[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for atum0:AAK86335.1

[Show Plain Result]


## Summary of Sequence Search
    1::181
    1::181     e-103 100%  181 aa  CHED_AGRT5 RecName: Full=Probable chemoreceptor glutamine deamidase
    2::184     6e-88  84%  184 aa  CHED_AGRRK RecName: Full=Probable chemoreceptor glutamine deamidase
    2::184     2e-86  82%  184 aa  CHED_RHILW RecName: Full=Probable chemoreceptor glutamine deamidase
    4::184     4e-84  81%  184 aa  CHED_RHIE6 RecName: Full=Probable chemoreceptor glutamine deamidase
    2::184     9e-84  80%  184 aa  CHED_RHIEC RecName: Full=Probable chemoreceptor glutamine deamidase
    4::184     3e-83  80%  184 aa  CHED_RHIL3 RecName: Full=Probable chemoreceptor glutamine deamidase
    2::184     1e-79  75%  184 aa  CHED_RHISN RecName: Full=Probable chemoreceptor glutamine deamidase
    4::183     2e-75  74%  183 aa  CHED_RHIME RecName: Full=Probable chemoreceptor glutamine deamidase
    4::183     4e-71  71%  183 aa  CHED_SINMW RecName: Full=Probable chemoreceptor glutamine deamidase
   13::188     1e-57  62%  188 aa  CHED_CAUSK RecName: Full=Probable chemoreceptor glutamine deamidase
   12::187     5e-55  57%  187 aa  CHED_CAUCR RecName: Full=Probable chemoreceptor glutamine deamidase
   12::187     5e-55  57%  187 aa  CHED_CAUCN RecName: Full=Probable chemoreceptor glutamine deamidase
   11::150     2e-41  56%  187 aa  CHED1_SILST RecName: Full=Probable chemoreceptor glutamine
   12::190     1e-40  50%  190 aa  CHED_ACICJ RecName: Full=Probable chemoreceptor glutamine deamidase
   10::162     6e-40  50%  199 aa  CHED_RHOS5 RecName: Full=Probable chemoreceptor glutamine deamidase
   17::183     2e-39  49%  199 aa  CHED_RHOS4 RecName: Full=Probable chemoreceptor glutamine deamidase
   17::183     5e-39  48%  199 aa  CHED_RHOSH RecName: Full=Probable chemoreceptor glutamine deamidase
   17::183     1e-38  47%  199 aa  CHED_RHOS1 RecName: Full=Probable chemoreceptor glutamine deamidase
   16::191     2e-38  46%  191 aa  CHED_THICR RecName: Full=Probable chemoreceptor glutamine deamidase
   23::163     3e-37  51%  223 aa  CHED_BORPD RecName: Full=Probable chemoreceptor glutamine deamidase
   23::163     1e-36  52%  226 aa  CHED_BORA1 RecName: Full=Probable chemoreceptor glutamine deamidase
   25::187     2e-36  48%  217 aa  CHED_RALEJ RecName: Full=Probable chemoreceptor glutamine deamidase
   36::213     4e-36  43%  213 aa  CHED_RHOP5 RecName: Full=Probable chemoreceptor glutamine deamidase
   23::163     9e-36  52%  215 aa  CHED_BORPE RecName: Full=Probable chemoreceptor glutamine deamidase
   23::163     9e-36  52%  212 aa  CHED_BORPA RecName: Full=Probable chemoreceptor glutamine deamidase
   23::163     9e-36  52%  226 aa  CHED_BORBR RecName: Full=Probable chemoreceptor glutamine deamidase
    9::178     1e-35  47%  178 aa  CHED_ZYMMO RecName: Full=Probable chemoreceptor glutamine deamidase
   27::210     1e-35  44%  220 aa  CHED_RALME RecName: Full=Probable chemoreceptor glutamine deamidase
   26::203     3e-35  44%  203 aa  CHED_METFK RecName: Full=Probable chemoreceptor glutamine deamidase
   26::200     2e-34  46%  201 aa  CHED1_DECAR RecName: Full=Probable chemoreceptor glutamine
   44::197     1e-33  51%  198 aa  CHED_XANC5 RecName: Full=Probable chemoreceptor glutamine deamidase
