTVVVKYGGAAMKQEELKEAVMRDIVFLACVGMRPVVVHGGGPEI
ARGB_PELTS      --------KAAVLVEALPYIKKFYGKTIVIKYGGHAMLDDSLKEAVLTDAVLMKYVGMHPVIVHGGGPEI
ARGB_ALCBS      MDANSAHDTARILIEALPYIQRFAGTTVVIKYGGNAMENEELKNSFARDVVMMKQXXXXXXXXXXXXXQI
ARGB_RALEJ      ----------------LPYIRKFHGKTIVVKYGGNAMTEEKLKHGFARDVILLKLVGMNPVVVHGGGPQI
ARGB_METS3      -----------ILVEALPYIKKFHEKKILIKYGGHAMIDEDAMSSTVRDTVLLKYVGMEPLIVHGGGPEI
ARGB_SYNWW      --------KAEILVEALPYIKDFYGRRVVIKYGGAAMTDCELKQKVMQDIVLMKFVGMHPIVVHGGGPEI
ARGB_THESQ      -----------VLLEALPYIKEFYGKTFVIKFGGSAMKQENAKKAFIQDIILLKYTGIKPIIVHGGGPAI
ARGB_THEMA      -----------VLLEALPYIKEFYGKTFVIKFGGSAMKQENAKKAFIQDIILLKYTGIKPIIVHGGGPAI
ARGB_THEP1      -----------VLLEALPYIKEFYGKTFVIKFGGSAMKQENAKKAFIQDIILLKYTGIKPIIVHGGGPAI
ARGB_JANSC      ---------ARTLSEALPYLQRFNDAVVVVKFGGNAMGDDAEMASFARDMVLLRQXXXXXXXXXXXXXMI
ARGB_SYNAS      --------KAEILLEALPYIRRFYNRTVVIKYGGHAMVDDELKQSFAKDVLMMKYIGINPVVVHGGGPQI
ARGB_KOSOT      ----------QVLLEALPYIKEFHGKTFVIKFGGSAMKNENAKEAFIKDLVLLKYTGINPVIVHGGGSEI
ARGB_DESMR      -----------------PYIRNFYGQTVVIKYGGHAMVDEQLQESFALNVILLKYIGINPVIVHGGGPQI
ARGB_CARHZ      --------KTKVLIEALPYIKKFYGKTIVIKYGGHAMVSDQLKEAVINDLVLMKFVGINPVVVHGGGPEI
ARGB_THEP3      --------KAQVLIEALPYIKKFSGKTVVIKYGGSAMLDCNLKRMVMQDIVLMKFVGLNPIVVHGGGPEI
ARGB_PSYWF      ---AQAKTTAEVLTTALPYIQRFEDKIIVVKYGGNAMTDPELESSFARDVVLLKTXXXXXXXXXXXXXQV
ARGB_METM7      ----EEYTKAEILIEALPYICKFHDQKVLIKYGGHAMVNEQAKNWIAKDLVLLKYVGINPIVVHGGGPEI
ARGB_CLOB8      --------RAEVLVHALPYIQRYRGKIIVVKYGGNAMISNELRETVINDIILMKCVGIEPIVVHGGGPDI
ARGB_THEPX      --------KAQVLIEALPYIKKFSGTTVVIKYGGSAMLDCNLKRMVMQDIVLMKFVGLNPIVVHGGGPEI
ARGB_RHOFD      --------KAEILAQALPYIRKFHGKTMVIKYGGNAMTDPALQADFAEDVVLLKLVGINPVVVHGGGPQI
ARGB_PROMP      ----DDSLRVSILSEALPYIQRFSGRKIVVKYGGSIMEDEKLKEAFFRDIALLSSVGVCPVVIHGGGPEI
ARGB_METM6      ----EQYTKAEILIEALPYICKFHDQKFLIKYGGHAMVNEQARNWIAKDLVLLKYVGINPIVVHGGGPEI
ARGB_SYNJB      --------RAQILIEALPYIQQYQGRVIVIKYGGAAMVHQERRAEVLRDIVFLACVGIRPVLVHGGGPEI
ARGB_DESHY      --------KARVLIEALPYIQKFTGKTVVIKYGGHAMLDQDLKEKVMLDILLLHSVGIRPVVVHGGGPEI
ARGB_GEOUR      --------KANTLMEALPYIRRFSGKTIVIKYGGHAMADEALKKSFAMDVILLKYIGINPVIVHGGGPQI
ARGB_HELMI      --------KAGILVEALPYIKKFSGKTVVIKYGGAAMVNDQLKEAVIMDVILMKLXXXXXXXXXXXXXEI
ARGB_METTH      -----------ILVEALPYIKKFHRKKIMIKYGGHAMIDEAAMDSTARDTVLLKYVGMEPVVVHGGGPEI
ARGB_DESHD      --------KARVLIEALPYIQKFAGKTVVIKYGGHAMLEQDLKEKVMLDILLLHSVGIRPVVVHGGGPEI
ARGB_CAMFF      ---------AEIILSALPYIQKFRDEIFVIKYGGAAQIDEKLKNNFARDIVLLQLVGIKAVIVHGGGKKI
ARGB_SYNJA      --------RAQILIEALPYIQQYQGRVIVIKYGGAAMVHQERRAEVLRDIVFLACVGIRPVLVHGGGPEI
ARGB_META3      ----DNALKAEVLIESLPYICKFQDQKIVIKYGGHAMVDEEAKSWIAKDVVLLRFVGLNPVIIHGGGPEI
ARGB_TRIEI      ---NESEMRVKVLSEALPYIQKFTGRKIVVKYGGAAMRDSNVKDQVMRDIVLLSCVGIRPIVVHGGGPEI
ARGB_METM5      ----EDYTKAEILIEALPYICKFHDQKFLIKYGGHAMVNEQARSWIAKDLVLLKYVGINPIVVHGGGPEI
ARGB_SYNY3      ----EAATRVKILSEALPYIQHFAGRTVVVKYGGAAMKDSNLKDKVIRDIVFMASVGIRPVVVHGGGPEI
ARGB_METB6      -----------VLMEALPYIQQFHGKTIVIKLGGHAMVDPEVLENAIKDAVLLHYVGIRVVLVHGGGPEI
ARGB_CLOPH      -------VKAQTLIEALPYIQKFNNKKVVVKYGGSAMLDPELELNVIKDVVLLKLVGMQPIIVHGGGKEI
ARGB_NITSB      ------------LLDALPFIKKFRDEIFVIKYGGSAQTDQKLKEKFAQDILLLYTVGIKPVIVHGGGKRI
ARGB_PROM9      -----------ILSEALPYIQSFSGRKIVIKYGGSVMENDNLKKAFFRDIALLSSVGVCPIVIHGGGPEI
ARGB_PROM0      -----------ILSEALPYIQSFSGRKIVIKYGGSVMEDDDLKNAFFRDIALLSTVGVCPIVIHGGGPEI
ARGB_CAMHC      ---------AEVIISALPYIRKFRDKIFVIKYGGAAQTDDNLKLNFARDIVLLHMVXXXXXXXXXXXXXX
ARGB_PROM5      ----DDSLRVSILSEALPYIQSFSGRKIVVKYGGSIMEDEKLKKAFFRDIALLSSVGVCPVVIHGGGPEI
ARGB_SILST      ---------AETLSSALPYLQRYDDAIVVIKLGGHAMGSDEGMESFARDVVLLRQVGVNPVIVHGGGPMI
ARGB_PROMS      -----------ILSEALPYIQSFSGRKIVIKYGGSVMENDNLKNAFFRDIALLSTVGVCPIVIHGGGPEI
ARGB_PROM2      -----------ILSEALPYIQSFSGRKIVIKYGGSVMENDNLKNAFFRDIALLSTVGVCPIVIHGGGPEI
ARGB_PORYE      LTNSE---RVKVLSEALPYIQQFSSRIIVIKYGGAAMKNQKLKDQVISDLVFLSFIGLRPILVHGGGPEI
ARGB_SULNB      ----------KTLLDALPFIKKFSNEKIVVKYGGAAQTSAELKEQFAQDIVLLHLVGMKPIIVHGGGKSI
ARGB_LEPIN      ------------ILEALPYITQYSGKTVVIKYGGAAMAKADLKESFAKDIVLLKYXXXXXXXXXXXXXEI
ARGB_LEPIC      ------------ILEALPYITQYSGKTVVIKYGGAAMAKADLKESFAKDIVLLKYXXXXXXXXXXXXXEI
ARGB_CAMC5      ---------AQVIISALPYIQKFRNKIFVVKYGGSAQIDDTLKNDFVRDIALLQLXXXXXXXXXXXXXXI
ARGB_AZOVD      --SRDAAIQAQVLSEALPYIRRFVGKTLVIKYGGNAMESDELKTGFARDIVLMKAXXXXXXXXXXXXXXX
ARGB_SULDN      ------------LLEALPFIKEFRGKTVVIKYGGSAQETPQLKEKFAEDILLMYLVGIKPVIVHGGGRQI
ARGB_METPE      -----------VLMEALPYIQQFHGQIFVIKLGGHAMVDQLVLEAAIRDVVLLSYIGISVVLVHGGGPEI
ARGB_GLOVI      --------RVQVLAEALPYIQRFAGKTIVVKYGGAAMVKENLRDLVIRDIVFLATVGIKPVVVHGGGPEI
ARGB_MICAN      --------RVKILSEALPYIQEFRGRTVVVKYGGAAMNNSDIKDTVMRDIVFLSCVGVRPVIVHGGGPEI
ARGB_METVS      --------KAEILIEALPYICKFHDQKFVIKYGGHAMVNEQAKNWIAKDMVLLKYVGINPIIVHGGGPEI
ARGB_METHJ      -----------VLMEALPYIQKFHGRSMVIKLGGHAMVDTCIMDTVIRDVVLLQLVGIKCVIVHGGGPEI
ARGB_CYACA      ---NNKSIRTQILIEALPYIQQFRGAIFVIKYGGAAMKDLISKERLIADIVFLSCIGLKLVCVHGGGPEI
ARGB_STRCO      --------KAQILIEALPWLTRHHGKTVVIKFGGNAMIDEDLKAAFAQDVVFLRHAGLKPVVVHGGGPQI
ARGB_METMP      ----EDYTKAEILIEALPYICKFHDQKILIKYGGHAMVNEQAKNWIAKDLVLLKYVGINPIVVHGGGPEI
ARGB_LEPBJ      ------------ILEALPYITKYSGKTVVIKYGGAAMAKADLKESFAKDIVLLKYXXXXXXXXXXXXXEI
ARGB_THELT      -----------ILFEVLQYMKEFREKTFVVKVGGAALEKEEAKTSFAKSIVFLRHVQVNPIIVHGGGVEI
ARGB_SALAI      ---ARAQAKAATLIEALPWLARFAGSTVVVKYGGHAMVDPELRRAFAADMVFLRYAGLKPVVVHGGGPQI
ARGB_LEPBL      ------------ILEALPYITKYSGKTVVIKYGGAAMAKADLKESFAKDIVLLKYXXXXXXXXXXXXXEI
ARGB_ARCFU      -----------LLIEALPYIKDFHSTTMVIKIGGHAMVNDRILEDTIKDIVLLYFVGIKPVVVHGGGPEI
ARGB_STRAW      --------KAQILIEALPWLTRHNGKTVVVKFGGNAMIDEELKAAFAQDIVFLHHAGLKPVVVHGGGPQI
ARGB_FRAAA      --------KTQVLIEALPWLSRFQGATIVIKYGGNAMTEPALRAAFAADIVFLRYSGLRVVVVHGGGPQI
ARGB_WOLSU      -----------ILLDSLPHIKLFSGSTMVIKYGGAAQINPTLKEQFAIDIVLLYMLGIKPVIVHGGGKKI
ARGB_NAUPA      ----------KTLLDSLPFIRKFYGKTIVIKYGGSAQIDERLKESFAIDILMLYMVGIKPVIVHGGGKRI
ARGB_HELHP      ----------KILLDSLPFIRIFRGQIIVIKYGGAAQINPQLKEKFALDIVIMYMLGLKPVIIHGGGKRI
ARGB_CORJK      -TGLTPEMRSHVLAEALPWLLHYRDKIVVVKYGGNAMIDEDLKRAFAADMVFLRAIGARPVVVHGGGPQI
ARGB_PROMA      -------IRVSVLSEALPYIQKFAGRRIVIKYGGSAMSKESLKEAVFRDIALLSSVGAQPVIIHGGGPEI
ARGB_RHOSK      ---------ARTLSEALPYLQRYAGAVVVVKFGGNAMGDEAAMAEFARDIVLMRQXXXXXXXXXXXXXMI
ARGB_RHOS4      ---------ARTLSEALPYLQRYAGAVVVVKFGGNAMGDEAAMAEFARDIVLMRQXXXXXXXXXXXXXMI
ARGB_RHOS1      ---------ARTLSEALPYLQRYAGAVVVVKFGGNAMGDEAAMAEFARDIVLMRQXXXXXXXXXXXXXMI
ARGB_ROSDO      ---------ASTLNKALPYLQRYAGATVVIKLGGHSMGSDEAMDEFARDVVLMRQVGVNPVIVHGGGPMI
ARGB_CORGB      -----SEVRANVLAEALPWLQHFRDKIVVVKYGGNAMVDDDLKAAFAADMVFLRTVGAKPVVVHGGGPQI
ARGB_COREF      -----------MLAEALPWLQHFRDKIVVVKYGGNAMVDDSLKAAFAADMVFLRTVGAKPVVVHGGGPQI
ARGB_PORUM      -------------------LQKFSSRIIVIKYGGAAMKNQKLKDHVISDLVFLSFIGLRPILVHGGGPEI
ARGB_PORPU      -------------------LQKFSSRIIVIKYGGAAMKNQKLKDHVISDLVFLSFIGLRPILVHGGGPEI
ARGB_FRASC      --------KTQVLIEALPWLSRFQGATIVVKYGGNAMTEPALREAFAADVVFLRHSGLRVVVVHGGGPQI
ARGB_DESDG      --------KSKVLIESLPYFRQFSGETVVIKYGGNAMIDESLKQAFALNIVLLKYXXXXXXXXXXXXXQI
ARGB_NOCSJ      --SKPDPAKARTLAAALPWLKRYHGKIVVVKYGGNAMTDETLKRAFAEDIAFLRFAGFKPVVVHGGGPQI
ARGB_RHOS5      ---------ARTLSEALPYLQRYAGAVVVVKFGGNAMGDEAAMAEFARDIVLMRQXXXXXXXXXXXXXMI
ARGB_CAMJR      --------KANVLIEALPYIRKFNSKIILIKYGGSAMENEELKHCVMQDIALLKLVGLKPIIVHGGGKDI
ARGB_THEFY      -TRQEALDKAKTLIEALPWLSALHGKTVVVKYGGNAMTDPDLRARFAENIVFLRYAGLRPVVVHGGGPQI
ARGB_HYDS0      --------KALILQEALPFIRDFYGKVFVVKYGGAAMEEEELKHSFAKDIALLRYVGIKVVLVHGGGKDI
ARGB_SYNR3      -------LRVEVLSEALPYIQRFRGRRVVIKYGGAAMVREDLRDAVFRDVALLASXXXXXXXXXXXXXXI
ARGB_RHOSR      --------KAHVLAEALPWLQQFRDKVVVVKYGGNAMVDDALKTAFAADMAFLRTVGIQPVVVHGGGPQI
ARGB_NEIM0      --------KARILAEALPYIRRFSGSVVVIKYGGNAMTEPALKEGFARDVVLLKLXXXXXXXXXXXXXQI
ARGB_NEIG2      --------KARILAEALPYIRRFSGSVAVIKYGGNAMTEPALKEGFARDVVLLKLXXXXXXXXXXXXXQI
ARGB_KINRD      LTELTAEDKANVLVEALPWLQKWHGALVVLKYGGNAMVDEDLKRAFAEDVVFLRTAGLRPVVVHGGGPQI
ARGB_NEIG1      --------KARILAEALPYIRRFSGSVAVIKYGGNAMTEPALKEGFARDVVLLKLXXXXXXXXXXXXXQI
ARGB_PELUB      ------------------YLEKYNDEFIIIKCGGSVLVDPKLFKVFIEDVVVLKKLGFNPIIVHGGGKRI
ARGB_CAMJ8      --------KANVLIEALPYIRKFNSKIILIKYGGSAMENEELKHCVMQDIALLKLVGLKPIIVHGGGKDI
ARGB_CORU7      --------RSHVLAEALPWLLHYRDKIVVVKYGGNAMIDDELKRAFAADMVFLRAVGARPVVVHGGGPQI
ARGB_NEIMA      --------KARILAEALPYIRRFSGSVAVIKYGGNAMTEPALKEGFARDVVLLKLXXXXXXXXXXXXXQI
ARGB_STRGG      --------KAQILIEALPWLTRHHGRTVVIKFGGNAMIDEELKAAFAQDVVFLRHAGLKPVVVHGGGPQI
ARGB_NEIMB      --------KARILAEALPYIRRFSGSVAVIKYGGNAMTEPALKEGFARDVVLLKLXXXXXXXXXXXXXQI
ARGB_PROM1      --TDKDSIRVSVLSEALPYIQRFANKRIVIKYGGSAMADKTLQNAVFRDLALLSSXXXXXXXXXXXXPEI
ARGB_NEIMF      --------KARILAEALPYIRRFSGSVAVIKYGGNAMTEPALKEGFARDVVLLKLXXXXXXXXXXXXXQI
ARGB_PROMT      --TDKDSIRVSVLSEALPYIQRFANKRIVIKYGGSAMADKTLQNAVFRDLALLSSXXXXXXXXXXXXPEI
ARGB_SYMTH      --------KAAVLAEALPYIREFSGKTVVIKYGGXXXXXXXXXXXVMQDIALMKYVGMHPIVVHGGGPEV
ARGB_SYNS9      --TANDALRVSVLSEALPYIQRFAGRRIVIKYGGAAMAHAELRAAVFRDIALLACXXXXXXXXXXXXXEI
ARGB_PARDP      ---------ARTLSEALPYMQRYSGAVVVVKFGGNAMGDDEAMAEFARDIVLMKQVGIHPVVCHGGGPMI
ARGB_CYAME      ------DLRVQVLTEALPYIQKWRNEIMVIKYGGAVVKQDA---DIIKDILFLTCCGFQIVVVHGGGPLI
ARGB_STRCL      --------KARTLIEALPWLTRHHGKTIVVKFGGNAMVNEELKGAFARPSFLVHHAGLRPVVVHGGGPQI
ARGB_METBF      -----------VLIEALPYMQEFYDSIMVIKVGGNAMVSAQIMEDIIKDIVLLRYVGIKPVIVHGGGPEI
ARGB_CORGL      -------------------MQHFRDKIVVVKYGGNAMVDDDLKAAFAADMVFLRTVGAKPVVVHGGGPQI
ARGB_RHOBA      --------KADTLIEAMGWIRRFRGKTTVIKLGGSLLEDREALQHLLLDVIFMETVGLRPVVVHGGGKAI
ARGB_RENSM      --------KAEILIEALPWIQQFAGTVVVVKYGGNAMVSDELRQAFTEDMVFLHHVGIKPVVVHGGGPQI
ARGB_CHLCH      ----------QVLIEALPYIRQFEGKTFVIKYGGAAMKDDTLKNMFAQNVTLLRKVGIRIVLVHGGGDAI
ARGB_ARCB4      ---AQTNPKVQTLIDAIPYFKKFYGKTIVIKYGGSAQTSDDLKEKFAQDIVLLTLLGIKPVVVHGGGARI
ARGB_SALTO      -----AQAKAATLIEALPWLARFAGSCVVVKYGGNAMADPELRREFAADMVFLRYAGLKPVVVHGGGPQI
ARGB_CHLPD      ----------QVLIEALPYIRKFEGKTFVIKYGGSAMKDDKLKNSFAQNVTLLRKVGINVVLVHGGGDAI
ARGB_CLOAB      -------------------LTQYSGKTFVIKYGGSIMKNKKAEEAFIKDVKYLRKLGINIVIVHGGGPEI
ARGB_GRATL      --------RVQILSDALPFVQRFHGRTLVVKYGGSAMKNVYLKSKIIEDILFLSYXXXXXXXXXXXXPMI
ARGB_CAMJD      --------KANVLIEALPYIRKFNSKIILIKYGGSAMENEELKHCVMQDIALLKLVGLKPIIVHGGGKDI
ARGB_SILPO      ---------AATLNAALPYLQRYDDAIVVIKLGGHAMGSDEAMESFARDVVLLRQXXXXXXXXXXXXXMI
ARGB_PROMM      --TEDDSLRVSVLSEALPYIQRFSGRRIVIKYGGAAMAHANLQEAVFRDLALLXXXXXXXXXXXXXXXXI
ARGB_CAMJE      --------KANVLIEALPYIRKFNSKIILIKYGGSAMENEELKHCVMQDIALLKLVGLKPIIVHGGGKDI
ARGB_BRAHW      MENISNRDKALILNQALPYIQKYTGKTVVIKYGGSAMENPELKKKVMSDVALLSTXXXXXXXXXXXXKDI
ARGB_GEOSF      --------KANTLMEALPYIRRFSGKTIVIKYGGHAMADEALKKSFALDVILLKYIGINTVIVHGGGPQI
ARGB_PELLD      ----------QVLIEALPYIRKFERKTFVIKYGGSAMKDLCLKNSFAQNVTLLRKVGINVVLVHGGGDAI
ARGB_CAMJJ      --------KANVLIEALPYIRKFNSKIILIKYGGSAMENEELKHCVMQDIALLKLVGLKPIIVHGGGKDI
ARGB_CHLL2      ----------QVLIEALPYIRKFEGKTFVIKYGGSAMKDELLKNSFAQNVTLLRKVGINVVLVHGGGDAI
ARGB_METMJ      -----------VLMEALPYIQKFYGKTIVIKLGGHAMVDQSILETVIRDAVLLRYVGMKVVLVHGGGPEI
ARGB_PROM3      --TEDDSLRVSVLSEALPYIQRFSGRRIVIKYGGAAMAHANLQEAVFRDLALLXXXXXXXXXXXXXXXXI
ARGB_PELPB      -----------VLIEALPYIRKFEGKTFVIKYGGAAMKDACLKNSFAQNVTLLRKVGIRIVLVHGGGDAI
ARGB_BIFLI      -TDLRADQKAEVLIEALPWLEEFAGQRIVVKYGGNAMVDDHLKQCFAEDMVFLRQVGLHPIVVHGGGPQI
ARGB_PROVI      ----------QVLIEALPYIRKFEGKTFVIKYGGSAMKDECLKNSFAQNVTLLRKVGINVVLVHGGGDAI
ARGB_BIFLO      -TDLRADQKAEVLIEALPWLEEFAGQRIVVKYGGNAMVDDHLKQCFAEDMVFLRQVGLHPIVVHGGGPQI
