[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for atum0:AAK86297.2

[Show Plain Result]


## Summary of Sequence Search
    1::216
    4::217     7e-34  48%  221 aa  AGMR_PSEAE RecName: Full=Glycerol metabolism activator;AltName:
    9::206     7e-22  35%  215 aa  NARP_ECOLI RecName: Full=Nitrate/nitrite response regulator protein
    4::201     2e-19  30%  208 aa  NARP_HAEIN RecName: Full=Nitrate/nitrite response regulator protein
    8::229     5e-19  31%  236 aa  DEGU_BREBE RecName: Full=Transcriptional regulatory protein degU;
    1::222     6e-18  31%  229 aa  DEGU_BACSU RecName: Full=Transcriptional regulatory protein
    1::201     5e-16  29%  210 aa  FIMZ_SALTY RecName: Full=Fimbriae Z protein;
    3::206     6e-15  28%  217 aa  NREC_STACT RecName: Full=Oxygen regulatory protein nreC;AltName:
    3::207     8e-15  25%  218 aa  NREC_STAES RecName: Full=Oxygen regulatory protein nreC;AltName:
    3::207     1e-14  25%  218 aa  NREC_STAEQ RecName: Full=Oxygen regulatory protein nreC;AltName:
    4::218     1e-14  28%  220 aa  YFIK_BACSU RecName: Full=Uncharacterized transcriptional regulatory
    3::206     2e-14  25%  217 aa  NREC_STAAW RecName: Full=Oxygen regulatory protein nreC;AltName:
    3::206     2e-14  25%  217 aa  NREC_STAAT RecName: Full=Oxygen regulatory protein nreC;AltName:
    3::206     2e-14  25%  217 aa  NREC_STAAS RecName: Full=Oxygen regulatory protein nreC;AltName:
    3::206     2e-14  25%  217 aa  NREC_STAAN RecName: Full=Oxygen regulatory protein nreC;AltName:
    3::206     2e-14  25%  217 aa  NREC_STAAM RecName: Full=Oxygen regulatory protein nreC;AltName:
    3::206     2e-14  25%  217 aa  NREC_STAAE RecName: Full=Oxygen regulatory protein nreC;AltName:
    3::206     2e-14  25%  217 aa  NREC_STAAC RecName: Full=Oxygen regulatory protein nreC;AltName:
    3::206     2e-14  25%  217 aa  NREC_STAA9 RecName: Full=Oxygen regulatory protein nreC;AltName:
    3::206     2e-14  25%  217 aa  NREC_STAA8 RecName: Full=Oxygen regulatory protein nreC;AltName:
    3::206     2e-14  25%  217 aa  NREC_STAA3 RecName: Full=Oxygen regulatory protein nreC;AltName:
    3::206     2e-14  25%  217 aa  NREC_STAA2 RecName: Full=Oxygen regulatory protein nreC;AltName:
    3::206     2e-14  25%  217 aa  NREC_STAA1 RecName: Full=Oxygen regulatory protein nreC;AltName:
    4::200     3e-14  30%  213 aa  YDFI_BACSU RecName: Full=Transcriptional regulatory protein ydfI;
    3::206     3e-14  25%  217 aa  NREC_STAAR RecName: Full=Oxygen regulatory protein nreC;AltName:
    3::206     3e-14  25%  217 aa  NREC_STAAB RecName: Full=Oxygen regulatory protein nreC;AltName:
    4::193     5e-14  28%  207 aa  TRPO_PSEAE RecName: Full=Putative transcriptional regulator;
    1::206     5e-14  26%  210 aa  FIMZ_ECOLI RecName: Full=Fimbriae Z protein;
    1::206     5e-14  26%  210 aa  FIMZ_ECO57 RecName: Full=Fimbriae Z protein;
    8::209     9e-14  29%  218 aa  YXJL_BACSU RecName: Full=Uncharacterized transcriptional regulatory
    5::200     1e-13  30%  209 aa  VRAR_STAES RecName: Full=Response regulator protein vraR;
    5::200     1e-13  30%  209 aa  VRAR_STAEQ RecName: Full=Response regulator protein vraR;
   74::219     2e-13  29%  227 aa  NODW_BRAJA RecName: Full=Nodulation protein W;
    3::206     2e-13  24%  217 aa  NREC_STAHJ RecName: Full=Oxygen regulatory protein nreC;AltName:
    3::213     3e-13  28%  214 aa  YHCZ_BACSU RecName: Full=Uncharacterized transcriptional regulatory
    5::209     4e-13  24%  209 aa  BVGA_BORPE RecName: Full=Virulence factors putative positive
    5::209     4e-13  24%  209 aa  BVGA_BORPA RecName: Full=Virulence factors putative positive
    5::209     4e-13  24%  209 aa  BVGA_BORBR RecName: Full=Virulence factors putative positive
    5::200     7e-13  30%  209 aa  VRAR_STAHJ RecName: Full=Response regulator protein vraR;
   59::194     2e-12  30%  211 aa  FIXJ_AZOC5 RecName: Full=Transcriptional regulatory protein fixJ;
   63::200     5e-12  28%  209 aa  VRAR_STAAW RecName: Full=Response regulator protein vraR;
   63::200     5e-12  28%  209 aa  VRAR_STAAS RecName: Full=Response regulator protein vraR;
   63::200     5e-12  28%  209 aa  VRAR_STAAR RecName: Full=Response regulator protein vraR;
   63::200     5e-12  28%  209 aa  VRAR_STAAN RecName: Full=Response regulator protein vraR;
   63::200     5e-12  28%  209 aa  VRAR_STAAM RecName: Full=Response regulator protein vraR;
   63::200     5e-12  28%  209 aa  VRAR_STAAC RecName: Full=Response regulator protein vraR;
   63::200     5e-12  28%  209 aa  VRAR_STAA1 RecName: Full=Response regulator protein vraR;
    9::208     5e-12  25%  216 aa  NARL_SHIFL RecName: Full=Nitrate/nitrite response regulator protein
    9::208     5e-12  25%  216 aa  NARL_ECOLI RecName: Full=Nitrate/nitrite response regulator protein
    9::208     5e-12  25%  216 aa  NARL_ECOL6 RecName: Full=Nitrate/nitrite response regulator protein
    9::208     5e-12  25%  216 aa  NARL_ECO57 RecName: Full=Nitrate/nitrite response regulator protein
   77::196     1e-11  30%  200 aa  YHJB_ECOLI RecName: Full=Putative HTH-type transcriptional
   63::200     1e-11  30%  209 aa  VRAR_STAS1 RecName: Full=Response regulator protein vraR;
    2::184     1e-11  28%  196 aa  UHPA_SALTY RecName: Full=Transcriptional regulatory protein uhpA;
   58::189     1e-11  30%  199 aa  DESR_BACSU RecName: Full=Transcriptional regulatory protein desR;
   56::200     1e-11  30%  210 aa  YCF29_CYAPA RecName: Full=Probable transcriptional regulator ycf29;
    4::202     2e-11  28%  211 aa  LIAR_BACSU RecName: Full=Transcriptional regulatory protein liaR;
    2::184     3e-11  27%  196 aa  UHPA_SHIFL RecName: Full=Transcriptional regulatory protein uhpA;
    2::184     3e-11  27%  196 aa  UHPA_ECOLI RecName: Full=Transcriptional regulatory protein uhpA;
    2::184     3e-11  27%  196 aa  UHPA_ECOL6 RecName: Full=Transcriptional regulatory protein uhpA;
    2::184     3e-11  27%  196 aa  UHPA_ECO57 RecName: Full=Transcriptional regulatory protein uhpA;
    1::211     4e-11  25%  216 aa  RCSB_SALTI RecName: Full=Capsular synthesis regulator component B;
   59::194     4e-11  30%  205 aa  FIXJ_BRAJA RecName: Full=Transcriptional regulatory protein fixJ;
    1::211     5e-11  24%  216 aa  RCSB_SHIFL RecName: Full=Capsular synthesis regulator component B;
    1::211     5e-11  24%  216 aa  RCSB_SALTY RecName: Full=Capsular synthesis regulator component B;
    1::211     5e-11  24%  216 aa  RCSB_ECOLI RecName: Full=Capsular synthesis regulator component B;
    1::211     5e-11  24%  216 aa  RCSB_ECOL6 RecName: Full=Capsular synthesis regulator component B;
    1::211     5e-11  24%  216 aa  RCSB_ECO57 RecName: Full=Capsular synthesis regulator component B;
    4::194     2e-10  20%  218 aa  UVRY_SHIFL RecName: Full=Response regulator uvrY;
    4::194     2e-10  20%  218 aa  UVRY_ECOLI RecName: Full=Response regulator uvrY;
    4::194     6e-10  20%  218 aa  UVRY_ECOL6 RecName: Full=Response regulator uvrY;
    4::194     6e-10  20%  218 aa  UVRY_ECO57 RecName: Full=Response regulator uvrY;
   92::190     2e-09  32%  200 aa  YVFU_BACSU RecName: Full=Uncharacterized transcriptional regulatory
    4::202     4e-09  24%  214 aa  GACA_PSEAE RecName: Full=Response regulator gacA;AltName:
   61::204     1e-08  27%  209 aa  YCF29_PORPU RecName: Full=Probable transcriptional regulator ycf29;
  828::891     1e-08  39%  902 aa  MALT_VIBPA RecName: Full=HTH-type transcriptional regulator
  828::891     1e-08  39%  902 aa  MALT_VIBHB RecName: Full=HTH-type transcriptional regulator
  828::890     1e-08  40%  902 aa  MALT_VIBCH RecName: Full=HTH-type transcriptional regulator
    4::202     1e-08  21%  214 aa  GACA_PSEU2 RecName: Full=Response regulator gacA;AltName:
   75::197     2e-08  25%  222 aa  YCF29_PORYE RecName: Full=Probable transcriptional regulator ycf29;
  828::890     2e-08  41%  902 aa  MALT_VIBVY RecName: Full=HTH-type transcriptional regulator
  828::890     2e-08  41%  902 aa  MALT_VIBVU RecName: Full=HTH-type transcriptional regulator
  828::896     4e-08  42%  903 aa  MALT_YERPY RecName: Full=HTH-type transcriptional regulator
  828::896     4e-08  42%  903 aa  MALT_YERPS RecName: Full=HTH-type transcriptional regulator
  828::896     4e-08  42%  903 aa  MALT_YERPP RecName: Full=HTH-type transcriptional regulator
  828::896     4e-08  42%  903 aa  MALT_YERPE RecName: Full=HTH-type transcriptional regulator
  828::896     4e-08  42%  903 aa  MALT_YERPB RecName: Full=HTH-type transcriptional regulator
  828::896     4e-08  42%  903 aa  MALT_YERPA RecName: Full=HTH-type transcriptional regulator
  828::896     4e-08  42%  903 aa  MALT_YERP3 RecName: Full=HTH-type transcriptional regulator
   58::188     4e-08  28%  204 aa  FIXJ_RHIME RecName: Full=Transcriptional regulatory protein fixJ;
   80::206     5e-08  32%  214 aa  CMPA_BACSU RecName: Full=Transcriptional regulatory protein
  825::887     7e-08  46%  901 aa  MALT_SALTY RecName: Full=HTH-type transcriptional regulator
  825::887     7e-08  46%  901 aa  MALT_SALTI RecName: Full=HTH-type transcriptional regulator
  825::887     7e-08  46%  901 aa  MALT_SALSV RecName: Full=HTH-type transcriptional regulator
  825::887     7e-08  46%  901 aa  MALT_SALPK RecName: Full=HTH-type transcriptional regulator
  825::887     7e-08  46%  901 aa  MALT_SALPB RecName: Full=HTH-type transcriptional regulator
  825::887     7e-08  46%  901 aa  MALT_SALPA RecName: Full=HTH-type transcriptional regulator