   44::197     1e-33  51%  198 aa  CHED_XANAC RecName: Full=Probable chemoreceptor glutamine deamidase
   38::216     2e-33  44%  216 aa  CHED_HALHL RecName: Full=Probable chemoreceptor glutamine deamidase
   22::159     2e-33  46%  178 aa  CHED1_GEOMG RecName: Full=Probable chemoreceptor glutamine
   26::165     3e-33  54%  203 aa  CHED_JANMA RecName: Full=Probable chemoreceptor glutamine deamidase
   44::197     4e-33  49%  198 aa  CHED_XANOR RecName: Full=Probable chemoreceptor glutamine deamidase
   44::197     4e-33  49%  198 aa  CHED_XANOM RecName: Full=Probable chemoreceptor glutamine deamidase
   60::215     4e-33  49%  234 aa  CHED1_RHOFD RecName: Full=Probable chemoreceptor glutamine
   44::197     5e-33  51%  198 aa  CHED_STRMK RecName: Full=Probable chemoreceptor glutamine deamidase
   44::197     5e-33  51%  198 aa  CHED_STRM5 RecName: Full=Probable chemoreceptor glutamine deamidase
   26::164     9e-33  51%  203 aa  CHED_HERAR RecName: Full=Probable chemoreceptor glutamine deamidase
   53::195     2e-32  47%  236 aa  CHED_RALPJ RecName: Full=Probable chemoreceptor glutamine deamidase
   21::163     2e-32  49%  246 aa  CHED_BURVG RecName: Full=Probable chemoreceptor glutamine deamidase
   50::192     2e-32  46%  233 aa  CHED_RALSO RecName: Full=Probable chemoreceptor glutamine deamidase
   44::160     3e-32  58%  198 aa  CHED_XANCP RecName: Full=Probable chemoreceptor glutamine deamidase
   44::160     3e-32  58%  198 aa  CHED_XANCB RecName: Full=Probable chemoreceptor glutamine deamidase
   44::160     3e-32  58%  198 aa  CHED_XANC8 RecName: Full=Probable chemoreceptor glutamine deamidase
   22::163     4e-32  47%  250 aa  CHED_BURXL RecName: Full=Probable chemoreceptor glutamine deamidase
   26::165     8e-32  50%  202 aa  CHED_THIDA RecName: Full=Probable chemoreceptor glutamine deamidase
   36::211     8e-32  41%  211 aa  CHED_HAHCH RecName: Full=Probable chemoreceptor glutamine deamidase
   45::218     4e-31  42%  218 aa  CHED_SACD2 RecName: Full=Probable chemoreceptor glutamine deamidase
   21::163     4e-31  48%  247 aa  CHED_BURCC RecName: Full=Probable chemoreceptor glutamine deamidase
   21::163     4e-31  48%  247 aa  CHED_BURCA RecName: Full=Probable chemoreceptor glutamine deamidase
   28::206     5e-31  44%  208 aa  CHED1_SHEON RecName: Full=Probable chemoreceptor glutamine
   21::163     2e-30  46%  241 aa  CHED_BURS3 RecName: Full=Probable chemoreceptor glutamine deamidase
   30::169     3e-30  47%  206 aa  CHED_LARHH RecName: Full=Probable chemoreceptor glutamine deamidase
   13::150     3e-30  43%  175 aa  CHED_JANSC RecName: Full=Probable chemoreceptor glutamine deamidase
   10::195     3e-30  41%  195 aa  CHED2_BURTA RecName: Full=Probable chemoreceptor glutamine
   21::163     1e-29  46%  234 aa  CHED1_BURTA RecName: Full=Probable chemoreceptor glutamine
   31::172     2e-29  52%  220 aa  CHED1_GEOSL RecName: Full=Probable chemoreceptor glutamine
   21::163     4e-29  45%  234 aa  CHED_BURPS RecName: Full=Probable chemoreceptor glutamine deamidase
   21::163     4e-29  45%  234 aa  CHED_BURP1 RecName: Full=Probable chemoreceptor glutamine deamidase
   21::163     4e-29  45%  234 aa  CHED_BURP0 RecName: Full=Probable chemoreceptor glutamine deamidase