ARGB_UNCMA      ----------------LPRRKEVEGAVIVIKVGGHAMVDPAARSSIIKDIVTLRELGALPVIVHGGGPEI
ARGB_SYNPX      --SGDDALRVSVLSEALPYIQRFSGRRIVIKYGGAAMAHAELREAVFRDLALLACXXXXXXXXXXXXXEI
ARGB_METMA      -----------VLIEALPYMQEFYDSIMVIKVGGNAMVSAQIMEDIIKDIVLLRYVGIKPVIVHGGGPEI
ARGB_METBU      -----------VLIEALPYIREFHDSVMVIKVGGHAMVDPQVMSDIVQDIVLLRFXXXXXXXXXXXXXEI
ARGB_METAC      -----------VLIEALPYMQEFYDSIMVIKVGGNAMVSTQIMEDIIKDIVLLRYVGIKPVIVHGGGPEI
ARGB_BIFLD      -TDLRADQKAEVLIEALPWLEEFAGQRIVVKYGGNAMVDDHLKQCFAEDMVFLRQVGLHPIVVHGGGPQI
ARGB_SYNS3      ----DDSLRVSVLSEALPYIQRFAGRRIVVKYGGAAMVHAELRDAVFRDIALLASXXXXXXXXXXXXXEI
ARGB_SYNSC      ---NDDALRVSVLSEALPYIQSFAGRRIVIKYGGAAMAHAELRSAVFRDLALLACXXXXXXXXXXXXXEI
ARGB_PROAC      -TQFSAQRKSEVLVEALPWIRRFQGRTVVVKYGGNAMVDPGLQQAFADDIVFMASVGIRPIVVHGGGPQI
ARGB_ALKMQ      --------KADVLIESLPYIKKFYNEIVVIKYGGSAMVNDELKESIIKDIVLMKYXXXXXXXXXXXXXEI
ARGB_LACLS      ---TDSQITAQILTESLKYFLKYRDQTVVIKYGGNVMIDEKVKESILKDILLLKTVGIKVVLVHGGGPAI
ARGB_BEUC1      --------KAEVLVQALPWLERFAGAVVVIKFGGNAMIDADLEAAFADDVLFLRRVGLKPVVVHGGGPQI
ARGB_MYCTU      -----THIKAQVLAEALPWLKQLHGKVVVVKYGGNAMTDDTLRRAFAADMAFLRNCGIXXXXXXXXXXQI
ARGB_MYCTA      -----THIKAQVLAEALPWLKQLHGKVVVVKYGGNAMTDDTLRRAFAADMAFLRNCGIXXXXXXXXXXQI
ARGB_MYCBT      -----THIKAQVLAEALPWLKQLHGKVVVVKYGGNAMTDDTLRRAFAADMAFLRNCGIXXXXXXXXXXQI
ARGB_MYCBP      -----THIKAQVLAEALPWLKQLHGKVVVVKYGGNAMTDDTLRRAFAADMAFLRNCGIXXXXXXXXXXQI
ARGB_MYCBO      -----THIKAQVLAEALPWLKQLHGKVVVVKYGGNAMTDDTLRRAFAADMAFLRNCGIXXXXXXXXXXQI
ARGB_MYCS2      --SIDRGFKADVLASALPWLKQLHGKIVVVKYGGNAMTDDVLKAAFAADMVFLRNCGIXXXXXXXXXXQI
ARGB_LACLM      ----DSQNTAQTLTESLKYFLKYRDQTVVIKYGGNAMIDEKVKESILKDILLLKTVGIKVVLVHGGGPAI
ARGB_SYNPW      ----DDALRVSVLSEALPYIQRFAGRRIVVKYGGAAMVHAELQSAVFRDLALLRSXXXXXXXXXXXXXEI
ARGB_ACIC1      ------QAKAATLVEALPWLATFHGRTVVIKYGGHAMIDPGLAASFAADVVFLRYAGLRPVVVHGGGPQI
ARGB_CORDI      -----SRERATVLADALPWLQRYRDKIVVVKYGGNAMVDEELKAAFAADMVFLRTXXXXXXXXXXXXXQI
ARGB_SACEN      --------KASVLIEALPWLQRFHGATVVVKYGGNAMIDDELKTAFAQDMVFLRLAGLXXXXXXXXXXQI
ARGB_CHLTE      -----------MLVEALPYIRKFEGKTFVIKYGGAAMKDEVLKNIFAENVTLLRXXXXXXXXXXXXXDAI
ARGB_METTP      ----------QVLIEALPYIREFYDSIMVIKIGGSIMTNHEILENFIQDIILLKYXXXXXXXXXXXXXEI
ARGB_ACTP7      MLQNEVENFANLLEQATVYLAPYQEKIIVVKYGGNAMINEDLKKLVMQDILLLNQXXXXXXXXXXXXPEI
ARGB_NOCFA      --------KAHVLADALPWLQKFRDKIVVVKYGGNAMIDEELKRAFAADMAFLRTXXXXXXXXXXXXXQI
ARGB_GEOTN      --------------------------TVVIKCGGSVLDE--LSPAFFASVKTMREQGMNVVIVHGGGPEI
ARGB_LACLA      ----DSQNTAQTLTESLKYFLKYRDQTVVIKYGGNAMIDEKVKESILKDILLLKTVGIKVVLVHGGGPAI
ARGB_HAEDU      -------------------LANWQGKTIVVKYGGNAMISAELKQTVMQNILLLNQYGINVVLVHGGGPEI
ARGB_BACHD      ---------------------------VVIKCGGSVL--DSLSDSFFTSVRRLQAEGAKPIIVHGGGPAI
ARGB_ACTPJ      MLQNEVENFTNLLEQATVYLAPYQEKIIVVKYGGNAMINEDLKKLVMQDILLLNQXXXXXXXXXXXXPEI
ARGB_MYCPA      -------VKAQVLAEALPWLKQLHGKIVVIKYGGNAMTDDTLRRAFAADMAFLRNCGIXXXXXXXXXXQI
ARGB_MYCUA      -----TQSKAQVLAEALRWLKQLHGRVVVIKYGGNAMTDDTLRQAFAADMAFLRNCGIXXXXXXXXXXQI
ARGB_ACTP2      MLQNEVENFANLLEQATVYLAPYQEKIIVVKYGGNAMINEDRKKLVMQDILLLNQXXXXXXXXXXXXPEI
ARGB_MYCA1      -------VKAQVLAEALPWLKQLHGKIVVIKYGGNAMTDDTLRRAFAADMAFLRNCGIXXXXXXXXXXQI
ARGB_MYCMM      -----TQSKAQVLAEALPWLKQLHGRVVVIKYGGNAMTDDTLRQAFAADMAFLRNCGIXXXXXXXXXXQI
ARGB_MYCLE      -----TQVKAEVLAEALPWLKQLHGKVVVVKYSGNAMTDDMLRRAFAADMAFLRNCGIXXXXXXXXXXQI
ARGB_DEHSC      -------------------MTQSSNHIVVIKLGGSVLDSKDTS---LKDIATLKQLGLKPVLIHGGASTV
ARGB_DEHSB      -------------------MTQSSNHIVVIKLGGSVLDSKDTS---LKDIATLKQLGLKPVLIHGGASTV
ARGB_CHLP8      -----------VLVEALPYIRQFEGKTFVIKYGGAAMKDEVLKNIFAENVTLLRXXXXXXXXXXXXXDAI
ARGB_UNCTG      ----------------------------VVKFGGSLTENPQAQNKFLEELTLISKRQ-NIILVHGGGPEI
ARGB_BACP2      ------------------------DKTIVFKCGGSVIRE--LSDTFYENVRSLQAAGFKLAIVHGGGPEI
ARGB_AKKM8      --------QASVIVGALPYLQAYRDKTFLIKFGGSAMDDARLVKKLMRDIVLLEVLGFNPVIVHGGGKAI
ARGB_GEOSW      -------------------------KTIVIKCGGSVLSD--LSPSFFTSLQEMYAQGMNIVLVHGGGPEI
ARGB_MYCVP      MTLTTSD-KAAVLADALPWLTALNDKIVVVKYGGNAMTDDRLKAAFAADMVFLRNCGIXXXXXXXXXXQI
ARGB_LEIXX      ------------LIESLPWLKTFHDRIIVVKFGGNAMVSEELQRTFAEDMVYLRYAGLLPVIVHGGGPQI
ARGB_ARTS2      ---SDAQDKAGTLIEALPWIQRFAGTTMVIKYGGNAMVNDELRRAFAEDVVFLXXXXXXXXXXXXXXXQI
ARGB_SOLUE      ---------------------------LLVKLGGTLLDSAASRDSLCLQIAAARAAGHEVTVVHGGGKQM
ARGB_MYCSJ      --TAATHTKAQVLAAALPWLKQLHGKIVVVKYGGNAMTDDTLKAAFAADMVFLRNCXXXXXXXXXXXXQI
ARGB_MYCGI      --------KAQVLADALPWLTALNGKIVVVKYGGNAMTDDRLKAAFAADMVFLRNCGIXXXXXXXXXXQI
ARGB_ACIBL      ---------------------------IVLKIGGAALENKDLVGQFCTTVASLAKDXXXXXXXXXXXXXX
ARGB_GEOKA      -------------------------KTVVIKCGGSVLDE--LSPAFFASVRTMREQGMDVVIVHGGGPEI
ARGB_ARTAT      ---SDAQDKAGTLIEALPWIQRFAGTTMVIKYGGNAMVNDDLRRAFAEDIVFLXXXXXXXXXXXXXXXQI
ARGB_BIFA0      --------KAEVLIEALPWLEEFFGKTIVIKYGGNAMVNDHLKECFAEDMVFLRXXXXXXXXXXXXXXXX
ARGB_CLAMS      ------ESKAAILIESLSWLQRFHDRIVVVKFGGNAMVDEELTRTFAEDVVYLRYAGLRPVVVHGGGPQI
ARGB_ARTCA      ---SDAQDKAATLIEALPWIQRFAGTTMVIKYGGNAMVNDELRRAFAEDIVFLXXXXXXXXXXXXXXXQI
ARGB_DEHE1      -------------------VSQVSNHIVVIKLGGSVLSSKDTS---LKDIAALKQLGLKPVLIHGGASTV
ARGB_CLAM3      --------KAATLIESLSWLQRFHDRIVVVKFGGNAMVDEELTRTFAEDVVYLRYAGLRPVVVHGGGPQI
ARGB_BIFAA      -TDLRADQKAEVLIEALPWLEEFAGQRIVIKYGGNAMIDDHLKACFAEDMVFLRQXXXXXXXXXXXXXQI
ARGB_ACIC5      ----------------------------VVKLGGAALENPEIFMACARAVADLVKDGHQVALVHGGGVQL
ARGB_BACST      -------------------------KTVVIKCGGSVLDE--LSPAFFASVNAMRKQGMEVVIVHGGGPEI
ARGB_METKA      ----------------------------VIKVGGEVLDR-------VEDLARVIDDSI---LVHGGGPEV
ARGB_MYCSS      --TAATHTKAQVLAAALPWLKQLHGKIVVVKYGGNAMTDDTLKAAFAADMVFLRNCXXXXXXXXXXXLQI
ARGB_MYCSK      --TAATHTKAQVLAAALPWLKQLHGKIVVVKYGGNAMTDDTLKAAFAADMVFLRNCXXXXXXXXXXXLQI
ARGB_MYXXD      ------------LRHAAKYVQQFRRKTFVVKLGGAMLSDPRLRRAACEQIALLWTFSIRPVVVHGGGPEL
ARGB_OCEIH      --------------------------TVVFKVGGSVLNQ--LSPKFYQVLLQLKETGTNPIIVHGGGPEI
ARGB_ANADF      -------------------------KTIVLKLGGELVHAPELD-VIARDLRVLVDGFNRVAIVHGGGPQA
ARGB_BACSU      -------------------------KTIVFKCGGSVIRE--LSEEFYQNLKELRASGWKLAIVHGGGPEI
ARGB_BACAM      -------------------------KTIVFKCGGSVIRE--LSEEFYQNLKELRASGWKLAIVHGGGPEI
ARGB_BACA2      -------------------------KTIVFKCGGSVIRE--LSADFFQNVKELMQSGWNIAVVHGGGPDI
ARGB_CLONN      -------------------LESLKNKIIVIKYGGSIFHTLKNNKSFIEDLKTLKKCXXXXXXXXXXXXXX
ARGB_ROSCS      --------------------------TLVIKVGGNELDDATFVKELARIVAAMRPI---PTLVHGGGKEI
ARGB_SORC5      ---------------------------LVIKLGGEVVGGPXXXXXXXXXXXXTR-AGARAIVVHGGGAQA
ARGB_BREBN      ---------------------------VVIKCGGSTMDQ--LPDSFFQAIAGLQAQGQEIVIVHGGGPAI
ARGB_BACFR      --------------------EKMKEKLTVIKVGGKIVEEEATLNQLLNDFAAIEG---HKVLVHGGGRSA
ARGB_BACFN      --------------------EKMKEKLTVIKVGGKIVEEEATLNQLLNDFAAIEG---HKVLVHGGGRSA
ARGB_CHLAD      ----------------------------VLKVSGHELDDPHFLAGLTGVIRTMTQP---LVLVHGGGKEI
ARGB_BACTN      -------------------------KLTVIKVGGKIVEEEATLLQLLNDFAAI--SG-HKVLVHGGGRSA
ARGB_BACLD      -------------------------KTIVFKCGGSVIRE--LSDEFFQNLKDLTESGWKIALVHGGGPDI
ARGB_BACV8      -----------------------KEKLTIIKVGGKIVEESTLNQLLADFSAIEGYK----LLVHGGGRSA
ARGB_BACAH      ------------------------NDYIVVKCGGSMLDQ--LNDVFFDCIKKLQQQ-YKVVIVHGGGPEI
ARGB_PARD8      -------------------------KLVLIKVGGKIVEEEETLRQLLNDFAAIEGY---KVLVHGGGRSA
ARGB_BACCZ      ---------------------------VVVKCGGSMLDQ--LNDVFFDCIKKLQQK-YKVVIVHGGGPEI
ARGB_BACC3      ------------------------NDYIVVKCGGSMLDQ--LNDVFFDCIKKLQQQ-YKVVIVHGGGPEI
ARGB_BACSK      --------------------------TVVIKIGGSTL--EALEEGFYEGVVKRASLGDKIMIVHGGGPAI
ARGB_BACCQ      ---------------------------IVVKCGGSMLDQ--LNDLFFDCIKKLQQK-YKVVIVHGGGPEI
ARGB_BACC7      ---------------------------IVVKCGGSMLDQ--LNDLFFDCIKKLQQK-YKVVIVHGGGPEI
ARGB_ANADE      -------------------------KTIVLKLGGEIVHSPELDLV-ARDLRTLVDGWNRVAIVHGGGPQA
ARGB_BACC0      ------------------------NDYIVVKCGGSML--EQLNDVFFDCIKKLQQQ-YKVVIVHGGGPEI
ARGB_BACAN      ------------------------NDYIVVKCGGSML--EQLNDVFFDCIKKLQQQ-YKVVIVHGGGPEI
ARGB_BACAA      ------------------------NDYIVVKCGGSML--EQLNDVFFDCIKKLQQQ-YKVVIVHGGGPEI
ARGB_BACHK      ------------------------NDYIVVKCGGSMLDQ--LNDVFFDCIKKLQQQ-YKVVIVHGGGPEI
ARGB_ANASK      -------------------------KTIVLKLGGEIVHSPELDLV-ARDLRTLVDGWNRVAIVHGGGPQA
ARGB_BACC1      ---------------------------IVVKCGGSMLDQ--LHDVFFDCIKKLQQK-YKVVIVHGGGPEI
ARGB_ANAD2      -------------------------KTIVLKLGGEIVHSPELDLV-ARDLRTLVDGWNRVAIVHGGGPQA
ARGB_BACAC      ------------------------NDYIVVKCGGSML--EQLNDVFFDCIKKLQQQ-YKVVIVHGGGPEI
ARGB_CYTH3      -------------------------KLYIIKVGGNIIDNPEALTSFLKDFASLKE---NKILVHGGGKVA
ARGB_BACCR      ---------------------------IVVKCGGSMLNQ--LNDVFFECIKKLQQK-YKVVIVHGGGPEI
ARGB_IGNH4      ---------------------------IVVKAGGRTLLNNM--DEIVKSISRLEKA----VFVHGGGDLV
ARGB_CHLSY      ----------------------------VIKVSGHELDDPT----FLGGLTAALRGFQQPLVVHGGGKEI
ARGB_CHLAA      ----------------------------VIKVSGHELDDPT----FLGGLTAALRGFQQPLVVHGGGKEI
ARGB_STAAR      -------------------------KFIVIKIGGSTLSD--MHPSIINNIKHLRSNNIYPIIVHGGGPFI
ARGB_BACC4      ---------------------------IVVKCGGSMLNQ--LNDVFFDCIKKLQQK-YKVVIVHGGGPEI
ARGB_BACC2      ---------------------------IVVKCGGSMLNQ--LNAVFFDCIKKLQQK-YKVVIIHGGGPEI
ARGB_BACWK      ---------------------------IVVKCGGSMLDQ--LNDVFFDCIKKLQQK-YKVVIVHGGGPEI
ARGB_STAAW      -------------------------KFIVIKIGGSTLSD--MHPSIINNIKHLRSNNIYPIIVHGGGPFI
ARGB_STAAT      -------------------------KFIVIKIGGSTLSD--MHPSIINNIKHLRSNNIYPIIVHGGGPFI
ARGB_STAAS      -------------------------KFIVIKIGGSTLSD--MHPSIINNIKHLRSNNIYPIIVHGGGPFI
ARGB_STAAN      -------------------------KFIVIKIGGSTLSD--MHPSIINNIKHLRSNNIYPIIVHGGGPFI
ARGB_STAAM      -------------------------KFIVIKIGGSTLSD--MHPSIINNIKHLRSNNIYPIIVHGGGPFI
ARGB_STAAE      -------------------------KFIVIKIGGSTLSD--MHPSIINNIKHLRSNNIYPIIVHGGGPFI
ARGB_STAAC      -------------------------KFIVIKIGGSTLSD--MHPSIINNIKHLRSNNIYPIIVHGGGPFI
ARGB_STAAB      -------------------------KFIVIKIGGSTLSD--MHPSIINNIKHLRSNNIYPIIVHGGGPFI
ARGB_STAA9      -------------------------KFIVIKIGGSTLSD--MHPSIINNIKHLRSNNIYPIIVHGGGPFI
ARGB_STAA8      -------------------------KFIVIKIGGSTLSD--MHPSIINNIKHLRSNNIYPIIVHGGGPFI
ARGB_STAA3      -------------------------KFIVIKIGGSTLSD--MHPSIINNIKHLRSNNIYPIIVHGGGPFI
ARGB_STAA2      -------------------------KFIVIKIGGSTLSD--MHPSIINNIKHLRSNNIYPIIVHGGGPFI
ARGB_STAA1      -------------------------KFIVIKIGGSTLSD--MHPSIINNIKHLRSNNIYPIIVHGGGPFI
ARGB_NITMS      ---------------------------ITIKIGGSVVDD--LHPSTIADIKKIAESE-GVILVHGGGKEV
ARGB_LISMF      --------------------------TIVVKLGGVASDNLT--EDFFQQIIQWQAANKKIVLVHGGGHYI
ARGB_LISMC      --------------------------TIVVKLGGVASDNLT--EDFFQQIIQWQAANKKIVLVHGGGHYI
ARGB_ROSS1      -----------------------DRPTLVIKVGGNDLDDATFVAELARVVAAIRPL---PVLVHGGGKEI
ARGB_ACTSZ      -------------------------RPLVIKLGGILLDTAAMENLFNALAKYLQNSDRSLLIVHGGGCVV
ARGB_STAS1      ---------------------------IVIKIGGSTLTE--LHETTIDDIAQLKQQDLXXXXXXXXXXFI
ARGB_STAES      ---------------------------IVIKLGGIAI--ENLNDAFIQQINAWHLENKKIIIVHGGGQVI
ARGB_STAEQ      ---------------------------IVIKLGGIAI--ENLNDAFIQQINAWHLENKKIIIVHGGGQVI
ARGB_LISMH      --------------------------TIVIKLGGVASDNLTEG--FFRQITEWQAANKKIVLVHGGGHYI
ARGB_OPITP      MNVAEITAKAEVLLEALPYVQDFRGSIFVVKYGGSFMDDDPAGRTVARDLAFLAAXXXXXXXXXXXXKAI
ARGB_STRSV      ---------------------------IVIKIGGVAA--QKLSDKFIKQMQEWIAAGKKIVVVHGGGLVI