  825::887     7e-08  46%  901 aa  MALT_SALNS RecName: Full=HTH-type transcriptional regulator
  825::887     7e-08  46%  901 aa  MALT_SALHS RecName: Full=HTH-type transcriptional regulator
  825::887     7e-08  46%  901 aa  MALT_SALG2 RecName: Full=HTH-type transcriptional regulator
  825::887     7e-08  46%  901 aa  MALT_SALEP RecName: Full=HTH-type transcriptional regulator
  826::888     7e-08  46%  902 aa  MALT_SALDC RecName: Full=HTH-type transcriptional regulator
  825::887     7e-08  46%  901 aa  MALT_SALCH RecName: Full=HTH-type transcriptional regulator
  825::887     7e-08  46%  901 aa  MALT_SALAR RecName: Full=HTH-type transcriptional regulator
  825::887     7e-08  46%  901 aa  MALT_SALA4 RecName: Full=HTH-type transcriptional regulator
  825::887     7e-08  46%  901 aa  MALT_CITK8 RecName: Full=HTH-type transcriptional regulator
  825::887     9e-08  44%  901 aa  MALT_KLEP7 RecName: Full=HTH-type transcriptional regulator
  825::887     9e-08  44%  901 aa  MALT_KLEP3 RecName: Full=HTH-type transcriptional regulator
  828::896     1e-07  42%  903 aa  MALT_YERE8 RecName: Full=HTH-type transcriptional regulator
  825::887     1e-07  44%  901 aa  MALT_ESCF3 RecName: Full=HTH-type transcriptional regulator
  825::887     1e-07  44%  901 aa  MALT_ECOLI RecName: Full=HTH-type transcriptional regulator
  825::887     1e-07  44%  901 aa  MALT_ECOLC RecName: Full=HTH-type transcriptional regulator
  825::887     1e-07  44%  901 aa  MALT_ECOHS RecName: Full=HTH-type transcriptional regulator
  825::887     1e-07  44%  901 aa  MALT_ECODH RecName: Full=HTH-type transcriptional regulator
  825::887     1e-07  44%  901 aa  MALT_ECOBW RecName: Full=HTH-type transcriptional regulator
  828::896     2e-07  42%  904 aa  MALT_SERP5 RecName: Full=HTH-type transcriptional regulator
  825::887     2e-07  44%  901 aa  MALT_ENTS8 RecName: Full=HTH-type transcriptional regulator
  825::887     2e-07  44%  901 aa  MALT_ENT38 RecName: Full=HTH-type transcriptional regulator
   12::69      5e-07  38%   74 aa  GERE_BACSU RecName: Full=Spore germination protein gerE;
  820::877     6e-07  40%  882 aa  Y890_MYCTU RecName: Full=Putative HTH-type transcriptional
  822::875     6e-07  46%  882 aa  ALKS_PSEOL RecName: Full=Regulatory protein alkS;
  820::877     8e-07  40%  882 aa  Y914_MYCBO RecName: Full=Putative HTH-type transcriptional
  162::213     8e-07  40%  227 aa  MOAR_KLEAE RecName: Full=Monoamine regulon transcriptional
  828::883     1e-06  45%  904 aa  MALT_PHOLL RecName: Full=HTH-type transcriptional regulator
   97::199     1e-06  28%  210 aa  YGEK_ECOLI RecName: Full=Putative uncharacterized response
   97::199     1e-06  28%  210 aa  YGEK_ECO57 RecName: Full=Uncharacterized response regulatory
    7::206     2e-06  24%  211 aa  SGAR_HYPME RecName: Full=Probable transcriptional regulatory
  825::878     2e-06  44%  901 aa  MALT_SHIF8 RecName: Full=HTH-type transcriptional regulator
  825::878     2e-06  44%  901 aa  MALT_SHIBS RecName: Full=HTH-type transcriptional regulator
  825::878     2e-06  44%  901 aa  MALT_ECOUT RecName: Full=HTH-type transcriptional regulator
  825::878     2e-06  44%  901 aa  MALT_ECOSM RecName: Full=HTH-type transcriptional regulator
  825::878     2e-06  44%  901 aa  MALT_ECOSE RecName: Full=HTH-type transcriptional regulator
  825::878     2e-06  44%  901 aa  MALT_ECOLU RecName: Full=HTH-type transcriptional regulator
  825::878     2e-06  44%  901 aa  MALT_ECOL6 RecName: Full=HTH-type transcriptional regulator
  825::878     2e-06  44%  901 aa  MALT_ECOL5 RecName: Full=HTH-type transcriptional regulator
  825::878     2e-06  44%  901 aa  MALT_ECOK1 RecName: Full=HTH-type transcriptional regulator
  825::878     2e-06  44%  901 aa  MALT_ECO8A RecName: Full=HTH-type transcriptional regulator
  825::878     2e-06  44%  901 aa  MALT_ECO81 RecName: Full=HTH-type transcriptional regulator
  825::878     2e-06  44%  901 aa  MALT_ECO7I RecName: Full=HTH-type transcriptional regulator
  825::878     2e-06  44%  901 aa  MALT_ECO5E RecName: Full=HTH-type transcriptional regulator
  825::878     2e-06  44%  901 aa  MALT_ECO57 RecName: Full=HTH-type transcriptional regulator
  825::878     2e-06  44%  901 aa  MALT_ECO55 RecName: Full=HTH-type transcriptional regulator
  825::878     2e-06  44%  901 aa  MALT_ECO45 RecName: Full=HTH-type transcriptional regulator
  825::878     2e-06  44%  901 aa  MALT_ECO27 RecName: Full=HTH-type transcriptional regulator
  825::878     2e-06  44%  901 aa  MALT_ECO24 RecName: Full=HTH-type transcriptional regulator
   58::185     2e-06  26%  197 aa  DCTR_RHOCA RecName: Full=C4-dicarboxylate transport transcriptional
    4::190     3e-06  32%  204 aa  EVGA_SHIFL RecName: Full=Positive transcription regulator evgA;
    4::190     3e-06  32%  204 aa  EVGA_ECOLI RecName: Full=Positive transcription regulator evgA;
    4::190     3e-06  32%  204 aa  EVGA_ECOL6 RecName: Full=Positive transcription regulator evgA;
    4::190     3e-06  32%  204 aa  EVGA_ECO57 RecName: Full=Positive transcription regulator evgA;
    2::119     5e-06  25%  124 aa  SP0F_BACSU RecName: Full=Sporulation initiation phosphotransferase
   15::200     9e-06  25%  223 aa  MOXX_PARDE RecName: Full=Methanol utilization control regulatory
  825::878     9e-06  43%  901 aa  MALT_SHISS RecName: Full=HTH-type transcriptional regulator
    4::104     9e-06  23%  235 aa  MALR_BACSU RecName: Full=Transcriptional regulatory protein
  156::207     9e-06  40%  216 aa  CSGD_SALTY RecName: Full=Probable csgAB operon transcriptional
  156::207     9e-06  40%  216 aa  CSGD_ECOLI RecName: Full=Probable csgAB operon transcriptional
   58::119     2e-05  31%  228 aa  YKOG_BACSU RecName: Full=Uncharacterized transcriptional regulatory
    1::110     2e-05  25%  469 aa  NTRC_SALTY RecName: Full=Nitrogen regulation protein NR(I);
   14::202     2e-05  20%  214 aa  GACA_PSEVI RecName: Full=Response regulator gacA;AltName:
   14::125     2e-05  22%  213 aa  GACA_PSEFL RecName: Full=Response regulator gacA;AltName:
  176::233     3e-05  36%  236 aa  SOLR1_RALSO RecName: Full=Transcriptional activator protein solR;
  176::229     4e-05  37%  236 aa  SOLR2_RALSO RecName: Full=Transcriptional activator protein solR;
  169::227     6e-05  29%  244 aa  CARR_PECCC RecName: Full=Transcriptional activator protein carR;
   99::172     6e-05  31%  259 aa  ARR4_ARATH RecName: Full=Two-component response regulator
   56::116     7e-05  38%  227 aa  REGX3_MYCTU RecName: Full=Sensory transduction protein regX3;
   56::116     7e-05  38%  228 aa  REGX3_MYCS2 RecName: Full=Sensory transduction protein regX3;
   56::116     7e-05  38%  227 aa  REGX3_MYCBO RecName: Full=Sensory transduction protein regX3;
  153::202     9e-05  32%  208 aa  YCF29_GUITH RecName: Full=Probable transcriptional regulator ycf29;
    4::116     9e-05  27%  231 aa  BCER_BACHD RecName: Full=Sensory transduction protein bceR;
    1::118     1e-04  29%  240 aa  YCF27_PORAE RecName: Full=Probable transcriptional regulator
    7::108     1e-04  31%  350 aa  CHEB1_DECAR RecName: Full=Chemotaxis response regulator
    8::110     2e-04  26%  469 aa  NTRC_KLEPN RecName: Full=Nitrogen assimilation regulatory protein;
   98::174     2e-04  31%  231 aa  ARR3_ARATH RecName: Full=Two-component response regulator ARR3;
    5::115     2e-04  26%  122 aa  SP0F_BACTK RecName: Full=Sporulation initiation phosphotransferase
   27::87      2e-04  36%  198 aa  REGX3_MYCLE RecName: Full=Sensory transduction protein regX3;
    1::110     2e-04  25%  469 aa  NTRC_ECOLI RecName: Full=Nitrogen regulation protein NR(I);
    1::110     2e-04  25%  469 aa  NTRC_ECO57 RecName: Full=Nitrogen regulation protein NR(I);
   60::128     2e-04  38%  360 aa  CHEB2_GEOMG RecName: Full=Chemotaxis response regulator
  824::941     3e-04  24%  948 aa  RCSC_SALTI RecName: Full=Sensor protein rcsC;       
    1::111     3e-04  28%  372 aa  CHEB_TREDE RecName: Full=Chemotaxis response regulator
    1::154     3e-04  22%  371 aa  CHEB3_GEOSL RecName: Full=Chemotaxis response regulator
   80::233     4e-04  23%  251 aa  Y851_SYNP2 RecName: Full=Probable transcriptional regulatory
   87::177     4e-04  31%  257 aa  SPHR_SYNE7 RecName: Full=Alkaline phosphatase synthesis
  824::941     4e-04  24%  948 aa  RCSC_SALTY RecName: Full=Sensor protein rcsC;       
  824::941     4e-04  24%  949 aa  RCSC_ECOLI RecName: Full=Sensor kinase protein rcsC;       
   72::168     4e-04  32%  592 aa  ARR21_ARATH RecName: Full=Putative two-component response regulator
    2::106     5e-04  28%  356 aa  CHEB_THIDA RecName: Full=Chemotaxis response regulator
   63::115     6e-04  30%  219 aa  RSSB_SERMA RecName: Full=Swarming motility regulation protein rssB;
   59::120     6e-04  32%  239 aa  OMPR_SHIFL RecName: Full=Transcriptional regulatory protein ompR;
   59::120     6e-04  32%  239 aa  OMPR_SALTY RecName: Full=Transcriptional regulatory protein ompR;
   59::120     6e-04  32%  239 aa  OMPR_SALTI RecName: Full=Transcriptional regulatory protein ompR;
   59::120     6e-04  32%  239 aa  OMPR_ECOLI RecName: Full=Transcriptional regulatory protein ompR;
   59::120     6e-04  32%  239 aa  OMPR_ECOL6 RecName: Full=Transcriptional regulatory protein ompR;
   59::120     6e-04  32%  239 aa  OMPR_ECO57 RecName: Full=Transcriptional regulatory protein ompR;
   97::149     6e-04  36%  175 aa  BGLJ_ECOLI RecName: Full=Transcriptional activator protein bglJ;
   62::122     8e-04  31%  255 aa  YCF27_GALSU RecName: Full=Probable transcriptional regulator
    1::147     8e-04  22%  240 aa  PHOP_BACSU RecName: Full=Alkaline phosphatase synthesis
    1::216

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSELVIIIADDHPLFRGALKQAVAGLDGQQTIIEAGDFEAARHAATTRNXXXXXXXXXXXPGVSGFSGLM
AGMR_PSEAE      -----ILIADDHPLFREAIHNVIAGFPGSE-VMETADLDSALGLTQEHXXXXXXXXXXNMPGMHGLNGLM
NARP_ECOLI      -----VMIVDDHPLMRRGVRQLLELDPGSEVVAEAGDGASAIDLAN-RLDIDVILLDLNMKGMSGLDTLN
NARP_HAEIN      --KLKVLLIDDHPLMRRGIKQLVELDDNFEVVADVSSGTEGISVAL-QTSPDVIILDLNMKGLSGLDTLK
DEGU_BREBE      -NKIQIVIIDDHQLFREGVKRILAMEPEFEVVADGEDGENAVELVEKYNPDVILMDINM-PKVNGVEATR
DEGU_BACSU      MTKVNIVIIDDHQLFREGVKRILDFEPTFEVVAEGDDGEAAR--IVEHYHPDVVIMDINMPNVNGVEATK
FIMZ_SALTY      MKPASVIIMDEHPIVRMSIEVLLGKNSNIQVVLKTDDSRTAIEYLRTY-PVDLVILDIELPGTDGFTLLK
NREC_STACT      -----IVIADDHAVVRTGFSMILNFQDDMEVVDTAADGVEAYQKVMQHQPDVLIMDLSMPPGESGLIATS
NREC_STAES      -----IVIADDHAVVRTGFSMILNYQEDMEVVATAADGVEAYQKVLEHRPDVLILDLSMPPGESGLIATS
NREC_STAEQ      -----IVIADDHAVVRTGFSMILNYQEDMEVVATAADGVEAYQKVLEHRPDVLILDLSMPPGESGLIATS
YFIK_BACSU      -----IIITDDQDIVREGLASLLQLREELDVIATARNGQEAFEKAKELEPDIVLMDIRM-PVSNGVEGTK
NREC_STAAW      -----IVIADDHAVVRTGFSMILNYQNDMEVVATAADGVEAYQKVMEYKPDVLLMDLSMPPGESGLIATS
NREC_STAAT      -----IVIADDHAVVRTGFSMILNYQNDMEVVATAADGVEAYQKVMEYKPDVLLMDLSMPPGESGLIATS
NREC_STAAS      -----IVIADDHAVVRTGFSMILNYQNDMEVVATAADGVEAYQKVMEYKPDVLLMDLSMPPGESGLIATS
NREC_STAAN      -----IVIADDHAVVRTGFSMILNYQNDMEVVATAADGVEAYQKVMEYKPDVLLMDLSMPPGESGLIATS
NREC_STAAM      -----IVIADDHAVVRTGFSMILNYQNDMEVVATAADGVEAYQKVMEYKPDVLLMDLSMPPGESGLIATS
NREC_STAAE      -----IVIADDHAVVRTGFSMILNYQNDMEVVATAADGVEAYQKVMEYKPDVLLMDLSMPPGESGLIATS
NREC_STAAC      -----IVIADDHAVVRTGFSMILNYQNDMEVVATAADGVEAYQKVMEYKPDVLLMDLSMPPGESGLIATS
NREC_STAA9      -----IVIADDHAVVRTGFSMILNYQNDMEVVATAADGVEAYQKVMEYKPDVLLMDLSMPPGESGLIATS
NREC_STAA8      -----IVIADDHAVVRTGFSMILNYQNDMEVVATAADGVEAYQKVMEYKPDVLLMDLSMPPGESGLIATS
NREC_STAA3      -----IVIADDHAVVRTGFSMILNYQNDMEVVATAADGVEAYQKVMEYKPDVLLMDLSMPPGESGLIATS
NREC_STAA2      -----IVIADDHAVVRTGFSMILNYQNDMEVVATAADGVEAYQKVMEYKPDVLLMDLSMPPGESGLIATS
NREC_STAA1      -----IVIADDHAVVRTGFSMILNYQNDMEVVATAADGVEAYQKVMEYKPDVLLMDLSMPPGESGLIATS
YDFI_BACSU      -----VLIVDDHLVVREGLKLLIETNDQYTIIGEAENGKVAVRLADELEPDIILMDLYM-PEMSGLEAIK
NREC_STAAR      -----IVIADDHAVVRTGFSMILNYQNDMEVVATAADGVEAYQKVMEYKPDVLLMDLSMPPGESGLIATS
NREC_STAAB      -----IVIADDHAVVRTGFSMILNYQNDMEVVATAADGVEAYQKVMEYKPDVLLMDLSMPPGESGLIATS
TRPO_PSEAE      -----VLIVDDHPAIRLAVR-LLFERDGFTIVGEADNGAEALQVARKKSPDLAILDIGI-PKIDGLEVIA
FIMZ_ECOLI      MKPTSVIIMDTHPIIRMSIEVLLQKNSELQIVLKTDDYRITIDYLRTR-PVDLIIMDIDLPGTDGFTFLK
FIMZ_ECO57      MKPTSVIIMDTHPIIRMSIEVLLQKNSELQIVLKTDDYRITIDYLRTR-PVDLIIMDIDLPGTDGFTFLK
YXJL_BACSU      -----VALADDQPLVREGFRYVINAQTDMTVSGEAGDGHDII-ALAKQTKPDVILMDVQMPRCSGIEAAK
VRAR_STAES      -----VLFVDDHEMVRIGISSY---LSTQEDIEVVGEGASGKDAITKAHELKPXXXXXXXXXXXGVEATT
VRAR_STAEQ      -----VLFVDDHEMVRIGISSY---LSTQEDIEVVGEGASGKDAITKAHELKPXXXXXXXXXXXGVEATT
NODW_BRAJA      ------------------------------------------------------------PGLSGLDYQT
NREC_STAHJ      -----IVIADDHAVVRTGFSMILNFQEDMEVVATAADGGEAYQKVMEHKPDVLIMDLSMPPGESGLIATS
YHCZ_BACSU      -----IVIADDHHVVRKGLRFFFATQDDIEVVGEAATLEALRVIEETK--PDLVLMDLSMPEMDGIQAIK
BVGA_BORPE      -----VLIIDDHPVLRFAVR-VLMEKEGFEVIGETDNGIDGLKIAREK-IPNLVVLDIGIPKLDGLEVIA
BVGA_BORPA      -----VLIIDDHPVLRFAVR-VLMEKEGFEVIGETDNGIDGLKIAREK-IPNLVVLDIGIPKLDGLEVIA
BVGA_BORBR      -----VLIIDDHPVLRFAVR-VLMEKEGFEVIGETDNGIDGLKIAREK-IPNLVVLDIGIPKLDGLEVIA
VRAR_STAHJ      -----VLFVDDHEMVRIGISSY---LSTQSDIEIVGEGESGKDAIAKAHELKPXXXXXXXXXXXGVEATT
FIXJ_AZOC5      ------------------------------------------------------------PGISGLELLK
VRAR_STAAW      ----------------------------------------------------------------GVEATT
VRAR_STAAS      ----------------------------------------------------------------GVEATT
VRAR_STAAR      ----------------------------------------------------------------GVEATT
VRAR_STAAN      ----------------------------------------------------------------GVEATT
VRAR_STAAM      ----------------------------------------------------------------GVEATT
VRAR_STAAC      ----------------------------------------------------------------GVEATT
VRAR_STAA1      ----------------------------------------------------------------GVEATT
NARL_SHIFL      -----ILLIDDHPMLRTGVKQLISMAPDITVVGEASNGEQGIELAESLDPDLILLDLNM-PGMNGLETLD
NARL_ECOLI      -----ILLIDDHPMLRTGVKQLISMAPDITVVGEASNGEQGIELAESLDPDLILLDLNM-PGMNGLETLD
NARL_ECOL6      -----ILLIDDHPMLRTGVKQLISMAPDITVVGEASNGEQGIELAESLDPDLILLDLNM-PGMNGLETLD
NARL_ECO57      -----ILLIDDHPMLRTGVKQLISMAPDITVVGEASNGEQGIELAESLDPDLILLDLNM-PGMNGLETLD
YHJB_ECOLI      ----------------------------------------------------------------------
VRAR_STAS1      ----------------------------------------------------------------GVEATE
UHPA_SALTY      ---ITVALIDDHLIVRSGFAQLLGLEPDLQVVAEFGSGREALAGLPGRGVQVCICDISM-PDISGLELLS
DESR_BACSU      ------------------------------------------------------------PGKTGLEAAE
YCF29_CYAPA     ------------------------------------------------------------PGMGGFNFLH
LIAR_BACSU      -----VLLIDDHEMVRMGLAAFLEAQPDIEVIGEASDGSEGVRLAVELSPDVILMDLVME-GMDGIEATK
UHPA_SHIFL      ---ITVALIDDHLIVRSGFAQLLGLEPDLQVVAEFGSGREALAGLPGRGVQVCICDISM-PDISGLELLS
UHPA_ECOLI      ---ITVALIDDHLIVRSGFAQLLGLEPDLQVVAEFGSGREALAGLPGRGVQVCICDISM-PDISGLELLS
UHPA_ECOL6      ---ITVALIDDHLIVRSGFAQLLGLEPDLQVVAEFGSGREALAGLPGRGVQVCICDISM-PDISGLELLS
UHPA_ECO57      ---ITVALIDDHLIVRSGFAQLLGLEPDLQVVAEFGSGREALAGLPGRGVQVCICDISM-PDISGLELLS
RCSB_SALTI      MNNMNIIIADDHPIVLFGIRKSLEQIEWVNVV---GEFEDSTALINNKLDAHVLITDLSMPGDKGITLIK
FIXJ_BRAJA      ------------------------------------------------------------PGLDGIELLK
RCSB_SHIFL      MNNMNVIIADDHPIVLFGIRKSLEQIEWVNVV---GEFEDSTALINNKLDAHVLITDLSMPGDKGITLIK
RCSB_SALTY      MNNMNVIIADDHPIVLFGIRKSLEQIEWVNVV---GEFEDSTALINNKLDAHVLITDLSMPGDKGITLIK
RCSB_ECOLI      MNNMNVIIADDHPIVLFGIRKSLEQIEWVNVV---GEFEDSTALINNKLDAHVLITDLSMPGDKGITLIK
RCSB_ECOL6      MNNMNVIIADDHPIVLFGIRKSLEQIEWVNVV---GEFEDSTALINNKLDAHVLITDLSMPGDKGITLIK
RCSB_ECO57      MNNMNVIIADDHPIVLFGIRKSLEQIEWVNVV---GEFEDSTALINNKLDAHVLITDLSMPGDKGITLIK
UVRY_SHIFL      -----VLLVDDHELVRAGIRRILEDIKGIKVVGEASCGEDAVKWCRT-NAVDVVLMDMSMPGIGGLEATR
UVRY_ECOLI      -----VLLVDDHELVRAGIRRILEDIKGIKVVGEASCGEDAVKWCRT-NAVDVVLMDMSMPGIGGLEATR
UVRY_ECOL6      -----VLLVDDHELVRAGIRRILEDIKGIKVVGEASCGEDAVKWCRA-NAVDVVLMDMSMPGIGGLEATR
UVRY_ECO57      -----VLLVDDHELVRAGIRRILEDIKGIKVVGEASCGEDAVKWCRA-NAVDVVLMDMSMPGIGGLEATR
YVFU_BACSU      ----------------------------------------------------------------------
GACA_PSEAE      -----VLVVDDHDLVRTGITRMLADIEGLQVVGQADCGEDCLKLARELKPDVVLMDVKM-PGIGGLEATR
YCF29_PORPU     ----------------------------------------------------------------GYELLE
MALT_VIBPA      ----------------------------------------------------------------------
MALT_VIBHB      ----------------------------------------------------------------------
MALT_VIBCH      ----------------------------------------------------------------------
GACA_PSEU2      -----VLVVDDHDLVRTGITRMLADIDGLQVVGQADSGEESLKKARELKPDVVLMDVKM-PGIGGLEATR
YCF29_PORYE     ----------------------------------------------------------------------
MALT_VIBVY      ----------------------------------------------------------------------
MALT_VIBVU      ----------------------------------------------------------------------
MALT_YERPY      ----------------------------------------------------------------------
MALT_YERPS      ----------------------------------------------------------------------
MALT_YERPP      ----------------------------------------------------------------------
MALT_YERPE      ----------------------------------------------------------------------
MALT_YERPB      ----------------------------------------------------------------------
MALT_YERPA      ----------------------------------------------------------------------
MALT_YERP3      ----------------------------------------------------------------------
FIXJ_RHIME      ------------------------------------------------------------PDMSGVELLR
CMPA_BACSU      ----------------------------------------------------------------------
MALT_SALTY      ----------------------------------------------------------------------
MALT_SALTI      ----------------------------------------------------------------------
MALT_SALSV      ----------------------------------------------------------------------
MALT_SALPK      ----------------------------------------------------------------------
MALT_SALPB      ----------------------------------------------------------------------
MALT_SALPA      ----------------------------------------------------------------------
MALT_SALNS      ----------------------------------------------------------------------
MALT_SALHS      ----------------------------------------------------------------------
MALT_SALG2      ----------------------------------------------------------------------
MALT_SALEP      ----------------------------------------------------------------------
MALT_SALDC      ----------------------------------------------------------------------
MALT_SALCH      ----------------------------------------------------------------------
MALT_SALAR      ----------------------------------------------------------------------
MALT_SALA4      ----------------------------------------------------------------------