ARGB_AZOPC      ----------------------------IVKVGGEIIRIPEVRDSFLKDFSII--AGYK-ILVHGGGSML
ARGB_LISMO      --------------------------TIVIKLGGVASDNLTEG--FFRQITEWQAANKKIVLVHGGGHYI
ARGB_PASMU      -------------------------KPLVIKLGGVLLDTPAAMENLFTALANYQQNFDRPLVVHGGGCIV
ARGB_LISIN      --------------------------TIVIKLGGVASDNLT--DDFFQQIIKWQAEKKKIVLVHGGGHYI
ARGB_SULAC      ---------------------------IVVKTGGRVLKQN-----LDRVVQSIIKTNNKIIYVHGGGDQV
ARGB_DEIRA      ---------------------------MIVKYGGNAMKSLDLRRAVARELGTLR--GAMPVVVHGGGPVI
ARGB_STRGC      ---------------------------IVIKIGGVAA--KKLSDKFIKQMQEWIAAGKKIVVVHGGGLVI
ARGB_CENSY      ----------------------------------------------------------------------
ARGB_BACCN      ------------------------NECIVIKCGGSML--ERLDSTFFHCIEKLKRK-YRIVIVHGGGPDI
ARGB_COLP3      -------------------------KPLVIKIGGAILEKESALNALLNVISQLKNKQV--VLVHGGGCVV
ARGB_LEUCK      -----------------------------------------LTPAFFDTIKYWQTQDTQIAIVHGGGDRI
ARGB_LEUMM      -------------------------KKIVIKIGGNAA--TQLTPAFFDTIKFWQKQHYKIAIVHGGGDTI
ARGB_LISW6      ---------------------------IVIKLGGTASDNLT--ENFFQKITEWQGAEKKIVLVHGGGHYI
ARGB_PSYIN      -------------------------KPLLIKLGGAVLNEQALENLFSALTVYLQTEQRPLLIVHGGGVIV
ARGA_RALSO      ------------LRAVAPYIHAFRDKTFVIGFGGELVKAGMLG-ALVNDIALLHAMGMHIVLVHGSRPQV
ARGB_PYRAR      ---------------------------IVVKIGG-----SVICKDASRVIQNLPKYADKAVVVHGGGCLV
ARGB_LACPL      -------------------------KLIVIKIGGQAI--SQLSTTFFDQIAQWYQQHYQILIVHGGGPMI
ARGB_PYRAE      ---------------------------IVVKIGG-----SVVCKDASKVIQNLPKYADRAVVIHGGGCLV
ARGB_MANSM      -------------------------KPLVIKLGGVLLDTPAAMENLFTALADYQQNFARPLIVHGGGCLV
ARBL_THET2      ---------------------------IVVKVGG---AEGINYEAVAKDAASLWKEGVKLLLVHGGSAET
ARGA_SHEON      -----------------PYVNAHRGKTFVVMLGGEALAQNQF-RGILNDVALLHSLGIKVVLVYGARPQI
ARGB_XANCP      ------------------FSQLDAKRFAVVKVGGAVLRDDL--EALTSSLSFLQEVGLTPIVLHGAGPQL
ARGB_CALMQ      ------------------------------------------------------------VLIHGGGCMV
ARGB_MORPR      ---------------------------LVLKLGGALLENETALEQLFTALSEYKSTSSRPLVVHGGGCFV
ARGB_SULSO      ------------------------------------------------------------ILVHGGGDIV
ARGB_SULIY      ---------------------------IVVKIGGRVVKNSL-------DKVILDIANINDILVHGGGDIV
ARGB_SULIN      ---------------------------IVVKIGGRVVKNSL-------DKVILDIANINDILVHGGGDIV
ARGB_SULIM      ---------------------------IVVKIGGRVVKNSL-------DKVILDIANINDILVHGGGDIV
ARGB_SULIL      ---------------------------IVVKIGGRVVKNSL-------DKVILDIANINDILVHGGGDIV
ARGB_SULIK      ---------------------------IVVKIGGRVVKNSL-------DKVILDIANINDILVHGGGDIV
ARGB_SULIA      ---------------------------IVVKIGGRVVKNSL-------DKVILDIANINDILVHGGGDIV
ARGB_PROMH      ---------------------------LIIKLGGVLLDNEKALTRFFTALQEYRTSHSRPLVVHGGGCLV
ARGA_VIBFM      --------------QSAPYVNAHRDKTVVIMLGGEAIADPNFAN-IVNDIALLNSLGLRIVIVYGTRPQM
ARGA_VIBF1      --------------QSAPYVNAHRDKTVVIMLGGEAIADPNFAN-IVNDIALLNSLGLRIVIVYGTRPQM
ARGB_DEIGD      ---------------------------MIVKYGGNAMKSVELRRAVAGEIAALRAEQXXXXXXXXXXX-I
ARGB_ERWCT      ---------------------------LIIKLGGVLLSEEALERLFTALVAYRQEHQRPLVIVHGGGCLV
ARGB_THENV      ---------------------------IVVKIGG-----SVVCKDPTKVVENLPNYADKAVVVHGGGCLV
ARGB_MORAB      ---------------------------LVLKLGGALLQNETALEQLFTALSEYKSTCTSLILVHGGGCFV
ARGA_SHIFL      ---------------SVPYINTHRGKTFVIMLGGEAIEHENFS-SIVNDIGLLHSLGIRLVVVYGARPQI
ARGB_PECCP      ---------------------------LIIKLGGVLLSEEALERLFTALVAYRQEHQRPLVIVHGGGCLV
ARGB_XANAC      ------------------FSQLDAKRFAVVKVGGAVLRDDL--DALTSSLSFLQEVGLTPIVLHGAGPQL
ARGA_SALAR      ---------------SVPYINTHRGKTFVIMLGGEAIEHDNFS-SIVNDIGLLHSLGIRLVVVYGARPQI
ARGB_PYRIL      ---------------------------IVIKVGG-----SVVCKDVSKVIQNLPKYADRAIIVHGGGCLV
ARGA_ESCF3      ---------------SVPYINTHRGKTFVIMLGGEAIEHENFS-SIVNDIGLLHSLGIRLVVVYGARPQI
ARGA_ECOLI      ---------------SVPYINTHRGKTFVIMLGGEAIEHENFS-SIVNDIGLLHSLGIRLVVVYGARPQI
ARGA_ECOL6      ---------------SVPYINTHRGKTFVIMLGGEAIEHENFS-SIVNDIGLLHSLGIRLVVVYGARPQI
ARGA_ECO57      ---------------SVPYINTHRGKTFVIMLGGEAIEHENFS-SIVNDIGLLHSLGIRLVVVYGARPQI
ARGA_VIBPA      --------------QSTPYVNAHRGKTMVIMLGGEAVAHNNFGNII-NDIALMHSLGIKVVVVYGARPQI
ARGA_PHOLL      ---------------SVPYINAHRGKTFVIMLGGEAIAHENFTNII-NDIGLLHSLGIRLVVVYGARPQI
ARGA_SALTI      ---------------SVPYINTHRGKTFVIMLGGEAIEHDNFS-SIVSDIGLLHSLGIRLVVVYGARPQI
ARGA_PROMH      ---------------SVPYINAHRGKTFVIMLGGEAIAHENF-PSIINDIGLLHSLGIRLVVVYGARPQI
ARGA_VIBVY      --------------QSTPYVNAHRGKTMVILLGGEAIADKNFSNII-NDIALMHSLGVKVVLVYGARPQI
ARGA_VIBVU      --------------QSTPYVNAHRGKTMVILLGGEAIADKNFSNII-NDIALMHSLGVKVVLVYGARPQI
ARGA_ENT38      ---------------SVPYINTHRGKTFVIMLGGEAIEHENFS-SIVNDIGLLHSLGIRLVVVYGARPQI
ARGB_SHEDO      -----------------------DNKSVLVKVGGALMGMSRLMTAAAQMIA----TGQKVLLVHGGGCLV
ARGB_AERS4      -----------------------DKQTLVIKLGGALINDEALTALFGTLKTFLDEQHRPLVLVHXXXXXX
ARGB_SHESH      --------------------------TLVLKVGG-ALMQCEMGMALMETAAKMIASGQQLIMVHGGGCLV
ARGA_PHOPR      --------------QSAPYVNAHSGKTVVIMLGGEAIADPNFAN-IVNDIALLNSLGLQIVVVYGARPQI
ARGA_VIBSL      --------------QSTPYVNAHRGKTMVIMLGGEAVADRNFGNIIS-DIALLHSLGVKIVLVHGARPQI
ARGA_SALTY      ---------------SVPYINTHRGKTFVIMLGGEAIEHDNFS-SIVSDIGLLHSLGIRLVVVYGARPQI
ARGA_PSEF5      ------------LRHASPYINAHRDCTFVVMLPGDGVEHPNFGN-IVHDLVLLHSLGVRLVLVHGSRPQI
ARGA_YERPY      ---------------SVPYINAHRGKTFVVMLGGEAIEHENFS-SIVNDIGLLHSLGIRLVVVYGARPQI
ARGA_YERPS      ---------------SVPYINAHRGKTFVVMLGGEAIEHENFS-SIVNDIGLLHSLGIRLVVVYGARPQI
ARGA_YERPN      ---------------SVPYINAHRGKTFVVMLGGEAIEHENFS-SIVNDIGLLHSLGIRLVVVYGARPQI
ARGA_YERPG      ---------------SVPYINAHRGKTFVVMLGGEAIEHENFS-SIVNDIGLLHSLGIRLVVVYGARPQI
ARGA_YERPE      ---------------SVPYINAHRGKTFVVMLGGEAIEHENFS-SIVNDIGLLHSLGIRLVVVYGARPQI
ARGA_YERPB      ---------------SVPYINAHRGKTFVVMLGGEAIEHENFS-SIVNDIGLLHSLGIRLVVVYGARPQI
ARGA_YERPA      ---------------SVPYINAHRGKTFVVMLGGEAIEHENFS-SIVNDIGLLHSLGIRLVVVYGARPQI
ARGA_YERP3      ---------------SVPYINAHRGKTFVVMLGGEAIEHENFS-SIVNDIGLLHSLGIRLVVVYGARPQI
ARGA_YERE8      ---------------SVPYINAHRGKTFVVMLGGEAIEHENFS-SIVNDIGLLHSLGIRLVVVYGARPQI
ARGB_SHEON      ------------------------NSVLVLKVGG-ALLQCEMGMARLMDTAAMIANGQQVLMVHGGGCLV
ARGB_XYLFA      ------------------FSQLDAKRFAVVKVGGAVLRDDV--DALTSSLSFLQEVGLTPIVLHGAGPQL
ARGA_ACTP7      --------------QSTPYVNMHREKTFVIMLDGNAIAHPNFIN-ITNDISLLHSLGIKLVIVFGARCQI
ARGB_SULTO      ---------------------------IVIKAGGRVIKNNLDGI-----IESLSNVGEQAIFVHGGGDQV
ARGB_PHOLL      ---------------------------LVIKLGGVLLNEEALERVFTALQEYRQTHERQLVVVHGGGYLV
ARGA_VIBCH      --------------QSAPYVNAHRGKTMVVMLGGEAIADKNFPNIIS-DIALLHSLGVKVVLVHGARPQI
ARGA_SERP5      ---------------SVPYINAHRGKTFVVMLGGEAIEHENFAN-IVNDIGLLHSLGIRLVVVYGARPQI
ARGB_SHEPA      -----------------------QKPVMVLKVGGALMGMSRLMQAAAKIIA----SGQPIIMVHGGGCLV
ARGB_SHELP      -------------------------KTLVLKVGGALMQEMGLARLMASAANIIK-SGQSVILVHGGGCLV
ARGB_PYRCJ      ---------------------------IVVKVGG-----SVICKDLSKVVENLPKYAGEAVVVHGGGCLV
ARGB_VIBFM      -------------------------RPLVIKLGGAVLSSDTLTLLFKTISNYQQQAKRSLIIVHGGGYLV
ARGB_VIBF1      -------------------------RPLVIKLGGAVLSSDTLTLLFKTISNYQQQAKRSLIIVHGGGYLV
ARGB_SHESR      ------------------------NSVLVLKVGG-ALLQCEMGMARLMDTAAMIANGQQVLMVHGGGCLV
ARGB_SHEHH      ---------------------------MVLKVGGALMGMARLMEAAAKIIA----NGQPIIMVHGGGCLV
ARGB_KLEP7      ---------------------------LIIKLGGVLLDSEEALERLFTALVNYREAHQRPIIVHGGGCVV
ARGA_ACTP2      --------------QSTPYVNMHREKTFVIMLDGNAIAHPNFIN-ITNDIGLLHSLGIKLVIVFGARCQI
ARGB_YERE8      ---------------------------MVIKLGGVLLSEEALERLFTALVTYREKHERPLVIMHGGGCLV
ARGB_XYLFT      ------------------FSQLDAKRFAVVKVGGAVLRDDV--DALTSSLSFLQEVGLTPIVLHGAGPQL
ARGA_PSEPG      ------------LRHASPYINAHRDCTFVVMLPGDGVEHPNFGN-IVHDLVLLHSLGVRLVLVHGSRPQI
ARG56_DICDI     ---------------------KDQKQIVLVKIGGGVIESDI--SSLIGSLNFLKKIGLFPIVVHGGGPQL
ARGB_KLEP3      ---------------------------LIIKLGGVLLDSEEALERLFTALVNYREAHQRPIIVHGGGCVV
ARGA_PSEPU      ------------LRHASPYINAHRDCTFVVMLPGDGVEHPNFGN-IVHDLVLLHSLGVRLVLVHGSRPQI
ARGA_PSEPK      ------------LRHASPYINAHRDCTFVVMLPGDGVEHPNFGN-IVHDLVLLHSLGVRLVLVHGSRPQI
ARG56_SCHPO     --------------QYLRYFTSFEQRFAIIKVGGAIITDEL--DTLAQSLAFLNHVGLYPIVVHGAGPQL
ARGB_STRMU      ---------------------------IVIKIGGVA--SQQLSGDFLSQIKNWQDAGKQLVIVHGGGFAI
ARGA_ACTPJ      --------------QSTPYVNMHREKTFVIMLDGNAIAHPNFIN-ITNDISLLHSLGIKLVIVFGARCQI
ARGB_SHESA      ------------------------NSVLVLKVGG-ALLQCEMGMARLMDTAAMIANGQQVLMVHGGGCLV
ARGB_SHESM      ------------------------NSVLVLKVGG-ALLQCEMGMARLMDTAAMIADGQQVLMVHGGGCLV
ARGA_PECCP      ---------------SVPYINAHRGKTFVIMLGGEAIEHANFS-SIVNDIGLLHSLGIKLVVVYGARPQI
ARGA_PASMU      --------------QSTPYVNMHRGKTFVIMLDGDTIACPNFVNII-NDISLLHSLGIKLVLVFGARYQI
ARGA_ERWCT      ---------------SVPYINAHRGKTFVIMLGGEAIEHANFS-SIVNDIGLLHSLGIKLVVVYGARPQI
ARGB_YERPY      ---------------------------LVIKLGGVLLSEEALERLFTALVTYREKHERPLVIMHGGGCLV
ARGB_YERPS      ---------------------------LVIKLGGVLLSEEALERLFTALVTYREKHERPLVIMHGGGCLV
ARGB_YERPP      ---------------------------LVIKLGGVLLSEEALERLFTALVTYREKHERPLVIMHGGGCLV
ARGB_YERPN      ---------------------------LVIKLGGVLLSEEALERLFTALVTYREKHERPLVIMHGGGCLV
ARGB_YERPG      ---------------------------LVIKLGGVLLSEEALERLFTALVTYREKHERPLVIMHGGGCLV
ARGB_YERPE      ---------------------------LVIKLGGVLLSEEALERLFTALVTYREKHERPLVIMHGGGCLV
ARGB_YERPB      ---------------------------LVIKLGGVLLSEEALERLFTALVTYREKHERPLVIMHGGGCLV
ARGB_YERPA      ---------------------------LVIKLGGVLLSEEALERLFTALVTYREKHERPLVIMHGGGCLV
ARGB_YERP3      ---------------------------LVIKLGGVLLSEEALERLFTALVTYREKHERPLVIMHGGGCLV
ARGB_ENTS8      ---------------------------LIIKLGGVLLSEEALERLFTALVNYRKEHQRPLVIVHGGGCLV
ARGA_ACTSZ      --------------QSTPYVNMHRGKTFVIMLDGDTIASENFINIIS-DIRLLHSLGIKLIIVFGARFQI
ARGB_ECOL6      ---------------------------LIIKLGGVLLSEEALERLFSALVNYRESHQRQLVIVHGGGCVV
ARGB_ECOL5      ---------------------------LIIKLGGVLLSEEALERLFSALVNYRESHQRQLVIVHGGGCVV
ARGB_SHISS      ---------------------------LIIKLGGVLLDSEEALERLFSTLVNYRESHQRPLVVHGGGCVV
ARGB_SHIDS      ---------------------------LIIKLGGVLLDSEEALERLFSALVNYRESHQRPLVVHGGGCVV
ARGB_SALSV      ---------------------------LIIKLGGVLLDSEEALERLFTALVNYRESHQRPLVVHGGGCVV
ARGB_CITK8      ---------------------------LIIKLGGVLLDSEEALERLFTALVNYRESHQRPIIVHGGGCVV
ARGB_SHIFL      ---------------------------LIIKLGGVLLDSEEALERLFSALVNYRESHQRPLVVHGGGCVV
ARGB_SHIBS      ---------------------------LIIKLGGVLLDSEEALERLFSALVNYRESHQRPLVVHGGGCVV
ARGB_SHIB3      ---------------------------LIIKLGGVLLDSEEALERLFSALVNYRESHQRPLVVHGGGCVV
ARGB_ECOUT      ---------------------------LIIKLGGVLLDSEEALERLFSALVNYRESHQRPLVVHGGGCVV
ARGB_ECOSE      ---------------------------LIIKLGGVLLDSEEALERLFSALVNYRESHQRPLVVHGGGCVV
ARGB_ECOLI      ---------------------------LIIKLGGVLLDSEEALERLFSALVNYRESHQRPLVVHGGGCVV
ARGB_ECOLC      ---------------------------LIIKLGGVLLDSEEALERLFSALVNYRESHQRPLVVHGGGCVV
ARGB_ECOK1      ---------------------------LIIKLGGVLLDSEEALERLFSALVNYRESHQRPLVVHGGGCVV
ARGB_ECOHS      ---------------------------LIIKLGGVLLDSEEALERLFSALVNYRESHQRPLVVHGGGCVV
ARGB_ECODH      ---------------------------LIIKLGGVLLDSEEALERLFSALVNYRESHQRPLVVHGGGCVV
ARGB_ECOBW      ---------------------------LIIKLGGVLLDSEEALERLFSALVNYRESHQRPLVVHGGGCVV
ARGB_ECO8A      ---------------------------LIIKLGGVLLDSEEALERLFSALVNYRESHQRPLVVHGGGCVV