MALT_CITK8      ----------------------------------------------------------------------
MALT_KLEP7      ----------------------------------------------------------------------
MALT_KLEP3      ----------------------------------------------------------------------
MALT_YERE8      ----------------------------------------------------------------------
MALT_ESCF3      ----------------------------------------------------------------------
MALT_ECOLI      ----------------------------------------------------------------------
MALT_ECOLC      ----------------------------------------------------------------------
MALT_ECOHS      ----------------------------------------------------------------------
MALT_ECODH      ----------------------------------------------------------------------
MALT_ECOBW      ----------------------------------------------------------------------
MALT_SERP5      ----------------------------------------------------------------------
MALT_ENTS8      ----------------------------------------------------------------------
MALT_ENT38      ----------------------------------------------------------------------
GERE_BACSU      ----------------------------------------------------------------------
Y890_MYCTU      ----------------------------------------------------------------------
ALKS_PSEOL      ----------------------------------------------------------------------
Y914_MYCBO      ----------------------------------------------------------------------
MOAR_KLEAE      ----------------------------------------------------------------------
MALT_PHOLL      ----------------------------------------------------------------------
YGEK_ECOLI      ----------------------------------------------------------------------
YGEK_ECO57      ----------------------------------------------------------------------
SGAR_HYPME      -SKIEVSIVDQNPVVRTGLETLLVR-DGRFSV--SGIYASGEDAALQTKPVEIVIVGWSLPDMTGGDVLT
MALT_SHIF8      ----------------------------------------------------------------------
MALT_SHIBS      ----------------------------------------------------------------------
MALT_ECOUT      ----------------------------------------------------------------------
MALT_ECOSM      ----------------------------------------------------------------------
MALT_ECOSE      ----------------------------------------------------------------------
MALT_ECOLU      ----------------------------------------------------------------------
MALT_ECOL6      ----------------------------------------------------------------------
MALT_ECOL5      ----------------------------------------------------------------------
MALT_ECOK1      ----------------------------------------------------------------------
MALT_ECO8A      ----------------------------------------------------------------------
MALT_ECO81      ----------------------------------------------------------------------
MALT_ECO7I      ----------------------------------------------------------------------
MALT_ECO5E      ----------------------------------------------------------------------
MALT_ECO57      ----------------------------------------------------------------------
MALT_ECO55      ----------------------------------------------------------------------
MALT_ECO45      ----------------------------------------------------------------------
MALT_ECO27      ----------------------------------------------------------------------
MALT_ECO24      ----------------------------------------------------------------------
DCTR_RHOCA      -------------------------------------------------------------GMSGPQLLD
EVGA_SHIFL      ------IIIDDHPLAIAAIRNLLIKNDIEAELTEGGS--AVQRVETLKXXXXXXXXXXXXXXXXQV--LE
EVGA_ECOLI      ------IIIDDHPLAIAAIRNLLIKNDIEAELTEGGS--AVQRVETLKXXXXXXXXXXXXXXXXQV--LE
EVGA_ECOL6      ------IIIDDHPLAIAAIRNLLIKNDIEAELTEGGS--AVQRVETLKXXXXXXXXXXXXXXXXQV--LE
EVGA_ECO57      ------IIIDDHPLAIAAIRNLLIKNDIEAELTEGGS--AVQRVETLKXXXXXXXXXXXXXXXXQV--LE
SP0F_BACSU      MNEKILIVDDQYGI--RILLNEVFNKEGYQTFQAANGLQALD--IVTKERPDLVLLDMKIPGMDGIEILK
MOXX_PARDE      ---LQILIVDDHPVVAEGWGRIIRTKTACEIASAPSASEGWRAWRQARPDLMVVDLSIGRNKIAGIRLIE
MALT_SHISS      ----------------------------------------------------------------------
MALR_BACSU      -----VLIVEDDPMVGELNKRYLSQIDGFQLKGIASSFQSALHILGEHHIDLILLDIYM-PGKNGLELLT
CSGD_SALTY      ----------------------------------------------------------------------
CSGD_ECOLI      ----------------------------------------------------------------------
YKOG_BACSU      ------------------------------------------------------------PGLSGLEVLR
NTRC_SALTY      MQRGIVWVVDDDSSIRWVLERALAGAGLTCTTFENGNEVLAALASKTPDVLLSDIRM---PGMDGLALLK
GACA_PSEVI      ---------------RTGITRMLADIDGLQVVGQADSGEESLKKARELKPDVVLMDVKM-PGIGGLEATR
GACA_PSEFL      ---------------RTGITRMLADIDGLQVVGQAESGEESLLKARELKPYVVLMDVKM-PGIGGLEATR
SOLR1_RALSO     ----------------------------------------------------------------------
SOLR2_RALSO     ----------------------------------------------------------------------
CARR_PECCC      ----------------------------------------------------------------------
ARR4_ARATH      ------------------------------------------------------------PGMTGYELLK
REGX3_MYCTU     ------------------------------------------------------------PGMSGTDVCK
REGX3_MYCS2     ------------------------------------------------------------PGMSGTDVCK
REGX3_MYCBO     ------------------------------------------------------------PGMSGTDVCK
YCF29_GUITH     ----------------------------------------------------------------------
BCER_BACHD      ----IMLIEDDHTLF-SEIKERLS--QWSYDVFGVSNFEKVIEEFTSLKPDLVIIDIQL-PKFDGFHWCR
YCF27_PORAE     MQKEKILVIDDEASIRRILETSIIGYD----VISAADGEEAL-SIFKREHPNLVVLDLMMPKLDGYGVCQ
CHEB1_DECAR     -----VLVVDDSALMRGLLSQMINLAPDMEVVGAAPDAQSAREMIKVLNVLTLDVQMPKMDGLEFLERLM
NTRC_KLEPN      -------IVDDDSSIRWVLERALTGAGLSCTTFESGN--EVLDALTTKTPDVLLSDIRM-PGMDGLALLK
ARR3_ARATH      ------------------------------------------------------------PGMTGYELLK
SP0F_BACTK      -----ILIVDDQYGIRVLLHE-VFQKEGYQTFQAANGFQALD--IVKKDNPDLVVLDMKIPGMDGIEIFK
REGX3_MYCLE     ------------------------------------------------------------PGMSGTDVYK
NTRC_ECOLI      MQRGIVWVVDDDSSIRWVLERALAGAGLTCTTFENGAEVLEALASKTPDVLLSDIRM---PGMDGLALLK
NTRC_ECO57      MQRGIVWVVDDDSSIRWVLERALAGAGLTCTTFENGAEVLEALASKTPDVLLSDIRM---PGMDGLALLK
CHEB2_GEOMG     ------------------------------------------------------------PKMDGFT-LL
RCSC_SALTI      --DMMILVVDDHPINRRLLADQLGSL-GYQCKTANDGVDALN--VLSKNAIDIVLSDVNMPNMDGYRLTQ
CHEB_TREDE      MEDIRVLIVDDSALMRNLIGKIVDATPGLKIADKAMNGRFALQKLE-RVAPDVIVLDLEMPEMNGIEFLR
CHEB3_GEOSL     MRKIRVVVIDDSAYSRRAITKMLESMPEVEVIGYATDGEEGIRKIIDLKPDLVTLDLEM-PRMDGFT-LL
Y851_SYNP2      ------------------------------------------------------------PEVNGLDLCR
SPHR_SYNE7      ------------------------------------------------------------PAVNGLDFCR
RCSC_SALTY      --DMMILVVDDHPINRRLLADQLGSL-GYQCKTANDGVDALN--VLSKNAIDIVLSDVNMPNMDGYRLTQ
RCSC_ECOLI      --DMMILVVDDHPINRRLLADQLGSL-GYQCKTANDGVDALN--VLSKNHIDIVLSDVNMPNMDGYRLTQ
ARR21_ARATH     ------------------------------------------------------------PGMNGLQLKK
CHEB_THIDA      --KIKVLIVDDSALIRGVMREIINSQPDMEVVGVAPDPIAAREKQTNPDVLTLDVEMPKMDGLEFLEKLM
RSSB_SERMA      --------------------------------------------------------------------LI
OMPR_SHIFL      ------------------------------------------------------------PGEDGLSICR
OMPR_SALTY      ------------------------------------------------------------PGEDGLSICR
OMPR_SALTI      ------------------------------------------------------------PGEDGLSICR
OMPR_ECOLI      ------------------------------------------------------------PGEDGLSICR
OMPR_ECOL6      ------------------------------------------------------------PGEDGLSICR
OMPR_ECO57      ------------------------------------------------------------PGEDGLSICR
BGLJ_ECOLI      ----------------------------------------------------------------------
YCF27_GALSU     ------------------------------------------------------------PKIDGYGVCQ
PHOP_BACSU      MNKKILVVDDEESIV--TLLQYNLERSGYDVITASDGEEALKKAETEK--PDLIVLDVMLPKLDGIEVCK


                         .         .         *         .         .         .         .:140
query           ALRAEFSSLPIVIVSATDDATTVRRSIELGASGFISKSSGIDDIRDGIRAVLEGDVWIPSGHQGEKEQDP
AGMR_PSEAE      NLRNEAPTIPVVIVSAEQDKQVVLQAITYGAVGFITKSSPRAQMTEAIEQILNGNVYLPSGHE-EHGISP
NARP_ECOLI      ALRRDGVTAQIIILTVSDASSDVFALIDAGADGYLLKDSDPEVLLEAIRAGAKGSVFSERVNQYLREREM
NARP_HAEIN      GLRAEGVDARILILTVSDAKNDIYTLIDAGADGYLLKDTEPDTLLEQIKRIAQGEVILSDSIKNERTHED
DEGU_BREBE      DLIQRYPDVKVLVLSIHDDESYVTHVLKTGASGYLLKEMDADALIEAVKVVAQGGAYIHPKHNLIKEEDE
DEGU_BACSU      QLVELYPESKVIILSIHDDENYVTHALKTGARGYLLKEMDADTLIEAVKVVAEGGSYLTSGVSAHPQHEV
FIMZ_SALTY      RIKSIQEHTRILFLSSKSEAFYAGRAIRAGANGFVSKRKDLNDIYNAVKMILSGYSFFPS----------
NREC_STACT      KIVESFPDTKILILTMYDDEEYLFHVLRNGAKGYILKNAPDEQLISAVRTVYRGDTYIDTGQDANSTNDP
NREC_STAES      KISESFPETKILILTMFDDEEYLFHMLKSGAKGYILKNSPDEQLILAVRTVYQGETYVDMNEFVNQSQTD
NREC_STAEQ      KISESFPDTKILILTMFDDEEYLFHVLKSGAKGYILKNSPDEQLILAVRTVYQGETYVDMNEFVNQSQTD
YFIK_BACSU      LITSSLPSVKVLMLTTFKDSALIAEALEEGASGYLLKDMSADTIVKAVMTVHSGGMVLPPENEWKREKQL
NREC_STAAW      KIADSFPETKILILTMFDDEEYLFHVLRNGAKGYILKNAPDEQLLLAIRTVYKGETYVDMKNEFVSNSNQ
NREC_STAAT      KIADSFPETKILILTMFDDEEYLFHVLRNGAKGYILKNAPDEQLLLAIRTVYKGETYVDMKNEFVSNSNQ
NREC_STAAS      KIADSFPETKILILTMFDDEEYLFHVLRNGAKGYILKNAPDEQLLLAIRTVYKGETYVDMKNEFVSNSNQ
NREC_STAAN      KIADSFPETKILILTMFDDEEYLFHVLRNGAKGYILKNAPDEQLLLAIRTVYKGETYVDMKNEFVSNSNQ
NREC_STAAM      KIADSFPETKILILTMFDDEEYLFHVLRNGAKGYILKNAPDEQLLLAIRTVYKGETYVDMKNEFVSNSNQ
NREC_STAAE      KIADSFPETKILILTMFDDEEYLFHVLRNGAKGYILKNAPDEQLLLAIRTVYKGETYVDMKNEFVSNSNQ
NREC_STAAC      KIADSFPETKILILTMFDDEEYLFHVLRNGAKGYILKNAPDEQLLLAIRTVYKGETYVDMKNEFVSNSNQ
NREC_STAA9      KIADSFPETKILILTMFDDEEYLFHVLRNGAKGYILKNAPDEQLLLAIRTVYKGETYVDMKNEFVSNSNQ
NREC_STAA8      KIADSFPETKILILTMFDDEEYLFHVLRNGAKGYILKNAPDEQLLLAIRTVYKGETYVDMKNEFVSNSNQ
NREC_STAA3      KIADSFPETKILILTMFDDEEYLFHVLRNGAKGYILKNAPDEQLLLAIRTVYKGETYVDMKNEFVSNSNQ
NREC_STAA2      KIADSFPETKILILTMFDDEEYLFHVLRNGAKGYILKNAPDEQLLLAIRTVYKGETYVDMKNEFVSNSNQ
NREC_STAA1      KIADSFPETKILILTMFDDEEYLFHVLRNGAKGYILKNAPDEQLLLAIRTVYKGETYVDMKNEFVSNSNQ
YDFI_BACSU      QIKEKHDT-PIIILTTYNEDHLMIEGIELGAKGYLLKDTSSETLFHTMDAAIRGNVLL----------QP
NREC_STAAR      KIADSFPETKILILTMFDDEEYLFHVLRNGAKGYILKNAPDEQLLLAIRTVYKGETYVDMKNEFVSNSNQ
NREC_STAAB      KIADSFPETKILILTMFDDEEYLFHVLRNGAKGYILKNAPDEQLLLAIRTVYKGETYVDMKNEFVSNSNQ
TRPO_PSEAE      RLKSLKLDTKVLVLTRQNPAQFAPRCLQAGAMGFVSKRENLSELLLAAKAVLAGYIHFPTGARSINQQSR
FIMZ_ECOLI      RIKQIQSTVKVLFLSSKSECFYAGRAIQAGANGFVSKCNDQNDIFHAVQMILSGYTFFPSETLNYIKSN-
FIMZ_ECO57      RIKQIQSTVKVLFLSSKSECFYAGRAIQAGANGFVSKCNDQNDIFHAVQMILSGYTFFPSETLNYIKSN-
YXJL_BACSU      DIMSALPNTKIVILTTFDTEEYVFEGIRAGAVGYLLKDTLPEELIDAIRAAARGEAIFRTSETFRAKQQT
VRAR_STAES      EIKKDLPQIKVVMLTSFIEDKEVYRALDSGVDSYILKTTSASDIADAVRKTYEGEVFEPEVLVKMRNRMK
VRAR_STAEQ      EIKKDLPQIKVVMLTSFIEDKEVYRALDSGVDSYILKTTSASDIADAVRKTYEGEVFEPEVLVKMRNRMK
NODW_BRAJA      ELARLNIHIPIIFITGHGDIPMTVRAMKGGAVDFLSKPFRDQELLDAVVAATERD-------RKRREAQR
NREC_STAHJ      KISESFPETKILILTMYDDEEYLFHVLRNGAKGYILKNAPDEQLLLAVRTVYKGETYVDMKNEFVNHKHS
YHCZ_BACSU      KAIQQFPDTNIIVLTSYSDQEHVIPALQAGAKAYQLKDTEPEELVK-TRQVHGGEYKLSTAIMPKNQHDP
BVGA_BORPE      RLQSLGLPLRVLVLTGQPPSLFARRCLNSGAAGFVCKHENLHEVINAAKAVMAGYTYFPSTTLSEMRMGD
BVGA_BORPA      RLQSLGLPLRVLVLTGQPPSLFARRCLNSGAAGFVCKHENLHEVINAAKAVMAGYTYFPSTTLSEMRMGD
BVGA_BORBR      RLQSLGLPLRVLVLTGQPPSLFARRCLNSGAAGFVCKHENLHEVINAAKAVMAGYTYFPSTTLSEMRMGD
VRAR_STAHJ      QIKKDLPHIKVVMLTSFIEDKEVYRALDAGVDSYILKTTSASDIADAVRKTFNGEVFEPEVLVKMRNRMK
FIXJ_AZOC5      ELNARGAHMAVIVMTGHGDVPLAVEAMKLGAADFLEKPFDDAAIIAAVRASL--------GRSAEQGRQE
VRAR_STAAW      QIKKDLPQIKVLMLTSFIEDKEVYRALDAGVDSYILKTTSAKDIADAVRKTSRGEVFEPEVLVKMRNRMK
VRAR_STAAS      QIKKDLPQIKVLMLTSFIEDKEVYRALDAGVDSYILKTTSAKDIADAVRKTSRGEVFEPEVLVKMRNRMK
VRAR_STAAR      QIKKDLPQIKVLMLTSFIEDKEVYRALDAGVDSYILKTTSAKDIADAVRKTSRGEVFEPEVLVKMRNRMK
VRAR_STAAN      QIKKDLPQIKVLMLTSFIEDKEVYRALDAGVDSYILKTTSAKDIADAVRKTSRGEVFEPEVLVKMRNRMK
VRAR_STAAM      QIKKDLPQIKVLMLTSFIEDKEVYRALDAGVDSYILKTTSAKDIADAVRKTSRGEVFEPEVLVKMRNRMK
VRAR_STAAC      QIKKDLPQIKVLMLTSFIEDKEVYRALDAGVDSYILKTTSAKDIADAVRKTSRGEVFEPEVLVKMRNRMK
VRAR_STAA1      QIKKDLPQIKVLMLTSFIEDKEVYRALDAGVDSYILKTTSAKDIADAVRKTSRGEVFEPEVLVKMRNRMK
NARL_SHIFL      KLREKSLSGRIVVFSVSNHEEDVVTALKRGADGYLLKDMEPEDLLKALHQAAAGEMVLSEANRATTERD-
NARL_ECOLI      KLREKSLSGRIVVFSVSNHEEDVVTALKRGADGYLLKDMEPEDLLKALHQAAAGEMVLSEANRATTERD-
NARL_ECOL6      KLREKSLSGRIVVFSVSNHEEDVVTALKRGADGYLLKDMEPEDLLKALHQAAAGEMVLSEANRATTERD-
NARL_ECO57      KLREKSLSGRIVVFSVSNHEEDVVTALKRGADGYLLKDMEPEDLLKALHQAAAGEMVLSEANRATTERD-
YHJB_ECOLI      -----------VLITATDNKRWLQEVIHFNVLAIVPRDSTVETFALAVNSAAMGMMFLPGDWRTTPEKD-
VRAR_STAS1      QVKKDLPNIKVVMLTSYIEDNEVYRALDSGVDSYILKTTSASDIAEAIRSVFEAEVLVKM--RNRMKQRA
UHPA_SALTY      QLP---KGMATIVLSVHDSPALVEQALNAGARGFLSKRCSPDELIAAVHTVATGGCYLT----------P
DESR_BACSU      ELKD--TGCKIIILTTFARPGYFQRAIKAGVKGYLLKDSPSEELANAIRSVMNGKIYAPELME-------
YCF29_CYAPA     QLRTDYCTLPVILLTTRGLTQDRIIGYKTGCDSYISKPFNIEELVVIIEGVLNRHTLIRLKLE-KKQKNS
LIAR_BACSU      QICRELSDPKIIVLTSFIDDDKVYPVIEAGALSYLLKTSKXXXXXXXXXXXSKGEPKLESKVAGK-----
UHPA_SHIFL      QLP---KGMATIMLSVHDSPALVEQALNAGARGFLSKRCSPDELIAAVHTVATGGCYLT----------P
UHPA_ECOLI      QLP---KGMATIMLSVHDSPALVEQALNAGARGFLSKRCSPDELIAAVHTVATGGCYLT----------P
UHPA_ECOL6      QLP---KGMATIMLSVHDSPALVEQALNAGARGFLSKRCSPDELIAAVHTVATGGCYLT----------P
UHPA_ECO57      QLP---KGMATIMLSVHDSPALVEQALNAGARGFLSKRCSPDELIAAVHTVATGGCYLT----------P
RCSB_SALTI      YIKRHFPSLSIIVLTMNNNPAILSAVLDLDIEGIVLKQGAPTDLPKALAALQKGKKFTPESVSREKISAG
FIXJ_BRAJA      RMKAQQSPFPILIMTGHGDVPLAVEAMKLGAVDFLEKP--FED--DRLTAMIESAI-----RQAEAKSEA
RCSB_SHIFL      YIKRHFPSLSIIVLTMNNNPAILSAVLDLDIEGIVLKQGAPTDLPKALAALQKGKKFTPESVSREKISAG
RCSB_SALTY      YIKRHFPSLSIIVLTMNNNPAILSAVLDLDIEGIVLKQGAPTDLPKALAALQKGKKFTPESVSREKISAG
RCSB_ECOLI      YIKRHFPSLSIIVLTMNNNPAILSAVLDLDIEGIVLKQGAPTDLPKALAALQKGKKFTPESVSREKISAG
RCSB_ECOL6      YIKRHFPSLSIIVLTMNNNPAILSAVLDLDIEGIVLKQGAPTDLPKALAALQKGKKFTPESVSREKISAG
RCSB_ECO57      YIKRHFPSLSIIVLTMNNNPAILSAVLDLDIEGIVLKQGAPTDLPKALAALQKGKKFTPESVSREKISAG
UVRY_SHIFL      KIARSTADVKIIMLTVHTENPLPAKVMQAGAAGYLSKGAAPQEVVSAIRSVYSGQRYIASDQMALSQIEP
UVRY_ECOLI      KIARSTADVKIIMLTVHTENPLPAKVMQAGAAGYLSKGAAPQEVVSAIRSVYSGQRYIASDQMALSQIEP
UVRY_ECOL6      KIARSTADVKIIMLTVHTENPLPAKVMQAGAAGYLSKGAAPQEVVSAIRSVYSGQRYIASDQMALSQIEP
UVRY_ECO57      KIARSTADVKIIMLTVHTENPLPAKVMQAGAAGYLSKGAAPQEVVSAIRSVYSGQRYIASDQMALSQIEP
YVFU_BACSU      ------------------------RAVKAGAHGYLLKDGEIDDLADAIRKCV----------KGKRVFSP
GACA_PSEAE      KLLRSQPDIKVVVVTVCEEDPFPTRLMQAGAAGYMTKGAGLEEMVQAIRQVFAGQRYI----------SP
YCF29_PORPU     KLRKKLAKIPVIFLTAKGMTKDRIKGYNMGCYGYLSKPFDPEELVSLIKNLIYRD---SLNSQNLKKQNS
MALT_VIBPA      ---------------------------------------------------------------------P
MALT_VIBHB      ---------------------------------------------------------------------P
MALT_VIBCH      ---------------------------------------------------------------------P
GACA_PSEU2      KMLRSHPDIKVVAVTVCEEDPFPTRLLQAGAAGYMTKGAGLAEMVQAIRLVFAGQRYISAQQLALKSFQP
YCF29_PORYE     ------SKIPVIFLTAKGMTKDRIKGYDMGCYGYLSKPFDPNELLSIINNLIARDVLKEASLQNSATSNQ
MALT_VIBVY      ---------------------------------------------------------------------P
MALT_VIBVU      ---------------------------------------------------------------------P
MALT_YERPY      ---------------------------------------------------------------------P
MALT_YERPS      ---------------------------------------------------------------------P
MALT_YERPP      ---------------------------------------------------------------------P
MALT_YERPE      ---------------------------------------------------------------------P
MALT_YERPB      ---------------------------------------------------------------------P
MALT_YERPA      ---------------------------------------------------------------------P
MALT_YERP3      ---------------------------------------------------------------------P
FIXJ_RHIME      NLGDLKINIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFEDTVIIEAIERASE--------HLXXXXXXX
CMPA_BACSU      ----------IIVYTGYEVEDYFEEAIRAGLHGAISKTESKEKITQYIYHVLNGEILVDFAYSSQKEQD-
MALT_SALTY      ---------------------------------------------------------------------P
MALT_SALTI      ---------------------------------------------------------------------P
MALT_SALSV      ---------------------------------------------------------------------P
MALT_SALPK      ---------------------------------------------------------------------P
MALT_SALPB      ---------------------------------------------------------------------P
MALT_SALPA      ---------------------------------------------------------------------P
MALT_SALNS      ---------------------------------------------------------------------P
MALT_SALHS      ---------------------------------------------------------------------P
MALT_SALG2      ---------------------------------------------------------------------P
MALT_SALEP      ---------------------------------------------------------------------P
MALT_SALDC      ---------------------------------------------------------------------P
MALT_SALCH      ---------------------------------------------------------------------P
MALT_SALAR      ---------------------------------------------------------------------P
MALT_SALA4      ---------------------------------------------------------------------P
MALT_CITK8      ---------------------------------------------------------------------P
MALT_KLEP7      ---------------------------------------------------------------------P
MALT_KLEP3      ---------------------------------------------------------------------P
MALT_YERE8      ---------------------------------------------------------------------P
MALT_ESCF3      ---------------------------------------------------------------------P
MALT_ECOLI      ---------------------------------------------------------------------P
MALT_ECOLC      ---------------------------------------------------------------------P
MALT_ECOHS      ---------------------------------------------------------------------P
MALT_ECODH      ---------------------------------------------------------------------P
MALT_ECOBW      ---------------------------------------------------------------------P
MALT_SERP5      ---------------------------------------------------------------------P
MALT_ENTS8      ---------------------------------------------------------------------P
MALT_ENT38      ---------------------------------------------------------------------P
GERE_BACSU      ----------------------------------------------------------------------
Y890_MYCTU      ----------------------------------------------------------------------
ALKS_PSEOL      ----------------------------------------------------------------------
Y914_MYCBO      ----------------------------------------------------------------------
MOAR_KLEAE      ----------------------------------------------------------------------