ARGB_ECO5E      ---------------------------LIIKLGGVLLDSEEALERLFSALVNYRESHQRPLVVHGGGCVV
ARGB_ECO57      ---------------------------LIIKLGGVLLDSEEALERLFSALVNYRESHQRPLVVHGGGCVV
ARGB_ECO55      ---------------------------LIIKLGGVLLDSEEALERLFSALVNYRESHQRPLVVHGGGCVV
ARGB_ECO45      ---------------------------LIIKLGGVLLDSEEALERLFSALVNYRESHQRPLVVHGGGCVV
ARGB_ECO24      ---------------------------LIIKLGGVLLDSEEALERLFSALVNYRESHQRPLVVHGGGCVV
ARGB_AERHH      -----------------------DKQTLVIKLGGALIENDEXXXXXXXXXXXXXDEQHRPLVVHGGGCLV
ARGA_HAEDU      --------------QSAPYVNMHRHKTFVIMLDGNAIAHPNFIN-ITNDISLLHSLGIKLVIVFGARCQI
ARGB_SHESW      ------------------------NSVLVLKVGG-ALLQCEMGMARLMDTAAMLANGQQVLMVHGGGCLV
ARGB_SHEPC      ------------------------NSVLVLKVGG-ALLQCEMGMARLMDTAAMLANGQKVLMVHGGGCLV
ARGB_SALA4      ---------------------------LIIKLGGVLLDSEEALERLFTALVNYRESHQRPLVVHGGGCVV
ARGB_SALPB      ---------------------------LIIKLGGVLLDSEEALERLFTALVNYRESHQRPLVVHGGGCVV
ARGA_PSEFS      ------------LRHASPYINAHRDCTFVVMLPGDGVEHPNFGN-IVHDLVLLHSLGVRLVLVHGSRPQI
ARGB_SALTY      ---------------------------LIIKLGGVLLDSEEALERLFTALVNYRESHQRPLVVHGGGCVV
ARGB_SALTI      ---------------------------LIIKLGGVLLDSEEALERLFTALVNYRESHQRPLVVHGGGCVV
ARGB_SALPK      ---------------------------LIIKLGGVLLDSEEALERLFTALVNYRESHQRPLVVHGGGCVV
ARGB_SALPC      ---------------------------LIIKLGGVLLDSEEALERLFTALVNYRESHQRPLVVHGGGCVV
ARGB_SALPA      ---------------------------LIIKLGGVLLDSEEALERLFTALVNYRESHQRPLVVHGGGCVV
ARGB_SALNS      ---------------------------LIIKLGGVLLDSEEALERLFTALVNYRESHQRPLVVHGGGCVV
ARGB_SALHS      ---------------------------LIIKLGGVLLDSEEALERLFTALVNYRESHQRPLVVHGGGCVV
ARGB_SALG2      ---------------------------LIIKLGGVLLDSEEALERLFTALVNYRESHQRPLVVHGGGCVV
ARGB_SALEP      ---------------------------LIIKLGGVLLDSEEALERLFTALVNYRESHQRPLVVHGGGCVV
ARGB_SALDC      ---------------------------LIIKLGGVLLDSEEALERLFTALVNYRESHQRPLVVHGGGCVV
ARGB_SALCH      ---------------------------LIIKLGGVLLDSEEALERLFTALVNYRESHQRPLVVHGGGCVV
ARBL_DEIRA      ---------------------------IVVKVGG---SDGIDYDAVCADLAERWQAGEKLILVHGGSGET
ARGB_SHIF8      ---------------------------LIIKLGGVLLDSEEALERLFSALVNYRESHQRPLVVHGGGCVV
ARGB_SHEAM      ----------------------------------------------------LLEKGEQVVLVHGGGCLV
ARGA_PSEPF      ------------LRHASPYINAHRDCTFVVMLPGDGVEHPNFGN-IVHDIVLLHSLGVRLVLVHGSRPQI
ARG56_CANAL     ------------------FTSVSQQQFAVIKVGGAIITQQL--NELASCLAFLYHVGLYPIVLHGTGPQI
ARGB_ENT38      ---------------------------LIIKLGGVLLDSEEALERLFSALVDYRESHQRPLVVHGGGCVV
ARGA_NEIMA      --------------EAAPYIRQMRGKTLVAGIDDRLLEGDTLNK-FAADIGLLSQLGIRLVLIHGARHFL
ARGA_EDWI9      ---------------SVPYINAHRGKTFVIMLSGEAIAEANF-VGIINDIALLHSLGIRLVVVYGARPQI
ARGB_SHEB9      ------------------------NSVLVLKVGG-ALLQCEMGMARLMDTAAMLANGQQVLMVHGGGCLV
ARGB_SHEB8      ------------------------NSVLVLKVGG-ALLQCEMGMARLMDTAAMLANGQQVLMVHGGGCLV
ARGB_SHEB5      ------------------------NSVLVLKVGG-ALLQCEMGMARLMDTAAMLANGQQVLMVHGGGCLV
ARGB_SHEB2      ------------------------NSVLVLKVGG-ALLQCEMGMARLMDTAAMLANGQQVLMVHGGGCLV
ARGA_PSEAE      ------------LRHASPYINSHRDRTFVVMLPGEGVEHPNFGN-IVHDLVLLHSLGARLVLVHGSRPQI
ARGA_PSEAB      ------------LRHASPYINSHRDRTFVVMLPGEGVEHPNFGN-IVHDLVLLHSLGARLVLVHGSRPQI
ARGA_PSEA8      ------------LRHASPYINSHRDRTFVVMLPGEGVEHPNFGN-IVHDLVLLHSLGARLVLVHGSRPQI
ARGB_VIBHB      -------------------MTQTNQAPLVIKLGGAALSTQTLSQLFGAIAAYQKSAQRQIAIVHGGGYLV
ARGA_PSEMY      ------------LRHASPYINAHRDRTFVVMLPGEGIAHPNFAN-IVHDLVLLHSLGVRLVLVHGSRPQI
ARGA_BUCAI      ---------------SVPYINAHRGKTFVIMLGGEAIKYGNF-YSIINDIGLLHSLGIRLVVVYGACPQI
ARGA_PSEA7      ------------LRHASPYINSHRDRTFVVMLPGEGVEHPNFGN-IVHDLVLLHSLGARLVLVHGSRPQI
ARGA_NEIMB      --------------EAVPYIRQMRGKTLVAGIDDRLLEGDTLNK-LAADIGLLSQLGIRLVLIHGARHFL
ARGB_METS5      ---------------------------IVVKIGGRVVKNALQNVIES----VLRYPG-KLILVHGGGDIV
ARGA_MANSM      --------------QSTPYVNMHRGKTFVIMLDGNTXXXXXXXXXXXXXX-LLHSLGIKLIIVYGARVQI
ARG56_YEAST     ------------------FTSVSQQQFAVIKVGGAIISDNL--HELASCLAFLYHVGLYPIVLHGTGPQV
ARGB_VIBCM      ---------------------------LVIKLGGAALDCATLSKLFGAIAQYQNQAQRRIVIVHGGGYLV
ARGB_VIBCH      ---------------------------LVIKLGGAALDCATLSKLFGAIAQYQNQAQRRIVIVHGGGYLV
ARGB_VIBC3      ---------------------------LVIKLGGAALDCATLSKLFGAIAQYQNQAQRRIVIVHGGGYLV
ARGA_BUCAP      ---------------SVPYINAHRGKKFVIMLSGEAIKYGNFS-GIINDIGLLHSLGIRLIVVYGSCPQI
ARGA_AERHH      --------------QSTPYVNVHRGATFVLMMGGEALCHPNFAN-IVSDIALLQTLGIRLVLVFGSRPQN
ARGB_PHOPR      ---------------------------LVIKLGGAVLSNDTLEKLFTA-ISAYQASAQRPLLVHGGGYLV
ARGB_SERP5      ---------------------------LIIKLGGVLLSEEALERLFTALDSYRQQHQRPLVIVHGGGCLV
ARGB_SALAR      ---------------------------LIIKLGGVLLDNEEALERLFTALVNYRESHQRPLVVHGGGCVV
ARGA_AERS4      --------------QSTPYVNVHRGATFVLMMGGEAICHPNFAN-IVSDIALLQTLGIRLVLVFGSRPQN
ARG56_NEUCR     ----------------------------VIKVGGAILTDYL--DELCAALKFLYTVGLYPVIVHGAGPQL
ARGB_VIBVU      ---------------------------LVIKLGGAALSCSTLSQLFGAIASYQQKEQRQIVIVHGGGYLV
ARGA_PSESM      ------------LRHASPYINAHRDCTFVVMLPGDGVAHPNFGN-IVHDLVLLHSLGVRLVLVHGSRPQI
ARGB_VIBVY      ---------------------------LVIKLGGAALSCSTLSQLFGAIASYQQKEQRQIVIVHGGGYLV
ARGB_BUCAT      ---------------------------LVIKLGGVLLSDDAMKRLFEALVDYQKFYKRHVSVIHGGGRLI
ARGA_PSEU2      ------------LRHASPYINAHRDCTFVVMLPGDGVAHPNFGN-IVHDLVLLHSLGVRLVLVHGSRPQI
ARGA_PSESY      ------------LRHASPYINAHRDCTFVVMLPGDGVAHPNFGN-IVHDLVLLHSLGVRLVLVHGSRPQI
ARGA_AZOVD      ------------LRHASPYINAHRDCTFVVMLPGEGIEHPNFGN-IVHDLVLLHSLGVRLVLVHGSRPQI
ARGB_VIBPA      -------------------MTQTNQAPLVIKLGGAALSTQTLSQLFGAIAAYQKSAQRQIAIVHGGGYLV
ARGB_EDWI9      ---------------------------LIIKLGGVLLDNPQAMERLFQALLAYRHHDRRPIVVHGGGCLV
ARGB_ALTMD      -------------------------------------------------------------------PLV
ARGB_SODGM      ---------------------------LIIKLGGVLLSDEALERLFTALDSYRAEHRCPLLIVHGGGCLV
ARGB_AERPE      ----------------------------VVKIGGSIA--SRLERV-ADEIAVLAREGLRLVVVHGGGKVV
ARGB_BUCAI      ---------------------------LVIKLGGVLLSDDAMKRLFEALVDYQKFYKRHVSVIHGGGRLI
ARGB_BUCA5      ---------------------------LVIKLGGVLLSDDAMKRLFEALVDYQKFYKRHVSVIHGGGRLI
ARGB_BUCAP      ---------------------------LVIKLGGVLLSDNAMMRLFKALLDYQKSNKXXXXXXXXXXXXX
ARGB_PYRHO      ----------------------------VIKVGGSVL--ENLEKVFKPEIFR------DAVVVHGGSRYV
ARGB_PYRFU      ---------------------------------------------------LWRENGINSVIVHGGSRHV
ARCC_STAHJ      ---------------------------IVVALGGNALGQSPLVKGTAKSLVSLIQKGYEVVISHGNGPQV
ARGB_RUBXD      --------------------------------------------------------------------QL
ARGB_THET8      --------------------------------------------------------------------EI
CBK_TRIVA       ----------------------------------------------------------------------
ARCC_STAEQ      ---------------------------IVVALGGNALGKSPLVKNTAKSLVGLITKGHEIVISHGNGPQV
ARCC1_STAES     ---------------------------IVVALGGNALGKSPLVKNTAKSLVGLITKGHEIVISHGNGPQV
ARGB_PYRAB      ----------------------------------------------------------NSIIVHGGSRYV
ARCC1_STAAB     ---------------------------IVVALGGNALGKSPLVKNTAKSLVGLITKGHEIVISHGNGPQV
ARCC1_STAAR     ---------------------------IVVALGGNALGKSPLVKNTAKSLVGLITKGHEIVISHGNGPQV
ARCC1_STAAW     ---------------------------IVVALGGNALGKSPLVKNTAKSLVGLITKGHEIVISHGNGPQV
ARCC1_STAAS     ---------------------------IVVALGGNALGKSPLVKNTAKSLVGLITKGHEIVISHGNGPQV
ARCC1_STAAN     ---------------------------IVVALGGNALGKSPLVKNTAKSLVGLITKGHEIVISHGNGPQV
ARCC1_STAAM     ---------------------------IVVALGGNALGKSPLVKNTAKSLVGLITKGHEIVISHGNGPQV
ARCC1_STAAC     ---------------------------IVVALGGNALGKSPLVKNTAKSLVGLITKGHEIVISHGNGPQV
ARCC1_STAA8     ---------------------------IVVALGGNALGKSPLVKNTAKSLVGLITKGHEIVISHGNGPQV
ARCC1_STAA3     ---------------------------IVVALGGNALGKSPLVKNTAKSLVGLITKGHEIVISHGNGPQV
ARCC2_STAES     ---------------------------IVVALGGNALGQSPKEQXXXXXXXXXXDKGYEIVISHGNGPQV
ARCC2_ENTFA     ----------------------------VIALGGNAIGQKAVVNHAAKYIAEFVAKGEQVIVCHGNGPQV
PYRH_METS3      ----------------------------------------------------------------------
PROB_STRT2      ----------------------------------------------------------------------
PROB_STRT1      ----------------------------------------------------------------------
PROB_STRTD      ----------------------------------------------------------------------
PROB_GLOVI      ----------------------------------------------------------------------
PROB_CYAP8      -------------------------QTIVIKIGTSSLTQPESGKALVETLTQLRQLGHRIILVSSGAVGV
PROB_ACAM1      ------------------------SQTLVLKIGTSSLTNPDTGHSLVEVLSQLRQEGNQVILVSSGAVGI
ARCC3_STAA3     ---------------------------IVVALGGNALGQSPKEQXXXXXXXXXXDKGYEIVISHGNGPQV
ARCC_LACSK      -------------------------RKIVVALGGNAILSTDASKAVKETVAFVKQ-GDQLIISHGNGPQV
PROB_ANADE      ----------------------------------------------------------------------
PROB_THEMA      ----------------------------------------------------------------------
PROB_DEHE1      ----------------------------------------------------------------------
PROB_BACSK      --------------------------TIVIKIGSSSLTDGNGARGHVEAICELRHQGINVIVVTSGAVAA
PROB_OCEIH      ----------------------------------------------------------------------
PROB_METCA      --------------------------------GGKGLDQPAIGQ-WVQQIAELRQQGIQVVLVSSGSVAE
PROB_SYNAS      ----------------------------------------------------------------------
PROB_DEHSC      ----------------------------------------------------------------------
PROB_DEHSB      ----------------------------------------------------------------------
ARCC_LACHI      ----------------------------------------------AKHLVKFIENGDQLIISHGNGPQV
PROB_THICR      ----------------------------------------------------------------------
LEPA_POLSQ      ----------------------------------------------------------------------
PYRH_METST      ----------------------------------------------------------------------
PROB2_BACLD     ----------------------------------------------------------------------
NAGS_HUMAN      ----------------------------------------------------------------------
LEPA_RALSO      ----------------------------------------------------------------------
LEPA_RALPJ      ----------------------------------------------------------------------
LEPA_RALME      ----------------------------------------------------------------------
LEPA_RALEJ      ----------------------------------------------------------------------
LEPA_RALEH      ----------------------------------------------------------------------
LEPA_CUPTR      ----------------------------------------------------------------------
LEPA_BURVG      ----------------------------------------------------------------------
LEPA_BURTA      ----------------------------------------------------------------------
LEPA_BURS3      ----------------------------------------------------------------------
LEPA_BURPS      ----------------------------------------------------------------------
LEPA_BURP6      ----------------------------------------------------------------------
LEPA_BURP1      ----------------------------------------------------------------------
LEPA_BURP0      ----------------------------------------------------------------------
LEPA_BURMS      ----------------------------------------------------------------------
LEPA_BURMA      ----------------------------------------------------------------------
LEPA_BURM9      ----------------------------------------------------------------------
LEPA_BURM7      ----------------------------------------------------------------------
LEPA_BURM1      ----------------------------------------------------------------------
LEPA_BURCM      ----------------------------------------------------------------------
LEPA_BURCH      ----------------------------------------------------------------------
LEPA_BURCC      ----------------------------------------------------------------------
LEPA_BURCA      ----------------------------------------------------------------------
LEPA_BURA4      ----------------------------------------------------------------------
ARCC2_STAAB     ----------------------------------------------------------------------
PROB_THEEB      ----------------------------------------------------------------------
PROB_SYNJB      ----------------------------------------------------------------------
PROB_STRP6      ----------------------------------------------------------------------
NAGS_MOUSE      ----------------------------------------------------------------------
LEPA_NITMU      ----------------------------------------------------------------------
ARCC2_STAAC     ----------------------------------------------------------------------
ARCC2_STAA8     ----------------------------------------------------------------------
ARCC2_STAA3     ----------------------------------------------------------------------
PYRH_HALSA      ----------------------------------------------------------------------
PYRH_HALS3      ----------------------------------------------------------------------
PROB_KLEP7      ----------------------------------------------------------------------
PROB_KLEP3      ----------------------------------------------------------------------
PROB_BACSU      ----------------------------------------------------------------------
PROB_BACCR      ----------------------------------------------------------------------
LEPA_NITEU      ----------------------------------------------------------------------
LEPA_NITEC      ----------------------------------------------------------------------
LEPA_BURP8      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GAMLSKMGIESKFEGGLRVTDAKTVEIVEMVLAGSINKEIVALINQTGEWAIGLCGKDGNMVFAEKAKKT
ARGB_AGRT5      GAMLSKMGIESKFEGGLRVTDAKTVEIVEMVLAGSINKEIVALINQTGEWAIGLCGKDGNMVFAEKAKKT
ARGB_RHIE6      GAMLNKMGIESKFEGGLRVTDQKTVEIVEMVLAGSINKEIVALINQTGEWAIGLCGKDGNMVFAEKARKT
ARGB_RHIL3      GAMLSKMGIESKFEGGLRVTDQKTVEIVEMVLAGSINKEIVALINQTGEWAIGLCGKDGNMVFAEKARKT
ARGB_AGRVS      GAMLTKMGIESKFEGGLRVTDQKTVEIVEMVLAGSINKEIVALINQTGEWAIGLCGKDGNMVFAEKAKKT
ARGB_RHIEC      GAMLTKMGIESKFEGGLRVTDQKTVEIVEMVLAGSINKEIVALINQTGEWAIGLCGKDGNMVFAEKARKT
ARGB_RHILW      GAMLNKMGIESKFEGGLRVTDQKTVEIVEMVLAGSINKEIVALINQTGEWAIGLCGKDGNMVFAEKARKT
ARGB_RHIME      GAMLNRMGIESKFEGGLRVTDEKTVEIVEMVLAGSINKEIVALINQTGEWAIGLCGKDGNMVFAEKAKKT
ARGB_SINMW      GAMLNKMGIESKFEGGLRVTDEKTVEIVEMVLAGSINKEIVALINQTGEWAIGLCGKDGNMVFAEKAKKT
ARGB_RHISN      GAMLNKMGIESKFEGGLRVTDEKTVEIVEMVLAGSINKEIVALINQTGEWAIGLCGKDGNMVFAEKARKT
ARGB_AGRRK      GAMLTKMGIESKFEGGLRVTDQKTVEIVEMVLAGSINKEIVALINQTGEWAIGLCGKDGNMVFAEKAHKT
ARGB_RHILO      GAMLTKMGIESKFEGGLRVTDQKTVEIVEMVLAGSINKEIVALINAEGEWAIGLCGKDGNMVFAEKARKT
ARGB_MESSB      GDMLKRMGIESKFEGGLRVTDQKTVEIVEMVLAGSINKEIVALINAEGEWAIGLCGKDGNMVFAEKARKT
ARGB_OCHA4      QAMLTKLGIESRFEGGLRVTDEKTVEVVEMVLAGSINKEIVALINAEGEWAIGLCGKDGNMVFAQKAHKT
ARGB_BRUSU      QAMLTKLGIESRFEGGLRVTDEKTVEVVEMVLAGSINKEIVALINAEGEWAIGLCGKDGNMVFAQKAHKT
ARGB_BRUSI      QAMLTKLGIESRFEGGLRVTDEKTVEVVEMVLAGSINKEIVALINAEGEWAIGLCGKDGNMVFAQKAHKT
ARGB_BRUO2      QAMLTKLGIESRFEGGLRVTDEKTVEVVEMVLAGSINKEIVALINAEGEWAIGLCGKDGNMVFAQKAHKT
ARGB_BRUC2      QAMLTKLGIESRFEGGLRVTDEKTVEVVEMVLAGSINKEIVALINAEGEWAIGLCGKDGNMVFAQKAHKT
ARGB_BRUME      QAMLTKLGIESRFEGGLRVTDEKTVEVVEMVLAGSINKEIVALINAEGEWAIGLCGKDGNMVFAQKAHKT
ARGB_BRUMB      QAMLTKLGIESRFEGGLRVTDEKTVEVVEMVLAGSINKEIVALINAEGEWAIGLCGKDGNMVFAQKAHKT
ARGB_BRUAB      QAMLTKLGIESRFEGGLRVTDEKTVEVVEMVLAGSINKEIVALINAEGEWAIGLCGKDGNMVFAQKAHKT
ARGB_BRUA2      QAMLTKLGIESRFEGGLRVTDEKTVEVVEMVLAGSINKEIVALINAEGEWAIGLCGKDGNMVFAQKAHKT
ARGB_BRUA1      QAMLTKLGIESRFEGGLRVTDEKTVEVVEMVLAGSINKEIVALINAEGEWAIGLCGKDGNMVFAQKAHKT
ARGB_BART1      AEILMKMGIESRFENGLRVTDERIVEVVEMVLAGSINKEIVALINAEGEWAIGLCGKDGNMVFAEKAYRT
ARGB_BARQU      AEILMKMGIESRFENGLRVTDERIVEVVEMVLAGSINKEIVALINAEGEWAIGLCGKDGNMVFAEKAYKT
ARGB_BARHE      AEILMKMGIESRFENGLRVTDERIVEVVEMVLAGSINKEIVALINAEGEWAIGLCGKDGNMVFAEKAYKT
ARGB_BARBK      AETLKKMGIESRFESGLRVTDEKIVEVVEMVLAGSINKEIVALINAEGEWAIGLCGKDGNMVFAEKVHKT
ARGB_RHOPB      ATMLKRLGIKSEFAAGLRITDAATIEIVEMVLAGSINKQLVGYINEAGGKAVGLCGKDGNMVSATKATRT
ARGB_BRASO      ATMLKRLGIVSEFAAGLRITDAATIEIVEMVLAGSINKQLVGYINEAGGKAVGLCGKDGNMVRAVKATRT
ARGB_METS4      GRMLDRLGIKSEFREGLRVTDAATVEVVEMVLAGSINKQIVGWISAEGGKAIGLCGKDGNMVQARRATRT
ARGB_BRASB      ATMLKRLGIVSEFAAGLRITDAATIEIVEMVLAGSINKQLVGYINEAGGKAVGLCGKDGNMVRAVKATRT
ARGB_RHOPA      AQMLKRLGIKSEFAAGLRITDAATIEIVEMVLAGSINKQLVGYINEAGGKAVGLCGKDGNMVSASKATRT
ARGB_RHOP5      ATMLKRLGIKSEFAAGLRITDAATIEIVEMVLAGSINKQLVGYINEAGGKAVGLCGKDGNMVTACKATRT
ARGB_RHOPT      AQMLKRLGIKSEFAAGLRITDAATIEIVEMVLAGSINKQLVGYINEAGGKAVGLCGKDGNMVSATKATRT
ARGB_NITWN      AAMLQRLGIKSEFAAGLRITDAATIEIVEMVLAGSINKQLVGYINEAGGKAVGLCGKDGNMVTAAKATRM
ARGB_OLICO      ATMLGRLGIKSEFAAGLRITDASAIEIVEMVLAGSINKQIVSHINAAGGKAVGLSGKDGNMVTAVKATRT
ARGB_NITHX      ATMLQRLGIKSEFAAGLRITDAATIEIVEMVLAGSINKQLVGYINEAGGKAVGLCGKDGNMVTASKATRT
ARGB_METNO      GRMLDRLGIKSEFREGLRVTDEATVEVVEMVLAGSINKQIVGWISAEGGKAIGLCGKDGNMVQARRATRT
ARGB_RHOPS      ATMLKRLGIKSEFAAGLRITDGATIEIVEMVLAGSINKQLVGYINEAGGKAVGLCGKDGNMVTASKATRT
ARGB_RHOP2      ATMLKRLGIKSEFAAGLRITDGATIEIVEMVLAGSINKQLVGYINEAGGKAVGLCGKDGNMVTASKATRT
ARGB_PARL1      GAMLNRLGIKSEFSGGLRITDKATVEIVEMVLAGSINKQIVAQLNQAGGRAVGLCGKDGNLVVARKVHQK
ARGB_BRAJA      ATMLKRLGIQSEFAAGLRITDAATIEIVEMVLAGSVNKQIVGYINEAGGKAVGLSGKDANMVKASKTTRT
ARGB_AZOC5      GAMLEKLGIKSEFAAGLRITDKATIEIVEMVLAGSINKQIVGFINEAGGKAIGLCGKDGNMVRARKATRT
ARGB_SPHWW      GKMLKTLGVESRFVDGLRVTDAETARVAEMVLCGSINKEIVSWIAQAGGRAVGLSGKDGRMVVAEKVRRT
ARGB_RHOCS      GQMLERLKIKSEFVDGLRVTDKETVEIAEMVLSGSINKQIVALINDAGGDAVGLSGKDDDLIEARKVTRS
ARGB_SPHAL      GAMLKQLGIESTFVGGLRVTDAATAEVAEMVLAGKINKEIVGWIAGLGGRAVGISGKDANLVLAEKVKRS
ARGB_RHORT      GRMLDTLRIQSTFIDGLRVTDAATVDVVEMVLAGSINKAIVTEINQAGGCAVGLSGKDGRLIQARKMVRK
ARGB_GRABC      NDMLKRLAIQSRFVDGLRVTDXXXXXXXXXXLAGTVNKMVAGLINRAGAMAVGICGKDGGLIHARKLQRT
ARGB_GLUOX      SAMLDRLKIRSEFIDGLRVTDKSMVDVIEMVLSGSVNKQVTQLINRAGALAVGISGKDGGLIQARRLTRT
ARGB_NOVAD      GRMLKALGIESRFVDGLRVTDKQTAEVAEMVLAGAINKELVSWIARAGGKAIGISGKDGGMVIXXXXXXX
ARGB_ACICJ      NAMLKRLAIQSTFVDGLRVTDXXXXXXXXXXLAGTVNKMVAGLINRAGALAVGICGKDGGLIRARKLTRT
ARGB_ERYLH      GAMLKRLGVESTFVDGLRVTDKATAEVAEMVLSGAINKELVGWIAQAGGKAMGVSGKDGSLVTATKLERT
ARGB_SACD2      GDLLKKLNIESSFVDGMRVTDSATMDVVEMVLGGTVNKQIVSLINRNGGQAIGVTGKDGNLIHAKKLTVN
ARGB_SYNFM      GRMLKRIGKESDFCAGMRVTDADTMDIVEMVLAGKINKEIVSLINRHGGHAVGLSGKDGNLIEARKLHVY
ARGB_HYPNA      GKLLDKLGIVSEFKDGLRVTDEATMEVVEMVLSGPINKSIVRAINQAGGKAVGLSGADGNLLRAEKATRT
ARGB_THICR      GHLLERVGKQSEFIQGMRVTDSETMDIVEMVLGGMVNKEIVNLIHQHNGNAVGLTGKDGNLIRAKKMEMT
ARGB_HAHCH      GDLLQRLNIKSSFINGLRVTDSETMDVVEMVLGGSVNKDIVALINRNGGKAIGLTGKDANFITARKLEVT
ARGB_NITOC      GRLLERVGKQSEFIQGMRVTDKETMDIVEMVLSGQVNKEIVNLINRHGGHAVGLTGKDGTLIHAEKLHLT
ARGB_DECAR      ESLLARVGKKGEFIQGMRVTDAETMEVVEMVLGGQVNKDIVNLINQHGGKAVGLTGKDGNFI---RAKKL
ARGB_PELCD      GQVLKSMGKESRFVQGMRVTDQETMDVAEMVLGGKVNKEIVANINRHDGKAVGLSGKDGRLILARKLEMT
ARGB_GEOMG      NETLKRYGIVSEFVRGMRVTDAATMQVVEMVLTGQVNKEVVGYLNQHGGRAVGLSGKDGSLLLCRKLLQE
ARGB_CELJU      GSLLEKLNIKSEFINGMRVTDSATMDVVEMVLGGTVNKQIVSLINRNGGQAIGLTGKDGQLIRAKKLTVT
ARGB_GEOSL      NETLKRYGIVSEFVKGMRVTDAATMQVVEMVLTGQVNKEVVGYLNQHGGRAVGLSGKDGNLLLCRKLLQE
ARGB_DESPS      NNLLDRLDIKPSYVQGMRVTDGETMDVVEMVLVGKVNKEIVGLINHCGGKAVGLSGRDGDLVCAEQLQMN
ARGB_METCA      GNLLQRLGKTSEFVQGMRVTDAETMDVVEMVLGGLVNKEIVNLINRQGGAAVGLSGKDGDLIRARKIRMS
ARGB_GEOSM      NETLKRYGIVSEFVKGMRVTDKETMGVVEMVLTGQVNREVVGYINQNGGRAAGLSGKDGDLLICEKLLQE
ARGB_VESOH      GKILEKIGKQSQFIDGMRVTDSETMDVVEMVLGGLVNKEIVNLIHQHGGHSIGLTGKDGSLISAKKLKSD
ARGB_GEOBB      NETLKRYGIVSEFVKGMRVTDKETMGVVEMVLTGQVNREVVGYINQNGGRAAGLSGKDGDLLICEKLLQE
ARGB_NITEC      DSMLKRVGKEGVFIQGMRVTDAETMDIVEMILGGLINKEIVNLINRHGGQAVGLTGKDGMFI---RAKRM
ARGB_RUTMC      GKTLKKIGKQSQFIDGMRVTDSETMDVVEMVLGGLVNKEIVNLIHQHGGHSIGLTGKDGSLISAKKLKHD
ARGB_MARAV      GELLERLNIQSRFVNGMRVTDAETMDVVEMVLGGQVNKEIVSLINAHGGTAVGLTGKDANLIRARKLEVV
ARGB_ALHEH      GKLLERIGKHTEFVQGMRVTDAETMDVVEMVLGGLVNKEIVNLINSQGGRAVGLTGKDGGMIRARRLRLS
ARGB_ACIAD      DSLLKRLGQVSDRIDGMRVTDEATMEVVEMVLGGSVNKSIVNLINQHGGRAIGLTGKDGNLIRARKLLME
ARGB_CHRSD      GELLERLNIESRFVGGMRVTDAETMDVVEMVLGGLVNKSIVNLINRSGGKAIGLTGKDGAQITARQLRVE
ARGB_GLUDA      SAMLTRLQIPSTFVDGLRVTDAAMVDVIEMVLAGKVNKQVAGLINQAGALAVGISGKDGGLITARRLQRT
ARGB_ACIBY      DSFLKQLGRESDRIDGMRVTDEATMEVVEMVLGGSVNKSIVNLINKHGGRAIGLTGQDGNLLRARKLLME
ARGB_ACIBT      DSFLKQLGRESDRIDGMRVTDEATMEVVEMVLGGSVNKSIVNLINKHGGRAIGLTGQDGNLLRARKLLME
ARGB_ACIBS      DSFLKQLGRESDRIDGMRVTDEATMEVVEMVLGGSVNKSIVNLINKHGGRAIGLTGQDGNLLRARKLLME
ARGB_ACIBC      DSFLKQLGRESDRIDGMRVTDEATMEVVEMVLGGSVNKSIVNLINKHGGRAIGLTGQDGNLLRARKLLME
ARGB_ACIB5      DSFLKQLGRESDRIDGMRVTDEATMEVVEMVLGGSVNKSIVNLINKHGGRAIGLTGQDGNLLRARKLLME
ARGB_ACIB3      DSFLKQLGRESDRIDGMRVTDEATMEVVEMVLGGSVNKSIVNLINKHGGRAIGLTGQDGNLLRARKLLME
ARGB_POLNA      ETALNRLGKKGHFIQGMRVTDDETMEVVEWVLAGQVQQDIVGLINQAGGKAVGLTGRDGGMIRAKKL--T
ARGB_NITEU      DHMLKRVGKEGVFIQGMRVTDAETMDIVEMVLGGLINKEIVNLINRHGGQAVGLTGKDGMFI---RAKRM
ARGB_POLSJ      EAALNRLGKKGHFIQGMRVTDEETMEVVEWVLAGQVQQDIVGLINQAGGKAVGLTGRDGGLIRAQKLK--
ARGB_AZOSB      ETLLAKVGKKGEFVQGMRVTDAETMEVVEMVLGGQVNKEIVNLINQAGGKAVGLTGKDASFIRAKKLLMQ
ARGB_VEREI      ETALNRLGKKGVFIQGMRVTDAETMEVVEWVLAGQVQQDIVGLINQAGGKAVGLTGRDGAMIRAQKL-KM
ARGB_ACISJ      EQALNRLGKKGEFIQGMRVTDAETMEVVEWVLAGEVQQDIVGLIHQAGGKAVGLTGRDGGMIRAKKL-KM
ARGB_PERMH      GQMLKRMGLESKFVGGLRVTDRETMEVVEMVLGGLVNKSIVMLINRYAGGAVGLTGKDGGLIRAKKLDAQ
ARGB_MAGSM      GLIMKRMGLEPKFIDGLRVTDEDTMSVVEMVLAGKVNKDIVNLINLNGGRAAGLSGKDGYTIQARKRTHV
ARGB_CHRVO      NDLLARVGKQGEFIQGMRVTDAETMEVVEMVLGGLVNKEIVSLINKHGGKAVGLTGKDGHFI---RARKL
ARGB_DELAS      ETALNRLGKKGEFIQGMRVTDAETMEVVEWVLAGEVQQDIVGLIHQAGGKAVGLTGRDGGLIRARKL-KM
ARGB_ACIAC      ETALKRLGKQGHFIQGMRVTDAETMEVVEWVLAGEVQQDIVGLINQAGGKAVGLTGRDGGLIRARKLK--
ARGB_PELPD      NQTLKRYGIVSQFVKGMRVTDSETMAVVEMVLVGQVNKEVVGYLNQHGGRAVGLSGKDGTLLLSKKLLQD
ARGB_AZOSE      ETLLARVGKKGEFIQGMRVTDAETMEVVEMVLGGQVNKEIVSLINQHGGKAVGLTGKDASFI---RAKKL
ARGB_POLSQ      DEALKKIGKTGTFIQGMRVTDEETMEVVEWVLGGEVQQDIVMLINHFGGQAVGLTGKDGGLIHA---KKM
ARGB_BORPD      DDALRRIGKQGTFVQGMRVTDAETMEVVEWVLGGQVQQDIVMMINEVGGKAVGLTGKDGMLI---QARKK
ARGB_METFK      NELLDKLGKKGEFIQGMRVTDEETMDIVEMVLGGQVNKEIVNLINRNGGKAVGLTGQDGNFI---HARKL
ARGB_LAWIP      GNMLSRLNIQSEFREGLRVTDKATMDVVEMVLAGSVNKEIVNQVNQAGAKAVGLSGKDGAFILAEK-NDL
ARGB_NOSP7      NSWLDKLGIEPQFKNGLRVTDAATMDVVEMVLVGRVNKEIVALINQAGGLAVGLCGKDGNLFTARPQGQE
ARGB_DESRM      TGMLHRLGIESQFVSGLRVTDAPTMEVVEMVL-GKLNKEIVALINGLGGRSVGLSGKDANLIMANKKYSN
ARGB_ANATD      NSVLKKLNVESQFVNGLRVTDMQTMEVAQMVLVGKTNKELVSMLNQKGGKAIGICGIDGNLIQARKHYEY
ARGB_POLNS      DEALKKIGKTGTFIQGMRVTDEETMEVVEWVLGGEVQQDIVMLINHFGGQAVGLTGKDGGLI---RAKKM
ARGB_BURCM      DQALKKIGKAGTFIQGMRVTDEETMEVVEWVLGGEVQQDIVTLINHFGGHAVGLTGKDGGLIHARK----
ARGB_BURA4      DQALKKIGKAGTFIQGMRVTDEETMEVVEWVLGGEVQQDIVTLINHFGGHAVGLTGKDGGLIHARK----