MALT_PHOLL      ---------------------------------------------------------------------P
YGEK_ECOLI      --------------------------LEAGAKGCVWKTSHPAKLNRAIDSISNGYTYFDSVHMDCEK---
YGEK_ECO57      --------------------------LEAGAKGCVWKTSHPAKLNRAIDSISNGYTYFDSVHMDCEK---
SGAR_HYPME      RVRKEKWRTRIIIYTGERSSEVLRTAIKSGAWGFVAKTEEPQVLLEAVVSVARGRLSLPYVDIDLLNHDP
MALT_SHIF8      ---------------------------------------------------------------------P
MALT_SHIBS      ---------------------------------------------------------------------P
MALT_ECOUT      ---------------------------------------------------------------------P
MALT_ECOSM      ---------------------------------------------------------------------P
MALT_ECOSE      ---------------------------------------------------------------------P
MALT_ECOLU      ---------------------------------------------------------------------P
MALT_ECOL6      ---------------------------------------------------------------------P
MALT_ECOL5      ---------------------------------------------------------------------P
MALT_ECOK1      ---------------------------------------------------------------------P
MALT_ECO8A      ---------------------------------------------------------------------P
MALT_ECO81      ---------------------------------------------------------------------P
MALT_ECO7I      ---------------------------------------------------------------------P
MALT_ECO5E      ---------------------------------------------------------------------P
MALT_ECO57      ---------------------------------------------------------------------P
MALT_ECO55      ---------------------------------------------------------------------P
MALT_ECO45      ---------------------------------------------------------------------P
MALT_ECO27      ---------------------------------------------------------------------P
MALT_ECO24      ---------------------------------------------------------------------P
DCTR_RHOCA      ALQARPEGLPVIFLTGHADVPLAVQSLKAGAFDFVEKPFNDNHIVDIALSAI-------AAHEGXXXXXX
EVGA_SHIFL      TLRKRQYSGIIIIVSAKNDHFYGKHCADAGANGFVSKKEGMXXXXXXXXXXXXGYCYFPNRFVGSLTSDQ
EVGA_ECOLI      TLRKRQYSGIIIIVSAKNDHFYGKHCADAGANGFVSKKEGMXXXXXXXXXXXXGYCYFPNRFVGSLTSDQ
EVGA_ECOL6      TLRKRQYSGIIIIVSAKNDHFYGKHCADAGANGFVSKKEGMXXXXXXXXXXXXGYCYFPNRFVGSLTSDQ
EVGA_ECO57      TLRKRQYSGIIIIVSAKNDHFYGKHCADAGANGFVSKKEGMXXXXXXXXXXXXGYCYFPNRFVGSLTSDQ
SP0F_BACSU      RMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYL------------------
MOXX_PARDE      RLRRVDPDLPILVFTMHRSPVLARRALMFGANGIINKDSPPAEICAAFTEVARG------GNYVDSRLAM
MALT_SHISS      ---------------------------------------------------------------------P
MALR_BACSU      ELRAQNEAVDVIVISAASELDVIKKTLRYGAVDYLIK---------------------------------
CSGD_SALTY      ----------------------------------------------------------------------
CSGD_ECOLI      ----------------------------------------------------------------------
YKOG_BACSU      RLRKTDSQTPVILLTARDSIPDKVTGLDIGANDYVTKPFEIEELLARIRAAL------------------
NTRC_SALTY      QIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDE---------------------------
GACA_PSEVI      KLLRSHPDIKVVAVTVCEEDPFPTRLLQAGAAGYMTKGAGLAEMVQAIRLVFAGQRYISAQQLALKSFQP
GACA_PSEFL      KLLRSHPDIKVVAVTVCEEDPFPTRLLQAGAAGYLTKGAGLNEMVQAIRLVFAGQRYI------------
SOLR1_RALSO     ----------------------------------------------------------------------
SOLR2_RALSO     ----------------------------------------------------------------------
CARR_PECCC      ----------------------------------------------------------------------
ARR4_ARATH      KIKSNFREVPVVIMSSENVLTRIDRCLEEGAQDFLLKPVKLADVK-RLRSHLTKDVKLSNGNK-------
REGX3_MYCTU     QLRAR-SSVPVIMVTARDSEIDKVVGLELGADDYVTKPYSARELIARIRAVL------------------
REGX3_MYCS2     QLRAR-SSVPVIMVTARDSEIDKVVGLELGADDYVTKPYSARELIARIRAVL------------------
REGX3_MYCBO     QLRAR-SSVPVIMVTARDSEIDKVVGLELGADDYVTKPYSARELIARIRAVL------------------
YCF29_GUITH     ----------------------------------------------------------------------
BCER_BACHD      MIR-QHSNVPIIFLSSRDHPTDMVMSMQLGADDFIQKPFHFDVLVAKIQAIL------------------
YCF27_PORAE     ELRKE-SDVPIIMLTALSDVSDRITGLELGADDYIVKPFSPKELEARIRSVL------------------
CHEB1_DECAR     RLR----PMPVVMVSSFTEADTTLKALELGAIDFIGK---------------------------------
NTRC_KLEPN      QIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDE---------------------------
ARR3_ARATH      KIKTSFKEVPVVIMSSENVMTRIDRCLEEGAEDFLLKPVKLADVK-RLRSYLTRDVKVAA--EGNKRK--
SP0F_BACTK      ACKEIDESIKVILMSAYGELDMIQEAKDLGALMHFAKPFDIDEIRQAVR---------------------
REGX3_MYCLE     QLRVR-SSVPVIMVTARDSEIDKVVGLELGADDYVTKPYSARELIARIRAVL------------------
NTRC_ECOLI      QIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDE---------------------------
NTRC_ECO57      QIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDE---------------------------
CHEB2_GEOMG     RIIMGYCPTPVIVISAKSDDEKVFKALELGAVDFVAKSQGIDDIQQKVRGV-------------------
RCSC_SALTI      RIRQLGLTLPVVGVTANALAEEKQRCLESGMDSCLSKPVTLDALKQTLAVYAE-----------------
CHEB_TREDE      ELKKQNIKIPVVILSAKEGAKVTMDCLELGACDFITKPSG------------------------------
CHEB3_GEOSL     RIVMEYSPTAVIVISSRSEDEKVFRALELGAVDFVAKSEEILTIREDLHRKVRGVIHLNLAGIVRREREQ
Y851_SYNP2      FLRYQGNTIPILVLSAKASETDRVLGLEVGADDYLTKPFSLRELVARCRALLRRQQFIRSTPKNSVRQFK
SPHR_SYNE7      LLRRQGVTVPILMLSAKDTETDRVVGLEIGADDYLTKPFGTRELVARCRALLRRS-------QNQPAETP
RCSC_SALTY      RIRQLGLTLPVVGVTANALAEEKQRCLESGMDSCLSKPVTLDVLKQTLAVYAE-----------------
RCSC_ECOLI      RIRQLGLTLPVIGVTANALAEEKQRCLESGMDSCLSKPVTLDVIKQTLTLYAE-----------------
ARR21_ARATH     QITQEFGNLPVLVMSS--DTNKEEESLSCGAMGFIPKPIHPTDLTKIYQFALRNGKSTLSTEQNHKDADV
CHEB_THIDA      RLR----PMPVVMVSSLTESEITMRALELGAVDFVTK---------------------------------
RSSB_SERMA      AWRAAGQNIPIIILTARDRIESLVNSLDSGANDFLAKPFALPELISRVKAV-------------------
OMPR_SHIFL      RLRSQSNPMPIIMVTAKGEEVDRIVGLEIGADDYIPKPFNPRELLARIRAVL------------------
OMPR_SALTY      RLRSQSNPMPIIMVTAKGEEVDRIVGLEIGADDYIPKPFNPRELLARIRAVL------------------
OMPR_SALTI      RLRSQSNPMPIIMVTAKGEEVDRIVGLEIGADDYIPKPFNPRELLARIRAVL------------------
OMPR_ECOLI      RLRSQSNPMPIIMVTAKGEEVDRIVGLEIGADDYIPKPFNPRELLARIRAVL------------------
OMPR_ECOL6      RLRSQSNPMPIIMVTAKGEEVDRIVGLEIGADDYIPKPFNPRELLARIRAVL------------------
OMPR_ECO57      RLRSQSNPMPIIMVTAKGEEVDRIVGLEIGADDYIPKPFNPRELLARIRAVL------------------
BGLJ_ECOLI      ----------------------------------------------------------------------
YCF27_GALSU     EIRKE-SDIPIIMLTALGDVTDRITGLELGADDYVVKPFSPKELEARIRCVL------------------
PHOP_BACSU      QLRQQKLMFPILMLTAKDEEFDKVLGLELGADDYMTKPFSPREVNARVKAILRSEIAAPSSEMKNDEMEG


                         +         .         .         .         .         *         .:210
query           DVADLIGRLRTLTPQQSRVLGMLAEGLLNKQIAYELNVSEATIKAHVSAILLKLKVDSRTQAVIQLAKIN
AGMR_PSEAE      EL------LQALTRKQLLVLERMTKGESNKQIAYNLDIAETTVKAHVSAILRKLKVHNRVQAILSAGDID
NARP_ECOLI      FGAEE-DPFSVLTERELDVLHELAQGLSNKQIASVLNISEQTVKVHIRNLLRKLNVRSRVAATI------
NARP_HAEIN      NPLD------SLTDREMGVLRQIATGLSNKQIAAQLFISEETVKVHIRNLLRKLNVHSRVAATV------
DEGU_BREBE      QESSEIGPLHILTRRECEVLQLMTDGYSNRMIGEALYISEKTVKNHVSNILQKMNVNDRTQAVVESIK--
DEGU_BACSU      -YPEIRRPLHILTRRECEVLQMLADGKSNRGIGESLFISEKTVKNHVSNILQKMNVNDRTQAVVVAIK--
FIMZ_SALTY      ETLNFISNTRTLSNREVTVLRYLANGMSNKEIAEQLLLSNKTISAHKANIFSKLGLHSIVELI-------
NREC_STACT      --------FRILSKRELEILPLIAKGYGNKEIAEKLFVSVKTVEAHKTHIMQKLNLKSKPELV-------
NREC_STAES      EVSSSSDPFKILSKRELEILPLIAKGYGNKDIAEKLFVSVKTVEAHKTHIMTKLNLKSKPELV-------
NREC_STAEQ      EVSSSSDPFKILSKRELEILPLIAKGYGNKDIAEKLFVSVKTVEAHKTHIMTKLNLKSKPELV-------
YFIK_BACSU      KGINEIEKLLDLTEREIEVLAELGYGLNNKEIAEKLYITEGTVKNHVSNIISKLAVRDRTQAAIYSVRYG
NREC_STAAW      DTANTTDPFKILSKRELEILPLIAKGYGNKEIAEKLFVSVKTVEAHKTHIMTKLGLKSKPELV-------
NREC_STAAT      DTANTTDPFKILSKRELEILPLIAKGYGNKEIAEKLFVSVKTVEAHKTHIMTKLGLKSKPELV-------
NREC_STAAS      DTANTTDPFKILSKRELEILPLIAKGYGNKEIAEKLFVSVKTVEAHKTHIMTKLGLKSKPELV-------
NREC_STAAN      DTANTTDPFKILSKRELEILPLIAKGYGNKEIAEKLFVSVKTVEAHKTHIMTKLGLKSKPELV-------
NREC_STAAM      DTANTTDPFKILSKRELEILPLIAKGYGNKEIAEKLFVSVKTVEAHKTHIMTKLGLKSKPELV-------
NREC_STAAE      DTANTTDPFKILSKRELEILPLIAKGYGNKEIAEKLFVSVKTVEAHKTHIMTKLGLKSKPELV-------
NREC_STAAC      DTANTTDPFKILSKRELEILPLIAKGYGNKEIAEKLFVSVKTVEAHKTHIMTKLGLKSKPELV-------
NREC_STAA9      DTANTTDPFKILSKRELEILPLIAKGYGNKEIAEKLFVSVKTVEAHKTHIMTKLGLKSKPELV-------
NREC_STAA8      DTANTTDPFKILSKRELEILPLIAKGYGNKEIAEKLFVSVKTVEAHKTHIMTKLGLKSKPELV-------
NREC_STAA3      DTANTTDPFKILSKRELEILPLIAKGYGNKEIAEKLFVSVKTVEAHKTHIMTKLGLKSKPELV-------
NREC_STAA2      DTANTTDPFKILSKRELEILPLIAKGYGNKEIAEKLFVSVKTVEAHKTHIMTKLGLKSKPELV-------
NREC_STAA1      DTANTTDPFKILSKRELEILPLIAKGYGNKEIAEKLFVSVKTVEAHKTHIMTKLGLKSKPELV-------
YDFI_BACSU      DILKRLQEIQQLTEKEVIVLKAIAKGLKSKAIAFDLGVSERTVKSRLTSIYNKLGANSRTEAV-------
NREC_STAAR      DTANTSDPFKILSKRELEILPLIAKGYGNKEIAEKLFVSVKTVEAHKTHIMTKLGLKSKPELV-------
NREC_STAAB      DTANTSDPFKILSKRELEILPLIAKGYGNKEIAEKLFVSVKTVEAHKTHIMTKLGLKSKPELV-------
TRPO_PSEAE      D--NEARMLESLSDREMTVLQYLANGNTNKAIAQQLFLSEKTVSTYKSRIMLKLNAHS------------
FIMZ_ECOLI      KCXXXXXXXXXXXXREVTILRYLVSGLSNKEIADKLLLSNKTVSAHKSNIYGKLGLHSIVE-LIDYAKL-
FIMZ_ECO57      KCXXXXXXXXXXXXREVTILRYLVSGLSNKEIADKLLLSNKTVSAHKSNIYGKLGLHSIVE-LIDYAKL-
YXJL_BACSU      HAEELA---EPFTKRELEVLQQMAYGLRNEDIAEKLFVSESTVKTHVHRILQKCNAQDRTQAVV------
VRAR_STAES      KRAELY---EMLTEREMEILLLIAKGYSNQEIASASHITIKTVKTHVSNILSKLEVQDRTQAVI------
VRAR_STAEQ      KRAELY---EMLTEREMEILLLIAKGYSNQEIASASHITIKTVKTHVSNILSKLEVQDRTQAVI------
NODW_BRAJA      TVANLKSLFETLSPREQAVMKLVATGLMNKQVAAELGLAEITVKIYRGHVMKKMRARSLADLIRMSETLG
NREC_STAHJ      DDVSTNDPFKILSKRELEILPLIAKGYGNKDIAEKLFVSVKTVEAHKTHIMTKLDLKSKPELV-------
YHCZ_BACSU      EKE----KYYQLTRREKDVLTEIANGKSNKEIAAALFISEKTVKTHVSNLLAKLEVADRTQAALFAVKYN
BVGA_BORPE      NAKSDSTLISVLSNRELTVLQLLAQGMSNKDIADSMFLSNKTVSTYKTRLLQKLNATSLVE-LIDLAKRN
BVGA_BORPA      NAKSDSTLISVLSNRELTVLQLLAQGMSNKDIADSMFLSNKTVSTYKTRLLQKLNATSLVE-LIDLAKRN
BVGA_BORBR      NAKSDSTLISVLSNRELTVLQLLAQGMSNKDIADSMFLSNKTVSTYKTRLLQKLNATSLVE-LIDLAKRN
VRAR_STAHJ      KRAELY---EMLTEREMEILLLIAKGYSNQEIASASHITIKTVKTHVSNILSKLEVQDRTQAVI------
FIXJ_AZOC5      DARSEVGRIAGLSQRERQVLECLVNGLANKTIAYDLGISPRTVEVYRANVMTKMKAASLPELV-------
VRAR_STAAW      KRAELY---EMLTEREMEILLLIAKGYSNQEIASASHITIKTVKTHVSNILSKLEVQDRTQAVI------
VRAR_STAAS      KRAELY---EMLTEREMEILLLIAKGYSNQEIASASHITIKTVKTHVSNILSKLEVQDRTQAVI------
VRAR_STAAR      KRAELY---EMLTEREMEILLLIAKGYSNQEIASASHITIKTVKTHVSNILSKLEVQDRTQAVI------
VRAR_STAAN      KRAELY---EMLTEREMEILLLIAKGYSNQEIASASHITIKTVKTHVSNILSKLEVQDRTQAVI------
VRAR_STAAM      KRAELY---EMLTEREMEILLLIAKGYSNQEIASASHITIKTVKTHVSNILSKLEVQDRTQAVI------
VRAR_STAAC      KRAELY---EMLTEREMEILLLIAKGYSNQEIASASHITIKTVKTHVSNILSKLEVQDRTQAVI------
VRAR_STAA1      KRAELY---EMLTEREMEILLLIAKGYSNQEIASASHITIKTVKTHVSNILSKLEVQDRTQAVI------
NARL_SHIFL      --------VNQLTPRERDILKLIAQGLPNKMIARRLDITESTVXXXXXXXXXXXXXXSRVEAAV------
NARL_ECOLI      --------VNQLTPRERDILKLIAQGLPNKMIARRLDITESTVXXXXXXXXXXXXXXSRVEAAV------
NARL_ECOL6      --------VNQLTPRERDILKLIAQGLPNKMIARRLDITESTVXXXXXXXXXXXXXXSRVEAAV------
NARL_ECO57      --------VNQLTPRERDILKLIAQGLPNKMIARRLDITESTVXXXXXXXXXXXXXXSRVEAAV------
YHJB_ECOLI      -----IKDLKSLSARQREILTMLAAGESNKEIGRALNISTGTVKAHLESLYRRLEVKNRTQAAMML----
VRAR_STAS1      ELYEM------LTEREMEILLLIAKGYSNQEIASASHITIKTVKTHVSNILSKLEVQDRTQAVI------
UHPA_SALTY      DIAVKLGRQDPLTKRERQVAEKLAQGMAVKEIAAELGLSPKTVHVHRANLLEKLGVSN------------
DESR_BACSU      ---DLYSEANPLTDREKEVLELVADGKNTKEIAQELSIKSGTVRNYISMILEKLEVKNRIEAI-------
YCF29_CYAPA     FLLIKSNNLKNFTPREQSVLNLVVEGLLNKQIAANLNISIRIVEKYVSRLFIKTKTRNRAELV-------
LIAR_BACSU      ----VLSRLRSLTKRELEILCLIAEGKTNKEIGEELFITIKTVKTHITNILSKLDVSDRTQAAV------
UHPA_SHIFL      DIAIKLGRQDPLTKRERQVAEKLAQGMAVKEIAAELGLSPKTVHVHRANLMEKLGVSN------------
UHPA_ECOLI      DIAIKLGRQDPLTKRERQVAEKLAQGMAVKEIAAELGLSPKTVHVHRANLMEKLGVSN------------
UHPA_ECOL6      DIAIKLGRQDPLTKRERQVAEKLAQGMAVKEIAAELGLSPKTVHVHRANLMEKLGVSN------------
UHPA_ECO57      DIAIKLGRQDPLTKRERQVAEKLAQGMAVKEIAAELGLSPKTVHVHRANLMEKLGVSN------------
RCSB_SALTI      GYGD-----KRLSPKESEVLRLFAEGFLVTEIAKKLNRSIKTISSQKKSAMMKLGVENDIALLNYLSSVT
FIXJ_BRAJA      VAQDIAARVASLSPRERQVMEGLIAGLSNKLIAREYDISPRTIEVYRANVMTKMQANSLSELV-------
RCSB_SHIFL      GYGD-----KRLSPKESEVLRLFAEGFLVTEIAKKLNRSIKTISSQKKSAMMKLGVENDIALLNYLSSVT
RCSB_SALTY      GYGD-----KRLSPKESEVLRLFAEGFLVTEIAKKLNRSIKTISSQKKSAMMKLGVENDIALLNYLSSVT
RCSB_ECOLI      GYGD-----KRLSPKESEVLRLFAEGFLVTEIAKKLNRSIKTISSQKKSAMMKLGVENDIALLNYLSSVT
RCSB_ECOL6      GYGD-----KRLSPKESEVLRLFAEGFLVTEIAKKLNRSIKTISSQKKSAMMKLGVENDIALLNYLSSVT
RCSB_ECO57      GYGD-----KRLSPKESEVLRLFAEGFLVTEIAKKLNRSIKTISSQKKSAMMKLGVENDIALLNYLSSVT
UVRY_SHIFL      EKTE--SPFASLSERELQIMLMITKGQKVNEISEQLNLSPKTVNSYRYRMFSKLNI--------------
UVRY_ECOLI      EKTE--SPFASLSERELQIMLMITKGQKVNEISEQLNLSPKTVNSYRYRMFSKLNI--------------
UVRY_ECOL6      EKTE--SPFASLSERELQIMLMITKGQKVNEISEQLNLSPKTVNSYRYRMFSKLNI--------------
UVRY_ECO57      EKTE--SPFASLSERELQIMLMITKGQKVNEISEQLNLSPKTVNSYRYRMFSKLNI--------------
YVFU_BACSU      ELTNMMRDENPLTVREQEILRLAALGKTTKDITLELYLSQGTVRNYISEIIQKLNAKNRTEA--------
GACA_PSEAE      QIAQQLA-LKSFQPQQHQIALMIANCHKVQSISDKLCLSPKTVNTYRYRIFEKLSITSDVELAL------
YCF29_PORPU     DEIPLF-QLLYLTPREKSILNLVIDGLTNKEIAVILDTSIRNVEKYVSRLLQKTNTRNRTLLVKYSIKNN
MALT_VIBPA      NVPELV-RTSPLTQREWQVLGLIYSGFSNEQIAQELDVAGTTIKTHIRNLYQKLNIANRKEAIV------
MALT_VIBHB      NVPELV-RTSPLTQREWQVLGLIYSGFSNEQIAQELDVAGTTIKTHIRNLYQKLNIANRKEAIV------
MALT_VIBCH      NIPELV-RTSPLTQREWQVLGLIYSGFSNEQIAHELDVAGTTIKTHIRNLYQKLNIANRKEAV-------
GACA_PSEU2      QVNN--SPFDLLSEREIQIALMIVGCQKVQTISDKLCLSPKTVNTYRYRIFEKLSISSDVELAL------
YCF29_PORYE     QLNHKI----RLTPREKSILDLVVDGLTNKEISTILNTSVRNVEKYVSRLLHKTNMKNRTLLV-------
MALT_VIBVY      NVPELV-RTSPLTQREWQVLGLIYSGFSNEQIAQELDVAGTTIKTHIRNLYQKLNIANRKEAV-------
MALT_VIBVU      NVPELV-RTSPLTQREWQVLGLIYSGFSNEQIAQELDVAGTTIKTHIRNLYQKLNIANRKEAV-------
MALT_YERPY      QVPELI-RTSPLTQREWQVLGLIYSGYSNDQIANELDVAATTIKTHIRNLYQKLGVAHRQEAVQQAQRL-
MALT_YERPS      QVPELI-RTSPLTQREWQVLGLIYSGYSNDQIANELDVAATTIKTHIRNLYQKLGVAHRQEAVQQAQRL-
MALT_YERPP      QVPELI-RTSPLTQREWQVLGLIYSGYSNDQIANELDVAATTIKTHIRNLYQKLGVAHRQEAVQQAQRL-
MALT_YERPE      QVPELI-RTSPLTQREWQVLGLIYSGYSNDQIANELDVAATTIKTHIRNLYQKLGVAHRQEAVQQAQRL-
MALT_YERPB      QVPELI-RTSPLTQREWQVLGLIYSGYSNDQIANELDVAATTIKTHIRNLYQKLGVAHRQEAVQQAQRL-
MALT_YERPA      QVPELI-RTSPLTQREWQVLGLIYSGYSNDQIANELDVAATTIKTHIRNLYQKLGVAHRQEAVQQAQRL-
MALT_YERP3      QVPELI-RTSPLTQREWQVLGLIYSGYSNDQIANELDVAATTIKTHIRNLYQKLGVAHRQEAVQQAQRL-
FIXJ_RHIME      XXXXXIARLQTLSERERQVLSAVVAGLPNKSIAYDLDISPRTVEVHRANVMAKMKAKS------------
CMPA_BACSU      ----------VLTPRECLILQEVEKGFTNQEIADALHLSKRSIEYSLTSIFNKLNVGSRTEAVL------
MALT_SALTY      DVPELI-RTSPLTQREWQVLGLIYSGYSNEQIAGELAVAATTIKTHIRNLYQKLGVAHRQDAV-------
MALT_SALTI      DVPELI-RTSPLTQREWQVLGLIYSGYSNEQIAGELAVAATTIKTHIRNLYQKLGVAHRQDAV-------
MALT_SALSV      DVPELI-RTSPLTQREWQVLGLIYSGYSNEQIAGELAVAATTIKTHIRNLYQKLGVAHRQDAV-------
MALT_SALPK      DVPELI-RTSPLTQREWQVLGLIYSGYSNEQIAGELAVAATTIKTHIRNLYQKLGVAHRQDAV-------
MALT_SALPB      DVPELI-RTSPLTQREWQVLGLIYSGYSNEQIAGELAVAATTIKTHIRNLYQKLGVAHRQDAV-------
MALT_SALPA      DVPELI-RTSPLTQREWQVLGLIYSGYSNEQIAGELAVAATTIKTHIRNLYQKLGVAHRQDAV-------
MALT_SALNS      DVPELI-RTSPLTQREWQVLGLIYSGYSNEQIAGELAVAATTIKTHIRNLYQKLGVAHRQDAV-------
MALT_SALHS      DVPELI-RTSPLTQREWQVLGLIYSGYSNEQIAGELAVAATTIKTHIRNLYQKLGVAHRQDAV-------
MALT_SALG2      DVPELI-RTSPLTQREWQVLGLIYSGYSNEQIAGELAVAATTIKTHIRNLYQKLGVAHRQDAV-------
MALT_SALEP      DVPELI-RTSPLTQREWQVLGLIYSGYSNEQIAGELAVAATTIKTHIRNLYQKLGVAHRQDAV-------
MALT_SALDC      DVPELI-RTSPLTQREWQVLGLIYSGYSNEQIAGELAVAATTIKTHIRNLYQKLGVAHRQDAV-------
MALT_SALCH      DVPELI-RTSPLTQREWQVLGLIYSGYSNEQIAGELAVAATTIKTHIRNLYQKLGVAHRQDAV-------
MALT_SALAR      DVPELI-RTSPLTQREWQVLGLIYSGYSNEQIAGELAVAATTIKTHIRNLYQKLGVAHRQDAV-------
MALT_SALA4      DVPELI-RTSPLTQREWQVLGLIYSGYSNEQIAGELAVAATTIKTHIRNLYQKLGVAHRQDAV-------
MALT_CITK8      DVPELI-RTSPLTQREWQVLGLIYSGYSNEQIAGELAVAATTIKTHIRNLYQKLGVAHRQDAV-------
MALT_KLEP7      EVPELI-RTSPLTQREWQVLGLIYSGYSNEQIAGELDVAATTIKTHIRNLYQKLGVAHRQDAV-------
MALT_KLEP3      EVPELI-RTSPLTQREWQVLGLIYSGYSNEQIAGELDVAATTIKTHIRNLYQKLGVAHRQDAV-------
MALT_YERE8      QVPELI-RTSPLTQREWQVLGLIYSGYSNDQIAGELEVAATTIKTHIRNLYQKLGVAHRQDAVQQAQRL-
MALT_ESCF3      EVPELI-RTSPLTQREWQVLGLIYSGYSNEQIAGELEVAATTIKTHIRNLYQKLGVAHRQDAV-------
MALT_ECOLI      EVPELI-RTSPLTQREWQVLGLIYSGYSNEQIAGELEVAATTIKTHIRNLYQKLGVAHRQDAV-------
MALT_ECOLC      EVPELI-RTSPLTQREWQVLGLIYSGYSNEQIAGELEVAATTIKTHIRNLYQKLGVAHRQDAV-------
MALT_ECOHS      EVPELI-RTSPLTQREWQVLGLIYSGYSNEQIAGELEVAATTIKTHIRNLYQKLGVAHRQDAV-------
MALT_ECODH      EVPELI-RTSPLTQREWQVLGLIYSGYSNEQIAGELEVAATTIKTHIRNLYQKLGVAHRQDAV-------
MALT_ECOBW      EVPELI-RTSPLTQREWQVLGLIYSGYSNEQIAGELEVAATTIKTHIRNLYQKLGVAHRQDAV-------
MALT_SERP5      QVPELI-RTSPLTQREWQVLGLIYSGYSNDQIAGELAVAATTIKTHIRNLYQKLGVAHRQEAVQQAQQL-
MALT_ENTS8      EVPELI-RTSPLTQREWQVLGLIYSGYSNDQIAGELDVAATTIKTHIRNLYQKLGVAHRQDAV-------
MALT_ENT38      EVPELI-RTSPLTQREWQVLGLIYSGYSNEQIAGELAVAATTIKTHIRNLYQKLGVAHRQDAV-------
GERE_BACSU      -----------LTKREREVFELLVQDKTTKEIASELFISEKTVRNHISNAMQKLGVKGRSQAVVELLRM-
Y890_MYCTU      ----------SLTPTERDVVRLVSEGLSNKDIAKRLFVSPRTVQTHLTHVYAKLGLPSRVQLVDEAAR--
ALKS_PSEOL      -----------LTRKQIAVLRLVKEGCSNKQIATNMHVTEDAIKWHMRKIFATLNVVNRTQATIE-----
Y914_MYCBO      ----------SLTPTERDVVRLVSEGLSNKDIAKRLFVSPRTVQTHLTHVYAKLGLASRVQLVDEAAR--
MOAR_KLEAE      -----------LTAKEREIVGMVREGASNKLIARQLDISLSTVKTHLRNIFAKTEVVNRTELV-------
MALT_PHOLL      DVPELI-RNSPLTQREWQVLGLIYSGYSNDQIAAELDVATTTIKTHIRNLYQKLGI--------------
YGEK_ECOLI      -ISSRYSSDNQLTNRESEILQLIADGKTNKEIANFLQLSRKTVETHRLNIMKKLDVHSGIELI-------
YGEK_ECO57      -ISSRYSSDNQLTNRESEILQLIADGKTNKEIANFLQLSRKTVETHRLNIMKKLDVHSGIELI-------
SGAR_HYPME      XXXXXXXXXXXXXXXXN--------GWTNLQIAARTGISRNTVKYHLKNLYDKLGVSNRAMAVALHVSIN
MALT_SHIF8      EVPELI-RTSPLTQREWQVLGLIYSGYSNEQIAGELEVAATTIKTHIRNLYQKL----------------
MALT_SHIBS      EVPELI-RTSPLTQREWQVLGLIYSGYSNEQIAGELEVAATTIKTHIRNLYQKL----------------
MALT_ECOUT      EVPELI-RTSPLTQREWQVLGLIYSGYSNEQIAGELEVAATTIKTHIRNLYQKL----------------
MALT_ECOSM      EVPELI-RTSPLTQREWQVLGLIYSGYSNEQIAGELEVAATTIKTHIRNLYQKL----------------
MALT_ECOSE      EVPELI-RTSPLTQREWQVLGLIYSGYSNEQIAGELEVAATTIKTHIRNLYQKL----------------
MALT_ECOLU      EVPELI-RTSPLTQREWQVLGLIYSGYSNEQIAGELEVAATTIKTHIRNLYQKL----------------
MALT_ECOL6      EVPELI-RTSPLTQREWQVLGLIYSGYSNEQIAGELEVAATTIKTHIRNLYQKL----------------
MALT_ECOL5      EVPELI-RTSPLTQREWQVLGLIYSGYSNEQIAGELEVAATTIKTHIRNLYQKL----------------
MALT_ECOK1      EVPELI-RTSPLTQREWQVLGLIYSGYSNEQIAGELEVAATTIKTHIRNLYQKL----------------
MALT_ECO8A      EVPELI-RTSPLTQREWQVLGLIYSGYSNEQIAGELEVAATTIKTHIRNLYQKL----------------
MALT_ECO81      EVPELI-RTSPLTQREWQVLGLIYSGYSNEQIAGELEVAATTIKTHIRNLYQKL----------------
MALT_ECO7I      EVPELI-RTSPLTQREWQVLGLIYSGYSNEQIAGELEVAATTIKTHIRNLYQKL----------------
MALT_ECO5E      EVPELI-RTSPLTQREWQVLGLIYSGYSNEQIAGELEVAATTIKTHIRNLYQKL----------------
MALT_ECO57      EVPELI-RTSPLTQREWQVLGLIYSGYSNEQIAGELEVAATTIKTHIRNLYQKL----------------