ARGB_BURS3      DHALKKIGKAGTFIQGMRVTDEETMEVVEWVLGGEVQQDIVMLINHFGGHAVGLTGKDGGLIHARK----
ARGB_BURCH      DHALKKIGKAGTFIQGMRVTDEETMEVVEWVLGGEVQQDIVMLINHFGGHAVGLTGKDGGLIHARK----
ARGB_BURCC      DHALKKIGKAGTFIQGMRVTDEETMEVVEWVLGGEVQQDIVMLINHFGGHAVGLTGKDGGLIHARK----
ARGB_BURCA      DHALKKIGKAGTFIQGMRVTDEETMEVVEWVLGGEVQQDIVMLINHFGGHAVGLTGKDGGLIHARK----
ARGB_BORPA      DDALRRIGKQGTFVQGIRVTDAETMEVVEWVLGGQVQQDIVMMINEVGGKAVGLTGKDGMLI--QATKKL
ARGB_BORBR      DDALRRIGKQGTFVQGMRVTDAETMEVVEWVLGGQVQQDIVMMINEVGGKAVGLTGKDGMLI--QATKKL
ARGB_BURPS      DQALKKIGKQGTFIQGMRVTDEETMEVVEWVLGGEVQQDIVTLINHFGGHAVGLTGKDGGLI---HARKL
ARGB_BURP6      DQALKKIGKQGTFIQGMRVTDEETMEVVEWVLGGEVQQDIVTLINHFGGHAVGLTGKDGGLI---HARKL
ARGB_BURP1      DQALKKIGKQGTFIQGMRVTDEETMEVVEWVLGGEVQQDIVTLINHFGGHAVGLTGKDGGLI---HARKL
ARGB_BURP0      DQALKKIGKQGTFIQGMRVTDEETMEVVEWVLGGEVQQDIVTLINHFGGHAVGLTGKDGGLI---HARKL
ARGB_BURMS      DQALKKIGKQGTFIQGMRVTDEETMEVVEWVLGGEVQQDIVTLINHFGGHAVGLTGKDGGLI---HARKL
ARGB_BURMA      DQALKKIGKQGTFIQGMRVTDEETMEVVEWVLGGEVQQDIVTLINHFGGHAVGLTGKDGGLI---HARKL
ARGB_BURM9      DQALKKIGKQGTFIQGMRVTDEETMEVVEWVLGGEVQQDIVTLINHFGGHAVGLTGKDGGLI---HARKL
ARGB_BURM7      DQALKKIGKQGTFIQGMRVTDEETMEVVEWVLGGEVQQDIVTLINHFGGHAVGLTGKDGGLI---HARKL
ARGB_BURVG      DHALKKIGKAGTFIQGMRVTDEETMEVVEWVLGGEVQQDIVMLINHFGGHAVGLTGKDGGLIHARK----
ARGB_BURTA      DQALKKIGKQGTFIQGMRVTDEETMEVVEWVLGGEVQQDIVTLINHFGGHAVGLTGKDGGLI---HARKL
ARGB_BURP8      DQALKKIGKQGTFIQGMRVTDEETMEVVEWVLGGEVQQDIVTLINHFGGHAVGLTGKDGGLIHARK----
ARGB_BURCJ      DHALKKIGKAGTFIQGMRVTDEETMEVVEWVLGGEVQQDIVMLINHFGGHAVGLTGKDGGLIHARK----
ARGB_BORA1      DDALRRLGKQGTFVQGMRVTDAETMEVVEWVLGGQVQQDIVMMINEAGGKAVGLTGKDGMLLQAR--KKL
ARGB_THIDA      AGLLQRIGKQSEFIQGMRVTDEETLDVVEMVLGGLVNQDIVTLINKHGGRAVGLTGKDGNFI---HAKKM
ARGB_PSEMY      GDLLKRLSIESHFIDGMRVTDTATMDVVEMVLGGQVNKSIVNLINQHGGSAIGLTGKDAGLIRAKKLKVT
ARGB_BORPE      DDALRRIGKQGTFVQGMRVTDAETMEVVEWVLGGQVQQDIVMMINEVGGKAVGLTGKDGMLI--QATKKL
ARGB_THENN      SQMMKELGIEPVFKNGHRVTDERTMEIVEMVLVGKINKEIVMNINLHGGRAVGICGKDSKLIVAEKETK-
ARGB_PSEE4      GDLLKRLSIESHFIDGMRVTDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAELIRARKLTVT
ARGB_LEPBA      NSLIKSLNLNTQFIRGHRVTDEATMEVVEMVLTGKVNKQIVSLIQEKGGKPVGLSGKDGGLAIAEKYLME
ARGB_BURXL      DQALKKIGKQGTFIQGMRVTDEETMEVVEWVLGGEVQQDIVTLINHFGGHAVGLTGKDGGLIHARK----
ARGB_BURPP      DQALKKIGKQGTFIQGMRVTDEETMEVVEWVLGGEVQQDIVTLINHFGGHAVGLTGKDGGLIHARK----
ARGB_AQUAE      SKTLEKFGIKPKFVGGMRKTDEETMHVVEMVLSGDINKDIVALINRSGEYAVGLSGRDGRLLKAKKLDKE
ARGB_PSEF5      GDLLKRLSIESHFVDGMRVTDAQTMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAELIRAKKLTVT
ARGB_PSEFS      GDLLKRLSIESHFIDGMRVTDAQTMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAELIRAKKLTVT
ARGB_HERAR      DNALKKIGKQGTFIQGMRITDEETMEVVEWVLGGEVQQDIVMLINHYGGQAVGLTGKDGGLI---RARKM
ARGB_NITMU      NDMLKRVGKQGAFIQGMRVTDAETMDVVEMVL-GLINKEIVNLINQHGGRAVGLTGKDGSFI---RAKKM
ARGB_PSEU5      GDLLKRLNIESHFIDGMRVTDSQTMDVVEMVLGGQVNKSIVSLINQHGGSAIGLTGKDAGLIRARKLKAT
ARGB_MOOTA      TSMLGRLGKQSQFIQGQRVTDAETMEIVEMVLVGKINKEIVANIHRYGGKAIGLCGKDGHLIEARK-QVA
ARGB_JANMA      DNALKKIGKQGTFVQGMRITDEETMEVVEWVLGGEVQQDIVMLINHYGGQAVGLTGKDGGLI---RAKKM
ARGB_CAUCR      SRMLDKAGVKSTFVDGLRVTDEATMEVAEMVLSGAINKEIANWITLAGAEAVGLSGKDARLITAEKVTRT
ARGB_CAUCN      SRMLDKAGVKSTFVDGLRVTDEATMEVAEMVLSGAINKEIANWITLAGAEAVGLSGKDARLITAEKVTRT
ARGB_ANAVT      NSWLDKLGIEAQFKNGLRVTDAPTMDVVEMVLVGRVNKEIVSLINQAGGLAVGLCGKDGNLITARPQGQE
ARGB_EHRCR      NEFLEKINKKSTFVNGLRVTDAETLEIVEMVLCGLVNKDITQLINKAGGNAIGLCGKDANLIEAKKVCYT
ARGB_DINSH      NAMLAKLDINSDFVNGKRVTDAATIEVVEMVLSGLVNKRIVQAINREGGRAIGLSGKDANLIVCDPA---
ARGB_PSEPK      GDLLKRLSIESHFIDGMRVTDSATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAELIRARKLTVS
ARGB_PSEP1      GDLLKRLSIESHFIDGMRVTDSATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAELIRARKLTVS
ARGB_PETMO      NKMLASLNIETKFVNGLRVTDEKVMEIVEMVLVGKINKEITSLINKTGGKAVGLSGKDANLLLAEKDLSQ
ARGB_METST      SRSMDKMGKEPKFIGGLRVTDKETMEIVKMVLVGKINTEIVSKLGFHGGKSVGISGKDSYLVEASRKGLT
ARGB_METPP      DEALSRLGKKGTFIQGMRVTDEETMEVVEWVLGGEVQQDIVGLINAVGGKAVGLTGRDGGMIRARKLKMV
ARGB_THEEB      NTWLAKLNIEPQFKNGLRVTDAATMDVVEMVLVGRVNKEIVTLINQAGGQAVGLCGKDGNLIRARAKGEE
ARGB_PSEPG      GDLLKRLSIESHFIDGMRVTDSATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAELIRARKLTVS
ARGB_ANASP      NSWLDKLGIEAQFKNGLRVTDAPTMDVVEMVLVGRVNKEIVSLINQAGGLAVGLCGKDGNLITARPQGQE
ARGB_PSEPW      GDLLKRLSIESHFIDGMRVTDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAELIRAKKLTVS
ARGB_CLOTH      NKALDKFNIKSRFINGLRLTDKATMDVAQMVLVGKTNKEIVSILNQMGGKAVGICGIDGNVIECEQYKTT
ARGB_CALS8      NSVLKKLNVESQFVNGLRVTDMQTMEVAQMVLVGKTNKELVSMLNQKGGKAIGICGIDGNLIQARKHYEI
ARGB_RALSO      DDALKKVGKTGTFIQGMRVTDEETMEVVEWVLGGEVQQDIVMLINQYGGQAVGLTGKDGGLI---RAKKL
ARGB_RALME      DEALKKVGKVGTFIQGMRVTDEETMEVVEWVLGGEVQQDIVMLINQYGGQAVGLTGKDGGLI---RAKRL
ARGB_PSEPF      GDLLKRLSIESHFVDGMRVTDAATMDVVEMVLGGQVNKSIVNLINRHGGSAIGLTGKDAGLIRAKKLTVT
ARGB_HALOH      SEAMESMDKEARFIQGLRITDSETMSLVEMVLVGKVNKELVSIINRLGGEAVGICGKDGGLIEADK----
ARGB_DESVV      GKMLEQLNIQSHFREGLRVTDDATMDVVEMVLVGKVNKEIVNQMNLAGAKAVGLSGKDGMLIRARK-MEM
ARGB_DESVH      GKMLEQLNIQSHFREGLRVTDDATMDVVEMVLVGKVNKEIVNQMNLAGAKAVGLSGKDGMLIRARK-MEM
ARGB_ZYMMO      XKMLKALGVESQFIDGLRVTDNETAKIAEMVLSGAINKDIVSWIGRAGGRAVGISGKDAKLVEVEKVKKI
ARGB_PSEU2      GDLLKRLSIESHFIDGMRVTDAQTMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAELIRAKKLTVT
ARGB_PSESM      GDLLKRLSIESHFIDGMRVTDAQTMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAELIRAKKLTVT
ARGB_PSE14      GDLLKRLSIESHFIDGMRVTDAQTMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAELIRAKKLTVT
ARGB_MARMS      GDMLAKLNIESKFINGMRVTDTATMDVVEMVLGGQVNKEIVNLICEAGGKAIGITGKDSRFI---KAKKL
ARGB_GEOLS      NETLKRYGIVSEFVRGMRVTDGETMSVVEMVLVGQVNKEVVGYLNQHGGKAVXXXXXXXXXXXXXXXXQE
ARGB_EHRRG      NEFLEKINKKSTFINGLRITDAETLEIVEMVLCGLVNKNITQLINNAGGNAIGLCGKDANLIEAKKICYT
ARGB_SULSY      GQYLKKMGLESKFVGGLRVTDKETMDIVEMVLGGLVNKSIVQLINSYSGGAVGITGKDGCLI---KAKKL
ARGB_EHRRW      NEFLEKINKKSTFINGLRITDAETLEIVEMVLCGLVNKNITQLINNAGGNAIGLCGKDANLIEAKKICYT
ARGB_PSEA7      GDLLKRLSIESHFIDGMRVTDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAELIRAKKLTVT
ARGB_RALEH      DEALKKVGKVGTFVQGMRVTDEETMEVVEWVLGGEVQQDIVMLINQYGGQAVGLTGKDGGLI---RAKRL
ARGB_PSEAE      GDLLKRLSIESHFIDGMRVTDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAELIRAKKLTVT
ARGB_PSEAB      GDLLKRLSIESHFIDGMRVTDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAELIRAKKLTVT
ARGB_PSEA8      GDLLKRLSIESHFIDGMRVTDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAELIRAKKLTVT
ARGB_EHRCJ      NSFLEKINKKSTFINGLRVTDAETLEVVEMVLCGLVNKDITQLINKAGGNAIGLCGKDANLIEAKKVCYT
ARGB_CLOD6      NKMLAKVDIESKFVNGLRYTDEETMEIVKMVLAGKVNKDLVNKIHTKGGKAVGLCGIDNNMI--------
ARGB_CAUSK      SRMLDKAGVKSTFVDGLRVTDEATMEVAEMVLSGAINKEIANWITLAGAEAVGLSGKDARMITAEKVTRT
ARGB_THETN      SSFLKKLGIESKFVNGLRVTDEKTAEIVEMVLVGKINKEIVSMINELGGMAVGISGKDGKLLKAEKDLSN
ARGB_PSYA2      DNLLKELGRHSDRIDGMRVTDKSTMDIVEMVLGGSVNKSIVSLINKHGGCAIGLTGKDANLILAKKLMME
ARGB_METJA      NKAMEKMGKKPEFVHGLRVTDEETLDIVEMVLAGKINGDIVSKLSKFGGKAVGLSGKSGRXXXXXXXXXX
ARGB_PSYCK      DNLLKELGRHSDRIDGMRVTDKDTMDIVEMVLGGNVNKSIVSLINKHGGCAIGLTGKDANLILAKKLMME
ARGB_HALHL      GNLLERIGKETEFVQGMRVTDAETMDVVEMVLGGLVNKEIVNLISAQGGRAVGLTGKDGGLIRARKLEVE
ARGB_METLZ      TLKMKALGKEARFVGGLRVTDEETLEIAQMVLAGKIGNMIVSMIAKNGAKGVGISGNDGGLVIAEKTPRK
ARGB_CLOK5      SSYLKKLNKESVFIDGLRYTDEETMDVVQMVLSGKVNKDLVKLIQSYGGKALGLCGIDGAMIKAEKISKG
ARGB_CLOK1      SSYLKKLNKESVFIDGLRYTDEETMDVVQMVLSGKVNKDLVKLIQSYGGKALGLCGIDGAMIKAEKISKG
ARGB_ACAM1      NLWLEKLGIEPQFMKGLRVTDAPTMDVVEMVLVGRVNKELVSLINQAGGSAVGVCGKDGKLLTARPQGES
ARGB_SYNP6      NAWLGRVGIEPQFHNGLRVTDADTMEVVEMVLVGRVNKDIVSRINTTGGRAVGFCGTDGRLVLARPHDQE
ARGB_SYNE7      NAWLGRVGIEPQFHNGLRVTDADTMEVVEMVLVGRVNKDIVSRINTTGGRAVGFCGTDGRLVLARPHDQE
ARGB_PELTS      TEMLKRVGKDSRFVGGLRVTDGETMEIVEMVLVGKINKGIVSRINRIGGLAVGLSGKDAGLFQAVKKYRK
ARGB_ALCBS      GELLERLGKESKFVQGMRVTDRETMDVVQMVLGGLVNKDIVNLIQHNGGQAIGLTGKDGRLIKARKMVLK
ARGB_RALEJ      DEALKKVGKVGTFVQGMRVTDEETMEVVEWVLGGEVQQDIVMLINQYGGQAVGLTGKDGGLI---RAKRL
ARGB_METS3      SRSMDKLGKEPKFIKGLRVTDEETMEIIEMVLVGKISTDIVSQISYHDGKGISLSGKDSRLIFAHKKPVS
ARGB_SYNWW      NQMLSRLGIQSEFVNGFRVTDAATMEIVEMVLGGKVNKEIVAGIHASGGKAVGISGKDGMLIQAHPADGS
ARGB_THESQ      SQMMKDLGIEPVFKNGHRVTDEKTMEIVEMVLVGKINKEIVMNLNLHGGRAVGICGKDSKLIVAEKETKH
ARGB_THEMA      SQMMKDLGIEPVFKNGHRVTDEKTMEIVEMVLVGKINKEIVMNLNLHGGRAVGICGKDSKLIVAEKETKH
ARGB_THEP1      SQMMKDLGIEPVFKNGHRVTDEKTMEIVEMVLVGKINKEIVMNLNLHGGRAVGICGKDSKLIVAEKETKH
ARGB_JANSC      NDMLAKLGIESTFLNGKRVTDAATVDVVEMVLSGRVNKRIVQAINAQGGKAVGLSGKDANLITCVPA---
ARGB_SYNAS      GSFLKKLGKDSKFIQGMRVTDEETMNIVEMVLVGKVNKEIVGLINHAGGKAVGLSGKDGSLIRAEKYYLS
ARGB_KOSOT      SSLMNQLGIEPVFKNGYRITDEKTMEIVEMVLVGKVNKDIVMNINLHGGKAIGVCGKDGELLLAEKETK-
ARGB_DESMR      GRMLKLLNIESQFKQGLRVTDDATMDVVEMVLVGKVNKNIVNLINLKGGSAVGLSGKDGRLITARKLEMV
ARGB_CARHZ      SRMLNKLNIKSNFINGLRVTDEATLEVVEMVLVGKVNKEIVGLIEKAGGKAVGLSGKDAGLIKAH--KKL
ARGB_THEP3      NKMLERLGIESKFVNGLRVTDEATMEIVEMVLTGRINKEIVSLINELGGQAIGVSGKDGRLLKAEK----
ARGB_PSYWF      DNLLKELGRQSDRIDGMRVTNKSTMDVVEMVLGGSVNKSIVSLINKHGGRAIGLTGKDANLIRAKKLLMS
ARGB_METM7      NRAMEKMGKTPEFIHGLRVTDEETLEIVKMVLIGKINGDIVSKLELYGGKAVGLSGKSGQLIKAKKKIQY
ARGB_CLOB8      SDLLNRLNHKSEFINGLRYTDDITIEVVQMVLGGKVNKNLVSLIEKFGGKAIGLCGMDGSLL---KAKK-
ARGB_THEPX      NKMLERLGIESKFVNGLRVTDEATMEIVEMVLTGRINKEIVSLINELGGQAIGVSGKDGRLLKAEK----
ARGB_RHOFD      EAALKRLGKKGEFIQGMRVTDAETMEIVEWVLGGEVQQDIVGLINQAGGKAVGLTGRDGGMIRAQKLK--
ARGB_PROMP      NRWLNKLEISPKFENGLRVTDEKTMEIVEMVLMGRVNKQIVRGINKTGSLAVGISGLDGNLIQSRE----
ARGB_METM6      NRAMEKMGKTPEFIHGLRVTDEETLEIVKMVLIGKINGDIVSKLERYGGKAVGLSGKSGQLIKAKKKIQY
ARGB_SYNJB      NSWLQKLDIPFKFVDGLRVTDAATMEVVEMVLVGKVNKQIVQLISLAGGSAVGLCGRDGNLIKARSQGRA
ARGB_DESHY      NSMLTRVGKESHFVRGLRVTDKETMEIASMVLVGKLNTEIISLLNRFGGKAVGLSGKDAQLLQAVKKPMK
ARGB_GEOUR      NETLKRYGIVSEFVKGMRVTDAATMGVVEMVLTGQVNKEVVGYINQHGGRAVGLSGKDGGLLLCRKLLQE
ARGB_HELMI      NGMLDRLGLKSHFIQGLRVTDESTMEVVEMVLAGKVNKEIVALIQRFGGKAVGLCGKDGGLIQAKK-RFE
ARGB_METTH      SRAMNKMGKEPKFIEGLRVTDEETMEIVKMVLVGKINTSIVSKICYHGGRAIGLSGKDSNLLLARKAPHV
ARGB_DESHD      NSMLTRVGKESHFVRGLRVTDKETMEIASMVLVGKLNTEIISLLNRFGGRAVGLSGKDAQLLQAVKKPMQ
ARGB_CAMFF      NSFLERLNLKSEFIDGLRVTDKDAMEVVEMTLSGLINKEITSLLNKHGARAIGISGKDDNML---KAKS-
ARGB_SYNJA      NSWLQKLDIPFKFVDGLRVTDAATMEVVEMVLVGKVNKQIVQLISLAGGSAVGLCGRDGNLIRARSQGRA
ARGB_META3      NKAMEKMGKEPEFIHGLRVTDEETLDIVKMVLIGKINGDIVSKLGKYGGKAVGLSGKSGHLISARKKIQY
ARGB_TRIEI      NSWLGKLGIEPQFKDGLRVTDASTMEVVEMVLVGKVNKEIVSLINQAGGCAVGLCGKDASLIQARPXXXX
ARGB_METM5      NRAMEKMGKKPEFIHGLRVTDEETLDIVKMVLIGKINGDIVSKLERYGGKAVGLSGKSGQLIKAKKKIQY
ARGB_SYNY3      NTWLDKVGIEPQFKDGLRVTDAATMDIVEMVLVGRVNKELVNLINQAGGKAVGLCGKDGQLMTARTMTNK
ARGB_METB6      TEKMKALGKESVFVGGLRVTDQETLEIAQMVLVGKINKGIISLIAKCGAKGVGLSGSDGNIILAKKMDLQ
ARGB_CLOPH      SKWVSLLGHESKFVDGLRVTDEVTMEVAEMVL-GKVNKHLVQMVQQLGVKAVGISGKDGATLCCEK----
ARGB_NITSB      TEILNRLKIDTTFIDGQRVTTADVMEIVEMVLSGDINKEIVSLLNNHGAKAIGVSGKDAHFITAR-----
ARGB_PROM9      NNWLKKLEISPKFENGLRITDQKTMDIVEMVLMGRVNKQIVKGVNKTGSLAVGISGLDGNLIQSRE----
ARGB_PROM0      NNWLKKLEISPKFENGLRITDQKTMEIVEMVLMGRVNKQIVKGINKTGSLAVGISGLDGNLIQSRE----
ARGB_CAMHC      NQTLDLLGVKSEFADGLRITDKKSIEIVEMVLSGAVNKQITALLNQNGAKAIGICGKDANLLEAEVLSGG
ARGB_PROM5      NRWLSKLEISPKFEKGLRVTDDKTMEIVEMVLMGRVNKQIVRGINKTGSLAVGISGLDGNLIQSRE----
ARGB_SILST      NALLDKLQIKSEFVNGKRVTDAATMEVVEMVLSGMVNKRIVQAINAQGGKGIGLSGKDANLITCE-----
ARGB_PROMS      NNWLRKLEISPKFENGLRITDQKTMEIVEMVLMGRVNKEIVKGINKTGSLAVGISGLDGNLIQSRE----
ARGB_PROM2      NNWLKKLEISPKFENGLRITDQKTMEIVEMVLMGRVNKQIVKGINKTGSLAVGISGLDGNLIQSRE----
ARGB_PORYE      NFWLDRLKILPKFDDGVRVTDQPTMDIVEMVLVGRVNKDLVATINKQGGKSVGLSGKDGLLITPRPNGKA
ARGB_SULNB      TQLLADLGVDTTFIDGQRVTTKEVMRIVEMVLSGEINKEIVSLLDNHGAKAIGISGKDGG--FLKGMPKD
ARGB_LEPIN      NRLLDNLKIPTEFVHGHRVTDNQTMEIVEMVLTGKVNKQIVSLINSQGGKAVGISGKDGNLAKATKA-PI
ARGB_LEPIC      NRLLDNLKIPTEFVHGHRVTDNQTMEIVEMVLTGKVNKQIVSLINSQGGKAVGISGKDGNLAKATKA-PI
ARGB_CAMC5      NSYLDRLHIKSEFVDGLRVTDKEAMEIVEMVLSGNINKEITALLNKNGARAIGVSGKDANLLKA------
ARGB_AZOVD      XDLLKRLSIESRFVDGMRVTDAQTMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAGLIRAKKLKVT
ARGB_SULDN      NEMLDALKIESKFIEGQRVTSKEVMRIVEMVLSGEINKEIVSLLNSHGAKAIGISGKDAHFISA-KAK--
ARGB_METPE      TDKMKAMGKEPKFVGGLRITDQETLEIAQMVLVGKINDGIVSLIAKCGARGVGISGNDGSLLIAKRKELQ
ARGB_GLOVI      NSWLERLNIPVQFVGGLRVTDKITMEVVEMVLAGKVNKSIVQMINQAGGSAVGLCGRDGSIIEARPHQSA
ARGB_MICAN      NSWLDKLGIEPQFKDGLRVTDADTMDVVEMVLVGRVNKEIVALINQAGGKAVGLCGKDGNLITARPVGKE
ARGB_METVS      NRAMEKMGKVPEFIHGLRVTDEETLEIVKMVLIGKINGDIVSKLEQYXXXXXXXXXXXXQLIKARKKIQY
ARGB_METHJ      TEKMKAMGKQPRFVSGLRITDDDTLEVAQMVLVGKINSKIVSLVSRAGGRAVGISGNDANLIIARKMDRQ
ARGB_CYACA      NFWLNKMNVESKFHDGIRITDELTMQVVEMVLAGKINKELVSLLNNKGVKGVGLCGKDGTILTARKAQCG
ARGB_STRCO      SAALDKHGIVSEFKAGLRVTTEDAMDVVRMVLAGQVQRELVGLLNQHGPLAVGLTGEDAHTLTATKHQ--
ARGB_METMP      NRAMEKMGKTPEFIHGLRVTDEETLDIVKMVLIGKINGDIVSKLERYXXXXXXXXXXXXQLIKAKKKIQY
ARGB_LEPBJ      NRLLDSLKIPTEFIHGHRVTDTQTMEVVEMVLTGKVNKQIVSMINSQGGKAVGISGKDGNLAKAVKA-PI
ARGB_THELT      TRLMNQLGIKPLFKNGYRVTDEKTLQIAEMVLE-KINKDIVLKINLHGGRAIGVSGKDDNLLLCEKDIAN
ARGB_SALAI      SSMLDRLGIDSEFRGGLRVTTPEVMDVVRMVLVGQVGRELVGLINTHGPFAVGLSGEDAGL-FTAVRRTA
ARGB_LEPBL      NRLLDSLKIPTEFIHGHRVTDTQTMEVVEMVLTGKVNKQIVSMINSQGGKAVGISGKDGNLAKAVKA-PI
ARGB_ARCFU      SEKMEKFGLKPKFVEGLRVTDKETMEVVEMVLDGKVNSKIVTTFIRNGGKAVGLSGKDGLLIVAXXXXXX
ARGB_STRAW      SAALDRHGIVSEFKAGLRVTTEDAMDVVRMVLAGQVQRELVGLLNQHGPLAVGLTGEDAHTITATKHQ--
ARGB_FRAAA      TAHLARLGVESTFVGGLRVTTPETMDVVRMVLLGQVNRDVVGLVNDHGPFAVGLSGEDANL-FTARRRPA
ARGB_WOLSU      TDLLGKLGIESKFVEGHRITCIDSMKIVEMVLSGDINKEITSFLNHHGVKAVGISGKDSSLLRAEPKDGG
ARGB_NAUPA      TEILTALNVKTEFKDGVRVTTAESIKIAEMVLSGEINKEIVNMLNQHGAKAIGINGKDMSFM---KAKSL
ARGB_HELHP      NEMLDIMGIESEFYNGYRITSAECMRVVEMVLSGEINKELTAFLNFHGAKAVGMSGKDAHLLQA-KAKDN
ARGB_CORJK      NEMLKTVGLEGEFKGGFRVTTPEVMEYVRMVLFGKVGRELVGLINEHGPYAVGASGEDAGLFTASKRMIT
ARGB_PROMA      NHWLTKLEIKSEFRDGLRITDSNTMDIVEMVLIGRVNKQIVNGINKVGASAVGLCGIDGKLIEARPWGDG
ARGB_RHOSK      NELLGKLGIKSEFVRGKRVTDKATVEVVEMVLSGLVNKRIVQAINDQGGRAVGISGKDDDLMVC-----V
ARGB_RHOS4      NELLGKLGIKSEFVRGKRVTDKATVEVVEMVLSGLVNKRIVQAINDQGGRAVGISGKDDDLMVC-----V
ARGB_RHOS1      NELLGKLGIKSEFVRGKRVTDKATVEVVEMVLSGLVNKRIVQAINDQGGRAVGISGKDDDLMVC-----V
ARGB_ROSDO      NAMLDKLDIKSEFVNGKRVTDRATMDVVEMVLSGLVNKRIVQAINGQGGCAVGISGKDARLITCCQT---
ARGB_CORGB      SEMLNRVGLQGEFKGGFRVTTPEVMDIVRMVLFGQVGRDLVGLINSHGPYAVGTSGEDAGLFTAQKRM--
ARGB_COREF      SDMLRRVGLEGEFKGGFRVTTPEVMEIVRMVLFGQVGRDLVGLINSHGPYAVGTSGEDAGLFTAE---KR
ARGB_PORUM      NFWLDQLKILPKFENGVRVTDQPTMDIVEMVLVGRVNKDLVASINKQGGKSVGLSGKDGLLITSRPSDKP
ARGB_PORPU      NFWLDQLKILPKFENGVRVTDQPTMDIVEMVLVGRVNKDLVASINKQGGKSVGLSGKDGLLITSRPSDKP
ARGB_FRASC      TAHLERLGVPSTFVGGLRVTTPQTMDVVRMVLLGQVNRDVVGLVNDHGPFAVGLSGEDANL-FTARRRPA
ARGB_DESDG      GRMLQQLNIPTNFREGLRVTDDATMDVVEMVLVGKVNKQIVNLLNLSGAKAVGLSGKDGQLIRA-RQMEM
ARGB_NOCSJ      STMLDRLGIRSEFRGGLRVTTPEAMDVVRMVLVGQVQRELVGLINEHGPLAVGCSGEDAGLFTAEPA-NT
ARGB_RHOS5      NELLGKLGIKSEFVRGKRVTDKATVEVVEMVLSGLVNKRIVQAINDQGGRAVGISGKDDDLMVC-----V
ARGB_CAMJR      SAMCEKLGVKSEFKNGLRVSDKATTEVASMVL-NHINKNLVHSLQNLGVKAIGLCGKDGALL--ECVKK-
ARGB_THEFY      NAHLERLGVESTFTAGLRVTTPETMEIVRMVLVGQVNREIVGLINEHGPFAVGMSGEDAHLFTAER-KYA
ARGB_HYDS0      TNMLNKLNIQTEFINGIRKTDKESLDVARMVLIGKLNKDIVSMLNKNMHGAIGLSGIDANLLICTKYYQ-
ARGB_SYNR3      NQWLNRLSIEPVFQEGLRVTCPDTMDVVEMVLVGRVNKQIVNGLNRVGGRAVGLSGADGGLVQA----RT
ARGB_RHOSR      NAMLGKLGMTGEFKGGFRVTTPEVMDVVRMVLFGQVGRELVGLINAHGPYAVGISGEDAHLFTA--TKRT
ARGB_NEIM0      NAMLEKVGKKGKFVQGMRVTDKEAMDIVEMVLGGHVNKEIVSMINTYGGHAVGVSGRDDHFI---KAKKL
ARGB_NEIG2      NAMLEKVGKKGEFVQGMRVTDKETMDIVEMVLGGHVNKEIVSMINTYGGHAVGVSGRDDHFI---KAKKL
ARGB_KINRD      STMLDRLQIPSEFRGGLRVTTPEAMDVVRMVLTGQVGRELVGLLNAHGPLAVGLSGEDAGLLRATRR---
ARGB_NEIG1      NAMLEKVGKKGEFVQGMRVTDKETMDIVEMVLGGHVNKEIVSMINTYGGHAVGVSGRDDHFI---KAKKL
ARGB_PELUB      NSKLLEVNIKSNFINGLRVTDKDTINIVEDVLI-EFNKEIVEALNELDCKAKRITSKENNIITVVQENK-
ARGB_CAMJ8      SAMCEKLGVKSEFKNGLRVSDKATTEVASMVL-NHINKNLVHSLQNLGVKAIGLCGKDGALL--ECVKK-
ARGB_CORU7      NMMLDKVGLEGEFRGGFRVTSPEVMEYVRMVLFGKVGRELVGLINEHGPYAVGASGEDAGLFTAEK----
ARGB_NEIMA      NAMLEKVGKKGEFVQGMRVTDKEAMDIVEMVLGGHVNKEIVSMINTYGGHAVGVSGRDDHFI---KAKKL
ARGB_STRGG      SAQLDKQGLVSEFKAGLRVTTPEAMDVVRMVLAGQVQRELVGLLNQHGPLAVGLTGEDAHTITAVQHRPT
ARGB_NEIMB      NAMLEKVGKKGEFVQGMRVTDKEAMDIVEMVLGGHVNKEIVSMINTYGGHAVGVSGRDDHFI---KAKKL
ARGB_PROM1      NQWLEKLGIKPVFLDGLRITDTETMDVVEMVLTGRVNKQIVSGINNHGRLAVGLCGIDGGLIEAR-----
ARGB_NEIMF      NAMLEKVGKKGEFVQGMRVTDKEAMDIVEMVLGGHVNKEIVSMINTYGGHAVGVSGRDDHFI---KAKKL
ARGB_PROMT      NQWLEKLGIKPVFLDGLRITDTETMDVVEMVLTGRVNKQIVSGINNHGRLAVGLCGIDGGLIEAR-----
ARGB_SYMTH      SELARRMGIEPQFVDGLRVTDAATMEIAQMVLVGKTNREIVTHLCAQGVKAVGLSGQDAGLIRAARH---
ARGB_SYNS9      NQWLKRLQIPAEFRDGLRVTDADTMDVVEMVLVGRVNKQIVNGLNQLGARAVGLSGSDGGLVEAR-----
ARGB_PARDP      NDLLGKLGIESRFXXXXXXXXXXXXXXXXXXLSGLVNKRIVQAINDAGGRAVGISGKDDDLM--------
ARGB_CYAME      NEWLKQLNKSPQYWEGIRVTDKVTMEIVEMVLAGKVNKQLVGSINANGGKAIGLCGKDANLIVAKASSKK
ARGB_STRCL      SAELDRYGLVSEFKAGLRVTTDEAMDVVRMVLAGQVQRDVWGCSIVHGPLAVGITGEDAHPISATR-HRP
ARGB_METBF      TEKMGRMGKKAEFFQGLRITDDETMEIAKMVLVGNINTKIVSLIGVCGGKGIGLTGYDGRMILGHKAKKV
ARGB_CORGL      SEMLNRVGLQGEFKGGFRVTTPEVMDIVRMVLFGQVGRDLVGLINSHGPYAVGTSGEDAGLFTAQKRM--
ARGB_RHOBA      TEAMAKAGIEAQFIRGRRVTDEKSLEVVEQVLAGELNVELTEMMERFGGRAVNLSPRTTCVL---KGKK-
ARGB_RENSM      NSMLGKLGIESEFKGGLRVTTPEAMEVVRMVLAGQVGRELVGLINAHGPYAVGLSGEDGALLQAVRT-GT
ARGB_CHLCH      TRTAEKLGLQSRFVQGRRVTDKEMISVIQMTLAGKVNQDIVQLISEHGGKAVGVSGLDADTIKAH-----
ARGB_ARCB4      TELLNKLEIPSSFVDGYRVTCKESMRVVEMVLSGEINKNIASLLNFHG-------AXXXXXXXXXXXXXX
ARGB_SALTO      SVMLDRLGIDSEFRGGLRVTTPEVMDVVRMVLLGQVGRELVGLINAHGPFAMGLSGEDGGL-FTAVRRQA
ARGB_CHLPD      TRTAEKMGLSSRFHHGKRVTDIEMISVVQMTLAGKVNQDIVRLISEHGGKAVGVTGLDADTIKA------
ARGB_CLOAB      SRWLELSGIESRFVDGLRVTDEKVIEIVQMVLSGKINKKLSLQFNIDGVNAVGLSGVDNKLI--EATKKY
ARGB_GRATL      NHWLKQVNIQPKFFNGIRVTDKDTMELVEMVLVGKVNKDLVTLLNRSSNLAVGLSGKDANLVVASS----
ARGB_CAMJD      SAMCEKLGVKSEFKNGLRVSDKATTEVASMVL-NHINKNLVHSLQNLGVKAIGLCGKDGALL--ECVKK-
ARGB_SILPO      NAMLKKLDIQSEFVNGKRVTDVATXXXXXXXXXXXXNKRIVQEINRQGGKAVGLSGKDANLMICDQTNP-
ARGB_PROMM      NQWLERLEIPAQFRDGLRVTDADTMDVVEMVLVGRVNKQIVNGLNQLGAKAVGLSGSDGNLVEAR-----
ARGB_CAMJE      SAMCEKLGVKSEFKNGLRVSDKATIEVASMVL-NHINKNLVHSLQNLGVKAIGLCGKDGALL--ECVKK-
ARGB_BRAHW      TAMLNKIGKESKFINGLRYTDSETAEVVKMVLAGKVNKDLVASLENCGGKCLGICGIDGKMFKVSKYK--
ARGB_GEOSF      NETLKRYGIVSQFVKGMRVTDEATMGVVEMVLTGQVNKEVVGYLNQHGGRAVXXXXXXXXXXXXXXXXQE
ARGB_PELLD      TKTAEKLGITSTFVHGKRVTDKEMISVVQMTLAGKVNQDIVQLISEHGGKAVGVTGLDADTIQAVPCRDA
ARGB_CAMJJ      SAMCEKLGVKSEFKNGLRVSDKATTEVASMVL-NHINKNLVHSLQNLGVKAIGLCGKDGALL--ECVKK-
ARGB_CHLL2      TRTAEKLGLVSQFVHGKRVTDNDMITVVQMTLAGKVNQDIVRLLSEHGGKAVGVTGLDADTIKAV-----
ARGB_METMJ      TAKMQAMGKEPKFVGGLRITDPETLEIAQMVLVGKINDGIVSLIANCGTRAVGISGNDGNLLIARKMDPQ
ARGB_PROM3      NQWLERLEIPAKFRDGLRVTDADTMDVVEMVLVGRVNKQIVNGLNQLGAKAVGLSGSDGSLVEAR-----
ARGB_PELPB      TKTAEKLGITSRFLHGRRVTDKEMISVIQMTLAGKVNQDIVQLISEHGGKAVGVTGLDADTIKAL-----
ARGB_BIFLI      SHMLKALGIKSEFKGGLRVTTPEAMDVVRMVLTGKVSRELVGLINAHGPLAVGLSGEDGGL-FSAMQRRP
ARGB_PROVI      TKTAEKMGIKSTFVHGKRVTDSDMITIVQMTLAGKVNQDIVRLISEHGGKAVGVSGLDADTIQAV-----
ARGB_BIFLO      SHMLKALGIKSEFKGGLRVTTPEAMDVVRMVLTGKVSRELVGLINAHGPLAVGMSGEDGGL-FSAMQRRP
ARGB_UNCMA      DAMVKRMGMTPSFVAGIRVTDDETLEIVRMVLVGNVSPDIVSLIMRHXXXXXXXXXXXXXXXIARKKPME
ARGB_SYNPX      NQWLKRLEIPAEFRDGLRVTDADTMDVVEMVLVGRVNKQIVNGLNQLGTRAVGLSGSDGSLVEAR-----
ARGB_METMA      TEKMERMGKKAEFFQGLRITDDETMEIARMVLVGNINTKIVSLIXXXXXXXXXXXXXXXRMILGHKAKHV
ARGB_METBU      TEKMDRMGKKSEFIGGLRITDDETMEIARMVLVGNINTRIVSLISXXXXXXXXXXXXXXNMILAKKTQKI
ARGB_METAC      TEKMERMGKKAEFFQGLRITDDETMEIARMVLVGNINTKIVSLIXXXXXXXXXXXXXXXRMILGHKVKRV
ARGB_BIFLD      SHMLKALGIKSEFKGGLRVTTPEAMDVVRMVLTGKVSRELVGLINAHGPLAVGLSGEDGGL-FSAMQRRP
ARGB_SYNS3      NTWLKRLDIRSEFRDGLRVTDAETMDVVEMVLVGRVNKQIVNGLNRLGASAVGLSGSDGRLVEARPW---
ARGB_SYNSC      NQWLQRLEIPAEFRDGLRVTDADTMDVVEMVLVGRVNKQIVNGLNQLGTRAVGLSGSDGSLVEAR-----
ARGB_PROAC      NAMLAESATPVEFRNGLRVTSPEVMEVVRMVLVGQVGRQLVNRINAYAPLAAGMSGEDSGLLSARKS-RV
ARGB_ALKMQ      TNMLKVFDKESKFVDGLRVTDQATMEITEMVLLGKVCQEIVTRINQNGVRSIGICGKDGSMI-----KTV
ARGB_LACLS      GELLEKYEQKSQFVKGLRVXXXXXXXXXXXXXXXXVNKSLVQDIIRLGGNAIGVSGIDGKLIEAKPISE-
ARGB_BEUC1      TQMLAKLEITSEFRGGLRVTTPEAMDVVRMVLTGQVQRRLVTMLNARGPLAVGLSGEDAGL-FRAQRRSA
ARGB_MYCTU      TAMLRRLGIEGDFKGGFRVTTPEVLDVARMVLFGQVGRELVNLINAHGPYAVGITGEDAQLFTAVRRSVT
ARGB_MYCTA      TAMLRRLGIEGDFKGGFRVTTPEVLDVARMVLFGQVGRELVNLINAHGPYAVGITGEDAQLFTAVRRSVT
ARGB_MYCBT      TAMLRRLGIEGDFKGGFRVTTPEVLDVARMVLFGQVGRELVNLINAHGPYAVGITGEDAQLFTAVRRSVT
ARGB_MYCBP      TAMLRRLGIEGDFKGGFRVTTPEVLDVARMVLFGQVGRELVNLINAHGPYAVGITGEDAQLFTAVRRSVT
ARGB_MYCBO      TAMLRRLGIEGDFKGGFRVTTPEVLDVARMVLFGQVGRELVNLINAHGPYAVGITGEDAQLFTAVRRSVT
ARGB_MYCS2      SAMLKRLGIEGDFKGGFRVTTPEVLDVARMVLFGQVGRELVNLINAHGPYAVGVTGEDAQLFTAVRRNVT
ARGB_LACLM      GELLEKYEQKSQFVQGLRVXXXXXXXXXXXXXXXXVNKSLVQDIIRLGGNAIGVSGIDGKLIEAKPISE-
ARGB_SYNPW      NHWLKRLDIDPEFREGLRVTDAATMDVVEMVLVGRVNKQIVNGLNRLGARAVGLSGSDGCLVEARAWGDG
ARGB_ACIC1      DAMLRRLGIEPVFAAGLRVTTPETMDVVRMVLVGQVQREVVGLLNAHGPFAVGVSGEDGRLFTAVRRSA-
ARGB_CORDI      SQMLQRLGIEGEFKGGFRVTSPEVLEIVRMVLFGQVGRDLVGLINSHGPYAVGTSGEDAGLF---RAEKR
ARGB_SACEN      TAMLERLGMQGEFRGGLRVTTPETMDVVRMVLFGQVGRELVGLINQHGPHAVGMSGEDAGLFTARRRTAT
ARGB_CHLTE      TKTSAKLGLETTFVHGKRVTDRQTVDVIQMTLAGKVNQDIVQLINKDGGNAVGVSGLDADTILAK-----
ARGB_METTP      SETMKRLGKKAEFVAGLRVTDRETLEIARMVLLGNINAELVXXXXXXXXXXXXXXXXXXMLIVARKKPPM
ARGB_ACTP7      SQGVKLLGKEPQFINGLRVTDQDTINVVLQMLAGKVNKSXXXXXXXXXXXXXXI---DANMLQCEK----
ARGB_NOCFA      SAMLKKLGLHGEFRGGFRVTTPEVMDVVRMVLFGQVGRELVGLINAHGPYAVGISGEDAGL-FTATRRTV
ARGB_GEOTN      GKMLKQLNVRSEFVNGLRKTTKEVLAVVEMVLSGKVNKQLVTMFKQHGLPAVGISGVDGGLLEAE-----
ARGB_LACLA      GELLEKYEQKSQFVQGLRVXXXXXXXXXXXXXXXXVNKSLVQDIIRLGGNAIGVSGIDGKLIEAKPISE-
ARGB_HAEDU      SLGMKLLGKEPQFINGLRVTDQDTIDVVLQMLAGKVNKRLVAXXXXXXXXXXXXXXXXXQC---------
ARGB_BACHD      NGMLAKLEVETTFVDGLRKTTDSVLSVAEMVLCGQTNKKVVRKLQKAGVKSIGLSGSDGELVRVKAIDEA
ARGB_ACTPJ      SQGVKLLGKEPQFINGLRVTDQDTINVVLQMLAGKVNKSXXXXXXXXXXXXXXI---DANMLQCEK----
ARGB_MYCPA      TAMLRRLGIPGDFKGGFRVTTPEVLDVARMVLFGQVGRELVNLINAHGPYAVGITGEDAQLFTAVRRSVT
ARGB_MYCUA      TAMLGKLGIEGDFKGGFRVTTPEVLDVARMVLFGQVGRELVNLINAHGPYAVGVTGEDAQLF-------T
ARGB_ACTP2      SQGVKLLGKEPQFINGLRVTDQDTINVVLQMLAGKVNKSXXXXXXXXXXXXXXI---DANMLQCEK----
ARGB_MYCA1      TAMLRRLGIPGDFKGGFRVTTPEVLDVARMVLFGQVGRELVNLINAHGPYAVGITGEDAQLFTAVRRSVT
ARGB_MYCMM      TAMLGKLGIEGDFKGGFRVTTPEVLDVARMVLFGQVGRELVNLINAHGPYAVGVTGEDAQLF-------T
ARGB_MYCLE      TAMLRRLGIADDFKGGFRVTTPEVLDVARMVLFGQVGRELVNLINAHGPYAVGITGEDAQLFTAGRRSAT
ARGB_DEHSC      SAWSAKLGLETRLVNGERVTDDATLDVVAAILAGLVNKEIVAALLDMGIKAAGISGVDSATITGQI----
ARGB_DEHSB      SAWSAKLGLETRLVNGERVTDDATLDVVAAILAGLVNKEIVAALLDMGIKAAGISGVDSATITGQI----
ARGB_CHLP8      TKTSDKMGLETTFVHGKRVTDLETINVVQMTLAGKVNQDIVQLINEDGGNAVGVSGLDADMIRAV-----
ARGB_UNCTG      NALLEKFAITSRFVNGLRFTDADTLGVVELALSGKVNRVLTTGLIKNGANAVGISGKDGKSVICRQVEY-