MALT_ECO55      EVPELI-RTSPLTQREWQVLGLIYSGYSNEQIAGELEVAATTIKTHIRNLYQKL----------------
MALT_ECO45      EVPELI-RTSPLTQREWQVLGLIYSGYSNEQIAGELEVAATTIKTHIRNLYQKL----------------
MALT_ECO27      EVPELI-RTSPLTQREWQVLGLIYSGYSNEQIAGELEVAATTIKTHIRNLYQKL----------------
MALT_ECO24      EVPELI-RTSPLTQREWQVLGLIYSGYSNEQIAGELEVAATTIKTHIRNLYQKL----------------
DCTR_RHOCA      XXXXXXXXXXXXXXXXXXXMALMLEGLMNKQIAERLGIAMRTVEVHRSRVLAKM----------------
EVGA_SHIFL      Q------KLDSLSKQEISVMRYILDGKDNNDIAEKMFISNKTVSTYKSRLMEKLECKS------------
EVGA_ECOLI      Q------KLDSLSKQEISVMRYILDGKDNNDIAEKMFISNKTVSTYKSRLMEKLECKS------------
EVGA_ECOL6      Q------KLDSLSKQEISVMRYILDGKDNNDIAEKMFISNKTVSTYKSRLMEKLECKS------------
EVGA_ECO57      Q------KLDSLSKQEISVMRYILDGKDNNDIAEKMFISNKTVSTYKSRLMEKLECKS------------
SP0F_BACSU      ----------------------------------------------------------------------
MOXX_PARDE      QIALLVSRPGTLTGREEEILGMITEGMSYRDIADRACISYKTV-SNVSLVL-------------------
MALT_SHISS      EVPELI-HTSPLTQREWQVLGLIYSGYSNEQIAGELEVAATTIKTHIRNLYQKL----------------
MALR_BACSU      ----------------------------------------------------------------------
CSGD_SALTY      -----------LTHREKEILNKLRIGASNNEIARSLFISENTVKTHLYNLFKKIAVKNRTQAV-------
CSGD_ECOLI      -----------LTHREKEILNKLRIGASNNEIARSLFISENTVKTHLYNLFKKIAVKNRTQAV-------
YKOG_BACSU      ----------------------------------------------------------------------
NTRC_SALTY      ----------------------------------------------------------------------
GACA_PSEVI      QVNN--SPFDLLSEREIQIALMIVGCQKVQTISDKLCLSPKTVNTYRYRIFEKLSISSDVELAL------
GACA_PSEFL      ----------------------------------------------------------------------
SOLR1_RALSO     -----------LTAREREVLCWTGEGKTAYEIGQILRISERTVNFHVNNVLLKLAATNKVQAVVKAIAI-
SOLR2_RALSO     -----------LTTREREVLCWTGEGKTAYEIGQILRISERTVNFHVNNVLLKLAATNKVQAVVK-----
CARR_PECCC      -----------LSPRETEVLFLVSSGRTYKEVSRILGISEVTVKFHINNSVRKLDVINSRHAITKALELN
ARR4_ARATH      ----------------------------------------------------------------------
REGX3_MYCTU     ----------------------------------------------------------------------
REGX3_MYCS2     ----------------------------------------------------------------------
REGX3_MYCBO     ----------------------------------------------------------------------
YCF29_GUITH     -----------LTVKEKEVFKFIQDGLTNKQISNVMGITQRSVEKYVTKIFEKLKIQNRIQ---------
BCER_BACHD      ----------------------------------------------------------------------
YCF27_PORAE     ----------------------------------------------------------------------
CHEB1_DECAR     ----------------------------------------------------------------------
NTRC_KLEPN      ----------------------------------------------------------------------
ARR3_ARATH      ----------------------------------------------------------------------
SP0F_BACTK      ----------------------------------------------------------------------
REGX3_MYCLE     ----------------------------------------------------------------------
NTRC_ECOLI      ----------------------------------------------------------------------
NTRC_ECO57      ----------------------------------------------------------------------
CHEB2_GEOMG     ----------------------------------------------------------------------
RCSC_SALTI      ----------------------------------------------------------------------
CHEB_TREDE      ----------------------------------------------------------------------
CHEB3_GEOSL     ERASVAAGRRT-----------------------------------------------------------
Y851_SYNP2      DISTVRGEEVSLSPKEYRLLELFRDQLIEQVWGADFLGDTKTVDVHIRWLREKLELD-------------
SPHR_SYNE7      AVLRYEG--LKLFPEECRVL--------------------------------------------------
RCSC_SALTY      ----------------------------------------------------------------------
RCSC_ECOLI      ----------------------------------------------------------------------
ARR21_ARATH     SVPQQI----TLVPEQADVL--------------------------------------------------
CHEB_THIDA      ----------------------------------------------------------------------
RSSB_SERMA      ----------------------------------------------------------------------
OMPR_SHIFL      ----------------------------------------------------------------------
OMPR_SALTY      ----------------------------------------------------------------------
OMPR_SALTI      ----------------------------------------------------------------------
OMPR_ECOLI      ----------------------------------------------------------------------
OMPR_ECOL6      ----------------------------------------------------------------------
OMPR_ECO57      ----------------------------------------------------------------------
BGLJ_ECOLI      -----INQSRTLSPTEREILRFMSRGYSMTQIAEQLKRNIKTIRAHKFNVMSKLGVSS------------
YCF27_GALSU     ----------------------------------------------------------------------
PHOP_BACSU      QI--VIGDLKIL----------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           TSAMVA
AGMR_PSEAE      FAA---
NARP_ECOLI      ------
NARP_HAEIN      ------
DEGU_BREBE      ------
DEGU_BACSU      ------
FIMZ_SALTY      ------
NREC_STACT      ------
NREC_STAES      ------
NREC_STAEQ      ------
YFIK_BACSU      VS----
NREC_STAAW      ------
NREC_STAAT      ------
NREC_STAAS      ------
NREC_STAAN      ------
NREC_STAAM      ------
NREC_STAAE      ------
NREC_STAAC      ------
NREC_STAA9      ------
NREC_STAA8      ------
NREC_STAA3      ------
NREC_STAA2      ------
NREC_STAA1      ------
YDFI_BACSU      ------
NREC_STAAR      ------
NREC_STAAB      ------
TRPO_PSEAE      ------
FIMZ_ECOLI      ------
FIMZ_ECO57      ------
YXJL_BACSU      ------
VRAR_STAES      ------
VRAR_STAEQ      ------
NODW_BRAJA      ISA---
NREC_STAHJ      ------
YHCZ_BACSU      LNGEIS
BVGA_BORPE      NLA---
BVGA_BORPA      NLA---
BVGA_BORBR      NLA---
VRAR_STAHJ      ------
FIXJ_AZOC5      ------
VRAR_STAAW      ------
VRAR_STAAS      ------
VRAR_STAAR      ------
VRAR_STAAN      ------
VRAR_STAAM      ------
VRAR_STAAC      ------
VRAR_STAA1      ------
NARL_SHIFL      ------
NARL_ECOLI      ------
NARL_ECOL6      ------
NARL_ECO57      ------
YHJB_ECOLI      ------
VRAR_STAS1      ------
UHPA_SALTY      ------
DESR_BACSU      ------
YCF29_CYAPA     ------
LIAR_BACSU      ------
UHPA_SHIFL      ------
UHPA_ECOLI      ------
UHPA_ECOL6      ------
UHPA_ECO57      ------
RCSB_SALTI      LS----
FIXJ_BRAJA      ------
RCSB_SHIFL      LS----
RCSB_SALTY      LS----
RCSB_ECOLI      LS----
RCSB_ECOL6      LS----
RCSB_ECO57      LS----
UVRY_SHIFL      ------
UVRY_ECOLI      ------
UVRY_ECOL6      ------
UVRY_ECO57      ------
YVFU_BACSU      ------
GACA_PSEAE      ------
YCF29_PORPU     ------
MALT_VIBPA      ------
MALT_VIBHB      ------
MALT_VIBCH      ------
GACA_PSEU2      ------
YCF29_PORYE     ------
MALT_VIBVY      ------
MALT_VIBVU      ------
MALT_YERPY      ------
MALT_YERPS      ------
MALT_YERPP      ------
MALT_YERPE      ------
MALT_YERPB      ------
MALT_YERPA      ------
MALT_YERP3      ------
FIXJ_RHIME      ------
CMPA_BACSU      ------
MALT_SALTY      ------
MALT_SALTI      ------
MALT_SALSV      ------
MALT_SALPK      ------
MALT_SALPB      ------
MALT_SALPA      ------
MALT_SALNS      ------
MALT_SALHS      ------
MALT_SALG2      ------
MALT_SALEP      ------
MALT_SALDC      ------
MALT_SALCH      ------
MALT_SALAR      ------
MALT_SALA4      ------
MALT_CITK8      ------
MALT_KLEP7      ------
MALT_KLEP3      ------
MALT_YERE8      ------
MALT_ESCF3      ------
MALT_ECOLI      ------
MALT_ECOLC      ------
MALT_ECOHS      ------
MALT_ECODH      ------
MALT_ECOBW      ------
MALT_SERP5      ------
MALT_ENTS8      ------
MALT_ENT38      ------
GERE_BACSU      ------
Y890_MYCTU      ------
ALKS_PSEOL      ------
Y914_MYCBO      ------
MOAR_KLEAE      ------
MALT_PHOLL      ------
YGEK_ECOLI      ------
YGEK_ECO57      ------
SGAR_HYPME      ------
MALT_SHIF8      ------
MALT_SHIBS      ------
MALT_ECOUT      ------
MALT_ECOSM      ------
MALT_ECOSE      ------
MALT_ECOLU      ------
MALT_ECOL6      ------
MALT_ECOL5      ------
MALT_ECOK1      ------
MALT_ECO8A      ------
MALT_ECO81      ------
MALT_ECO7I      ------
MALT_ECO5E      ------
MALT_ECO57      ------
MALT_ECO55      ------
MALT_ECO45      ------
MALT_ECO27      ------
MALT_ECO24      ------
DCTR_RHOCA      ------
EVGA_SHIFL      ------
EVGA_ECOLI      ------
EVGA_ECOL6      ------
EVGA_ECO57      ------
SP0F_BACSU      ------
MOXX_PARDE      ------
MALT_SHISS      ------
MALR_BACSU      ------
CSGD_SALTY      ------
CSGD_ECOLI      ------
YKOG_BACSU      ------
NTRC_SALTY      ------
GACA_PSEVI      ------
GACA_PSEFL      ------
SOLR1_RALSO     ------
SOLR2_RALSO     ------
CARR_PECCC      ------
ARR4_ARATH      ------
REGX3_MYCTU     ------
REGX3_MYCS2     ------
REGX3_MYCBO     ------
YCF29_GUITH     ------
BCER_BACHD      ------
YCF27_PORAE     ------
CHEB1_DECAR     ------
NTRC_KLEPN      ------
ARR3_ARATH      ------
SP0F_BACTK      ------
REGX3_MYCLE     ------
NTRC_ECOLI      ------
NTRC_ECO57      ------
CHEB2_GEOMG     ------
RCSC_SALTI      ------
CHEB_TREDE      ------
CHEB3_GEOSL     ------
Y851_SYNP2      ------
SPHR_SYNE7      ------
RCSC_SALTY      ------
RCSC_ECOLI      ------
ARR21_ARATH     ------
CHEB_THIDA      ------
RSSB_SERMA      ------
OMPR_SHIFL      ------
OMPR_SALTY      ------
OMPR_SALTI      ------
OMPR_ECOLI      ------
OMPR_ECOL6      ------
OMPR_ECO57      ------
BGLJ_ECOLI      ------
YCF27_GALSU     ------
PHOP_BACSU      ------