ARGB_BACP2      TNMLQKLDVKTEFVDGQRKTTKPVLEVAEMVLSGTVNKYFVSELAKHDISSVGVSGKDGQMLVADFLDQD
ARGB_AKKM8      SKAMAEAGLEARFVNGLRVTTPEAISIVERTLSGTINPGLVQMFRDYGGKGVGIPGTE--IFVGERIHEK
ARGB_GEOSW      GQMLKRLNVPSEFVNGLRKTTKEVLEVAEMVLAGKVNKQLVALLRQHGLPAVGVSGVDACLLQA-----A
ARGB_MYCVP      SAMLKKLGIAGDFKGGFRVTTPEVLDVARMVLFGQVGRELVNLINAYGPYAVGITGEDAHL-FTAVRRTV
ARGB_LEIXX      SAMLDRLGIQSEFRGGYRVTTPEAMEVVRMVLTGQINRDIVAAINKHGPLAAGLSGEDA-ALFQGRKRGA
ARGB_ARTS2      NAMLSRLGIESEFKGGLRVTTPEAMDVVRMVLTGQVGRELVGLINSHGPYAVGMSGEDGGLLRAVRTGTX
ARGB_SOLUE      TRYLTDRGIESRFVGGLRVTSPDTIDAVLKVFAGSVNHELVANLNRAGALAVGLSGIDSFLVEAEQ----
ARGB_MYCSJ      SAMLKRLGIPGDFRGGFRVTTPEVLDVARMVLFGQVGRELVGLINAHGPYAVGITGEDAHLF-------T
ARGB_MYCGI      SAMLKKLGIAGDFKGGFRVTTPEVLEVARMVLFGQVGRELVNLINAYGPYAVGITGEDAHL-FTAVRRTV
ARGB_ACIBL      SRTLKELGIEPKFLNGLRVTDARTRDVALMVLGGLLNKQLAAAIGAVGQPAIGLCGSDLHLCVARK--KP
ARGB_GEOKA      GQMLKKLAVPSEFVNGLRKTTKEVLAVVEMVLSGKVNKQLVAMLRQNGLPAVGVSGVDGGLLEAEP----
ARGB_ARTAT      NSMLSRLGIESEFKGGLRVTTPEAMDVVRMVLTGQVGRELVGLINSHGPYAVGMSGEDGGLLRAVRTGTX
ARGB_BIFA0      SQMLKALGIHSEFKGGLRVTTPEAMDVVRMVLTGKVSRELVGLINAHGPLAVGLSGEDA-ALFSASQRKP
ARGB_CLAMS      SAMLTRLGIDSEFRGGYRVTTPEVLEVVRMVLTGQVSRDVVRGINAHGPLAAAVSGEDAGL-FTGRRRXX
ARGB_ARTCA      NSMLGRLGIESEFKGGLRVTTPEAMDVVRMVLTGQVGRELVGLINSHGPYAVGMSGEDGGLLRAVRTXXX
ARGB_DEHE1      SDWSAKLGLETRLVNGERVTDDPTLDVVAAVLTGLVNKEIVAALLDMGVQAAGISGVDGATITGQM----
ARGB_CLAM3      SAMLTRLGIESEFRGGYRVTTPEVLEVVRMVLTGQVSRDVVRGINAHGPLAAAVSGEDAGL-FTGRRRXX
ARGB_BIFAA      SQMLKALGIKSEFKGGLRVTTPEAMDVVRMVLTGKVSRELVGLINAHGPFAVGLSGEDG-ALFSAMQRKP
ARGB_ACIC5      TRTLKQLGKQSEFIAGLRVTDAETRDAALMVLSGRVNKSLVAALGSLGQAAMGLSGGDG-LIFRARKKRT
ARGB_BACST      GQMLKTLRVPSEFVNGLRKTTKDVLAVVEMVLSGKVNKQLASMLRQHGLPAVGVSGVDGGLLEAEP----
ARGB_METKA      SDVMERMGLEPRFVRGLRVTDRETLQVVMMVLAGLVNKRLVAELRSEGINALGLSGVDGGLLIAEK-RSE
ARGB_MYCSS      SAMLKRLGIPGDFRGGFRVTTPEVLDVARMVLFGQVGRELVGLINAHGPYAVGITGEDAHLF------XX
ARGB_MYCSK      SAMLKRLGIPGDFRGGFRVTTPEVLDVARMVLFGQVGRELVGLINAHGPYAVGITGEDAHLF------XX
ARGB_MYXXD      DTLCDALHLPVEKVAGRRVTSAPVLDAAKMVLAGKLHTDLLADLQAAGVPAVGLSGVDAGLIKARKRPPV
ARGB_OCEIH      NEALSKMNIKTEFVDGLRVTSEEVLSIAEMVMSGTINKRIVSSIQSIGGNALGLSGVDGKLLRAKQMHDG
ARGB_ANADF      SALQKTLGLETRMVAGRRYTDAQTLEVMKYVVAGQLNVDLCGRLLANGVMGVGLHGASGHVVQARRRPPR
ARGB_BACSU      TNMLKRLNIKTEFSGGQRKTTKPVLEVAEMVLSGSVNKFFVAELAKHGLRAAGISGKDGGLLEAD-----
ARGB_BACAM      TNMLKRLNIKTEFSGGQRKTTKPVLEVAEMVLSGSVNKFFVAELAKHGLRAAGISGKDGGLLEAD-----
ARGB_BACA2      SKMLKTLQIETEFVDGQRKTTKPVLETAEMVLSGTINKFFVTELAKNGLKAAGISGKDGGLLQA-----S
ARGB_CLONN      SKWLKKLQINNKFINGLRVTDSTTIEIVEMVLSGKINKQLVSTLSKEGINSIGLSGVDNNLLLCKK-KYT
ARGB_ROSCS      GVLQETLGSAPRFVGGLRYTDATALTAAEMVLCGSVSTRLVAALIVAGADALGISGVDRGLIRVVKQE--
ARGB_SORC5      TRLQERLGIPVRQVAGQRVTDADTLDVMKMVVAGKLNVDLCAALVAAGARPVGLHGASGPALSAVKRPPQ
ARGB_BREBN      NSMLDRVQITPQFVDGLRVTCEDTLRVVEMVLCGSINKALVKRLTQAGAKAWGVSGIDGQTLLATKTPK-
ARGB_BACFR      TKIAAQLGIDSKMVNGRRITDAETLKVVTMVYGGLVNKNIVAGLQARGVNALGLTGADMNVI--RSMKRP
ARGB_BACFN      TKIAAQLGIDSKMVNGRRITDAETLKVVTMVYGGLVNKNIVAGLQARGVNALGLTGADMNVI--RSMKRP
ARGB_CHLAD      SAAVEQAGLPVEFVDGLRVTTPEVMAIMQMVVCGSINKRIVTALVNAGVRALGLSGLDIGLLRCEPYR--
ARGB_BACTN      TKIAAQLGIESKMVNGRRITDAETLKVVTMVYGGLVNKNIVAGLQARGVNALGLTGADMNVI--RSVKRP
ARGB_BACLD      TKMLKKLNIRTEFVNGQRKTTKAVLEVAEMVLSGSINKFFVAELTKHGLPAVGVSGKDGGLLLADYLNEK
ARGB_BACV8      TRLAAQLGIESKMVNGRRITDAETLKVVTMVYGGLVNKNIVAGLQAKGVNAIGLTGADMNVI--RSVKRP
ARGB_BACAH      DAKLKDCNINVEKRDGLRVTPKEVMDVVQMVLCGSTNKKLVMNLQKHNLLAVGCSGCDGNLL--------
ARGB_PARD8      TKLAAQLGIESKMVNGRRITDAETLKVVTMVYGGLVNKNIVAGLQALGVNALGLTGADMNLMRSDKRPVA
ARGB_BACCZ      DAQLKDCNINVEKRDGLRVTPKEVMDVVQMVLCGSTNKKLVMNLQKHNLRAVGCSGCDGNLLQVQPVSE-
ARGB_BACC3      DAKLKDCNINVEKRDGLRVTPKEVMDVVQMVLCGSTNKKLVMNLQKHNLLAVGCSGCDGNLL--------
ARGB_BACSK      NNLLQAMAVESQFVNGLRKXXXXXXXXXXXXXSGQINKQLVRSLYQAGGKAIGLSGSDGHLL-----KTI
ARGB_BACCQ      DAQLKDCNINAEKRDGLRVTPKEVMDVVQMVLCGSTNKKLVMNLQKHNLRAVGCSGCDGNLLQVQPVSE-
ARGB_BACC7      DAQLKDCNINAEKRDGLRVTPKEVMDVVQMVLCGSTNKKLVMNLQKHNLRAVGCSGCDGNLLQVQPVSE-
ARGB_ANADE      TALQKRLGLETRMVAGRRYTDEATLEVMKYVVAGQLNVDLCARLLANGVMPVGLHGASGHAVQATRRPPR
ARGB_BACC0      DAKLKDCNINVEKRDGLRVTPKEVMDVVQMVLCGSTNKKFVMNLQKHNLLAVGCSGCDGKLLQVQPVSE-
ARGB_BACAN      DAKLKDCNINVEKRDGLRVTPKEVMDVVQMVLCGSTNKKFVMNLQKHNLLAVGCSGCDGKLLQVQPVSE-
ARGB_BACAA      DAKLKDCNINVEKRDGLRVTPKEVMDVVQMVLCGSTNKKFVMNLQKHNLLAVGCSGCDGKLLQVQPVSE-
ARGB_BACHK      DAKLKDCNINVEKRDGLRVTPKEVMDVVQMVLCGSTNKKFVMNLQKHNLLAVGCSGCDGKLLQVQPVSE-
ARGB_ANASK      TALQKRLGLETRMVAGRRFTDEATLEVMKYVVAGRLNVDLCGRLLANGVMPVGLHGASGHAIQATRRPPR
ARGB_BACC1      DAKLKDCNINVEKKDGLRVTPKEVMDIVQMVLCGSTNKKLVMNLQKHNLRAVGCSGCDGKLLQVQPVSE-
ARGB_ANAD2      TALQKRLGLETRMVAGRRFTDEATLEVMKYVVAGRLNVDLCGRLLANGVMPVGLHGASGHAIQATRRPPR
ARGB_BACAC      DAKLKDCNINVEKRDGLRVTPKEVMDVVQMVLCGSTNKKFVMNLQKHNLLAVGCSGCDGKLLQVQPVSE-
ARGB_CYTH3      TEISKGLGIEAQMVDGRRITDAETLKIVTMVYGGLINKNIVAKLQSNECNAIGLTGADANIMLSSKRP--
ARGB_BACCR      DAKLKDCNINVEKRDGLRITPKEVMDVVQMVLCGSTNKKLVMNLQKHNLLAVGCSGCDGNLL--------
ARGB_IGNH4      DEWERKMGMEPQFKVSFRYTDEKELEVFVAVLGGLLNKKIVASFASYGRGAVGLTGADGPSVIAERKKKV
ARGB_CHLSY      SAAVERAGLQIEFVDGLRVTSPAVMDIMQMVVCGTINKRIVTALVNAGVKAIGLSGLDLGLLRCEPYRPA
ARGB_CHLAA      SAAVERAGLQIEFVDGLRVTSPAVMDIMQMVVCGTINKRIVTALVNAGVKAIGLSGLDLGLLRCEPYRPA
ARGB_STAAR      NEALSNQQIEPHFVNGLRVTDKATMTITKHTLIADVNTALVAQFNQQQCSAIGLCGLDAQLFEIKRFDQ-
ARGB_BACC4      DAKLKDCNINVEKRDGLRITPKEVMDVVQMVLCGSTNKKLVMNLQKHNLLAVGCSGCDGNLLQVQPVSE-
ARGB_BACC2      DAKLKDCNINVEKRDGLRVTPKEVMDVVQMVLCGSTNKKLVMNLQKHNLLAVGCSGCDGNLLQVQPVSE-
ARGB_BACWK      DAKLKDCNIKVEKRDGLRVTPREVMDIVQMVLCGSTNKKLVMNLQKHNLLAVGCSGCDGNLLQVQPVSK-
ARGB_STAAW      NEALSNQQIEPHFVNGLRVTDKATMTITKHTLIADVNTALVAQFNQHQCSAIGLCGLD-----AQLFEIT
ARGB_STAAT      NEALSNQQIEPHFVNGLRVTDKATMTITKHTLIADVNTALVAQFNQHQCSAIGLCGLD-----AQLFEIT
ARGB_STAAS      NEALSNQQIEPHFVNGLRVTDKATMTITKHTLIADVNTALVAQFNQHQCSAIGLCGLD-----AQLFEIT
ARGB_STAAN      NEALSNQQIEPHFVNGLRVTDKATMTITKHTLIADVNTALVAQFNQHQCSAIGLCGLD-----AQLFEIT
ARGB_STAAM      NEALSNQQIEPHFVNGLRVTDKATMTITKHTLIADVNTALVAQFNQHQCSAIGLCGLD-----AQLFEIT
ARGB_STAAE      NEALSNQQIEPHFVNGLRVTDKATMTITKHTLIADVNTALVAQFNQHQCSAIGLCGLD-----AQLFEIT
ARGB_STAAC      NEALSNQQIEPHFVNGLRVTDKATMTITKHTLIADVNTALVAQFNQHQCSAIGLCGLD-----AQLFEIT
ARGB_STAAB      NEALSNQQIEPHFVNGLRVTDKATMTITKHTLIADVNTALVAQFNQHQCSAIGLCGLDAQLFEIKRFDQ-
ARGB_STAA9      NEALSNQQIEPHFVNGLRVTDKATMTITKHTLIADVNTALVAQFNQHQCSAIGLCGLD-----AQLFEIT
ARGB_STAA8      NEALSNQQIEPHFVNGLRVTDKATMTITKHTLIADVNTALVAQFNQHQCSAIGLCGLD-----AQLFEIT
ARGB_STAA3      NEALSNQQIEPHFVNGLRVTDKATMTITKHTLIADVNTALVAQFNQHQCSAIGLCGLD-----AQLFEIT
ARGB_STAA2      NEALSNQQIEPHFVNGLRVTDKATMTITKHTLIADVNTALVAQFNQHQCSAIGLCGLD-----AQLFEIT
ARGB_STAA1      NEALSNQQIEPHFVNGLRVTDKATMTITKHTLIADVNTALVAQFNQHQCSAIGLCGLD-----AQLFEIT
ARGB_NITMS      TKVCEQLGKEPKFPSGIRYTDKETAEIFTMVMSGRINKTIVQMLQKNGINAIGLSGVDAKVIEADRKKKL
ARGB_LISMF      TKMMKSLAIPVETKNGLRVTNKATLEVTKMVLIGQVQPAITTAFQKRNISVIGLNAGDTGLLEADFLN--
ARGB_LISMC      TKMMKSLAIPVETKNGLRVTNKATLEVTKMVLIGQVQPAITTAFQKRNISVIGLNAGDTGLLEADFLN--
ARGB_ROSS1      GILQETLGSTPRFVGGLRYTDATALTAAEMVLCGSVSTRLVXXXXXXXXXXXXXSGVDRGLIRVVKQE--
ARGB_ACTSZ      DDLMKRLNLPVRKKNGLRVTPSDQIDIIVGALAGIANKTLVAQAAKFKLNPVGLCLGDGELTAAKQ----
ARGB_STAS1      NQALEQQGVDSLFEDGLRVTTDEVMSITSQILIGKVNPQLVSKMNDENIQSIGLNGIDAKLFDVEPLNE-
ARGB_STAES      SNLLTKNNHSTIKIDGMRVTAKNDLPIIYDALINIVGHQLLERLKESNLEFFQFKEKIKELVSAEFLNKN
ARGB_STAEQ      SNLLTKNNHSTIKIDGMRVTAKNDLPIIYDALINIVGHQLLERLKESNLEFFQFKEKIKELVSAEFLNKN
ARGB_LISMH      TKMMEALAIPVETKNGLRITNKAALEVTKMVLIGQVQPAITTAFQKRNISVIGLNAGDTGLLEADRLSDT
ARGB_OPITP      TRAMESSGLKANFVNGMRQTDEATIAVVKKTLDEVVNRDVCDAIXXXXXXXXXXXX-DSVLV----CQKL
ARGB_STRSV      NQLMKERQLPTRKVKGLRVTAKSDLPIIEQALLGQVGRTLTQELNDSDIESLQLVSHLGKTVLAD-----
ARGB_AZOPC      TELARNLDIETQMIDGRRVTTEKILKLAVMVYAGLINKEIVVGLQALGVDALGFTGADSNIICSEKRP--
ARGB_LISMO      TKMMEALAIPVETKNGLRVTNKATLEVTKMVLIGQVQPAITTAFQKRNISVIGLNASDTGLLEADRLSDT
ARGB_PASMU      DELMQRLHLPVQKKNGLRVTPSDHIEIITGALAGIANKTLVAQAAKFHLNPVGLCLADGNLTYA-----T
ARGB_LISIN      TKMMKALDIPVETKKGLRVTNKQALEVTKMVLIGQVQPAITTAFQKRNISVIGLNAGDTGLLEADQINDS
ARGB_SULAC      TELSSKLGIEPKFEGRSRYTTKEELEVFIMVMS-SISRNILSRVSSYRN-SIALTGADGKLVLAERKKKI
ARGB_DEIRA      ERELAARGVASEFIGGLRVTTPEAMDVVEMALC-QLNKQLSQDIGQ----AVGLMGRDDELLRAE-----
ARGB_STRGC      NQLMKERQLPTRKVKGLRVTAKSDLPIIQQALLGQVGRTLTQELNYSDIESLQLVSHLGKTVSADFIDKD
ARGB_CENSY      -----------------RYTDKETAEIFTMVMSGRINKCIVRMLQQHGVNAVGLSGIDGGLIRAERKSRL
ARGB_BACCN      DKILKKLQIPIEKKHGLRVTSQEVMEVVQMVLCGSTNKNLVQNFQRYGLPAIGISGCDGKLLQAKPLNKK
ARGB_COLP3      DEMLAQAGFTTEKKHGLRVTPKEQVGLISGALAGTVNKAIVGTANSMDLAAVGLSLNDGDMISCTLSTQ-
ARGB_LEUCK      SQLMSQLHEPIEKINGIRLTTQTGINITKMALLGQVQPALIEACRQQGIATIGLNAGSNQLLTGH-----
ARGB_LEUMM      SALMSQLNEPVQKINGIRFTTQNGINITKMALLGQVQPALLESCRVNGLSVIGLNAASDQLLTGH-----
ARGB_LISW6      TKMMEALQIPVETKNGLRITNQQALEVTKMVLIGQVQPTITSAFQKRGISVIGLNAGDTGLLEAERLNDR
ARGB_PSYIN      EDVLKKMNIVSYKKEGLRITPFEQIPYVAGALAGTSNXXXXXXXXXXGLSAVGLSLADG-----FSCKVT
ARGA_RALSO      EEQLALRHVQTQFVDGIRVTDNAALESAKEA-SGELRLDIEATFSQTPMAGARISVVSGNFVTARPV---
ARGB_PYRAR      NEVMKKMGIEPKYPGGLRYTDLETLKAFVMAM-GWINKYIVASLHALGVEALGLTGADLGVVKAKRKERV
ARGB_LACPL      NRLTTQLALPVHKVNGLRVXXXXXXXXXXXXXXGDAQPALLAKLTQHHLPVLGLNAADNQLLTGE-----
ARGB_PYRAE      NELLKRMGIEPKFPGGLRYTDWETLKVFVMAM-GWINKYIVASLHGLGVQALGLTGADLGVVVAKRKERV
ARGB_MANSM      DDLMKRLNLPVQKKNGLRVTPADQIDIIVGALAGIANKTLVAQAAKFKLNPVGLCLADGNLTQA-----T
ARBL_THET2      NKVAEALGHPPRFPGGQRLTDRKTLEIFEMVYCGLVNKRLVELLQKEGANAIGLSGLDGRL-FVGRRKTA
ARGA_SHEON      DAALAANGIEPAYHDGVRITDEDSLKVIKQV-AGALQFDITARLSMSLS-NTPMQGAQINLV----SGNF
ARGB_XANCP      DAELSAAGIEKQTVNGLRVTSPHALAIVRKVFQAS-NLKLVEALQQNGARATSI---TGGVFEAEYLNRD
ARGB_CALMQ      NSVMERMGVKPKHPNGYRYTDEETLKAYVMTMM-LINKLIVSKLNARGIRAIGLSGVDLGLVTAKRKERV
ARGB_MORPR      DELLAKMNIVSEKKNGLRITPFSDIGYITGALAGTANKVLMAQGLKSGAKVVGLSLADGGIATVTQS---
ARGB_SULSO      TDYTKRLGIEPVFEGRSRYTTKEELEVYIMAMS-LINKSITSKLCSLGKNAIGITGVDGGLLLAERKKRI
ARGB_SULIY      TDYTKRLGIEPVFEGRSRYTTKEELEVYIMAMS-LINKTITSKLCSLGKNAIGITGVDGGLLLAERKKRI
ARGB_SULIN      TDYTKRLGIEPVFEGRSRYTTKEELEVYIMAMS-LINKMITSKLCSLGKNAIGITGADGGLLLAERKKRI
ARGB_SULIM      TDYTKRLGIEPVFEGRSRYTTKEELEVYIMAMS-LINKTITSKLCSLGKNAIGITGVDGGLLLAERKKRI
ARGB_SULIL      TDYTKRLGIEPVFEGRSRYTTKEELEVYIMAMS-LINKTITSKLCSLGKNAIGITGVDGGLLLAERKKRI
ARGB_SULIK      TDYTKRLGIEPVFEGRSRYTTKEELEVYIMAMS-LINKTITSKLCSLGKNAIGITGVDGGLLLAERKKRI
ARGB_SULIA      TDYTKRLGIEPVFEGRSRYTTKEELEVYIMAMS-LINKTITSKLCSLGKNAIGITGVDGGLLLAERKKRI
ARGB_PROMH      DSLMKKLQLPVVKKQGLRVTPADQIDIITGALAGSANKTLLSWATRFGLNGVGLCLGDGQL-----AKVT
ARGA_VIBFM      RSLLKQTEHHAPFHKGIRITDEQTLELVKQI-AGQLQLDITASLNNTPMAGAQINVISGNFVIAQPL---
ARGA_VIBF1      RSLLKQTEHHAPFHKGIRITDEQTLELVKQI-AGQLQLDITASLNNTPMAGAQINVISGNFVIAQPL---
ARGB_DEIGD      ERELAARGIASEFSNGLRVTSPQAMAVVEMALA-QLNKQLSQDIGA----AVGLLGRDSELLVAE-----
ARGB_ERWCT      DELMKKLSLPVVKKNGLRVTPADQIDIITGALAGSANKTLLSWAKKHDINAVGLCLGDGD-------STT
ARGB_THENV      NDLLKRMGVEPKFPGGLRYTDLETLKVFVMAMSW-INKSIVASLHALGVEALGLTGADLGVVKARRKEKV
ARGB_MORAB      DDLLAKMNIESEKKNGLRITPASDIGYITGAYVGTANKVLMAQGIKLGFNVVGLTLADGGISTVTLS---
ARGA_SHIFL      DANLAAHHHEPLYHKNIRVTDAKTLELVKQA-AGTLQLDITASLNNTPLQGAHINVVSGNFIIAQPL---
ARGB_PECCP      DDLMKKLSLPVVKKNGLRVTPADQIDIITGALAGSANKTLLSWAKKHDINAVGLCLGDG-------GSTT
ARGB_XANAC      DAELSAAGIEKHTINGLRVTSPEALAIVRKVFQAS-NLKLVEALQQNGARATSI---TGGVFEAEYLDRD
ARGA_SALAR      DANLAAHHHEPIYHKNTRVTDAKTLELVKQA-AGLLQLDITARLSM----SLNNTPLQGAHINVVSGNFT
ARGB_PYRIL      NEML</