   21::163     4e-29  45%  234 aa  CHED_BURMS RecName: Full=Probable chemoreceptor glutamine deamidase
   21::163     4e-29  45%  234 aa  CHED_BURMA RecName: Full=Probable chemoreceptor glutamine deamidase
   21::163     4e-29  45%  234 aa  CHED_BURM9 RecName: Full=Probable chemoreceptor glutamine deamidase
   21::163     4e-29  45%  234 aa  CHED_BURM7 RecName: Full=Probable chemoreceptor glutamine deamidase
   21::179     2e-28  40%  201 aa  CHED_NITEU RecName: Full=Probable chemoreceptor glutamine deamidase
   40::177     3e-28  47%  214 aa  CHED_VIBVU RecName: Full=Probable chemoreceptor glutamine deamidase
   40::196     1e-27  43%  214 aa  CHED_VIBVY RecName: Full=Probable chemoreceptor glutamine deamidase
   21::161     2e-27  44%  194 aa  CHED_NITEC RecName: Full=Probable chemoreceptor glutamine deamidase
   11::197     4e-26  39%  197 aa  CHED2_DECAR RecName: Full=Probable chemoreceptor glutamine
   22::162     1e-25  43%  201 aa  CHED2_CHRVO RecName: Full=Probable chemoreceptor glutamine
   50::196     4e-25  43%  233 aa  CHED_VIBCM RecName: Full=Probable chemoreceptor glutamine deamidase
   50::196     4e-25  43%  233 aa  CHED_VIBCH RecName: Full=Probable chemoreceptor glutamine deamidase
   50::196     4e-25  43%  233 aa  CHED_VIBC3 RecName: Full=Probable chemoreceptor glutamine deamidase
    8::150     5e-25  40%  157 aa  CHED_THEMA RecName: Full=Chemoreceptor glutamine deamidase cheD;   
    9::152     2e-24  48%  199 aa  CHED2_SHEON RecName: Full=Probable chemoreceptor glutamine
    5::141     5e-23  37%  160 aa  CHED_DESHY RecName: Full=Probable chemoreceptor glutamine deamidase
    5::141     5e-23  37%  160 aa  CHED_DESHD RecName: Full=Probable chemoreceptor glutamine deamidase
    3::149     1e-22  37%  162 aa  CHED_THETN RecName: Full=Probable chemoreceptor glutamine deamidase
    2::159     2e-22  40%  162 aa  CHED2_GEOMG RecName: Full=Probable chemoreceptor glutamine
   11::159     2e-22  43%  162 aa  CHED3_GEOSL RecName: Full=Probable chemoreceptor glutamine
   27::166     2e-21  39%  171 aa  CHED1_ANADE RecName: Full=Probable chemoreceptor glutamine
   28::142     1e-20  48%  161 aa  CHED_GEOLS RecName: Full=Probable chemoreceptor glutamine deamidase
   23::156     2e-20  40%  176 aa  CHED_RHORT RecName: Full=Probable chemoreceptor glutamine deamidase
    8::160     5e-20  38%  161 aa  CHED_PYRKO RecName: Full=Probable chemoreceptor glutamine deamidase
   14::153     1e-19  30%  173 aa  CHED_HALMA RecName: Full=Probable chemoreceptor glutamine deamidase
   10::144     3e-19  38%  157 aa  CHED_ARCFU RecName: Full=Probable chemoreceptor glutamine deamidase
    2::147     1e-18  33%  161 aa  CHED_SYNWW RecName: Full=Probable chemoreceptor glutamine deamidase
   28::149     5e-18  39%  163 aa  CHED_BORAP RecName: Full=Probable chemoreceptor glutamine deamidase
   22::148     6e-18  37%  166 aa  CHED_METHJ RecName: Full=Probable chemoreceptor glutamine deamidase
   75::206     1e-17  38%  220 aa  CHED2_METAC RecName: Full=Probable chemoreceptor glutamine
   75::206     1e-17  37%  221 aa  CHED1_METMA RecName: Full=Probable chemoreceptor glutamine
    1::145     2e-17  39%  156 aa  CHED_SULDN RecName: Full=Probable chemoreceptor glutamine deamidase
   28::147     2e-17  39%  163 aa  CHED_BORGA RecName: Full=Probable chemoreceptor glutamine deamidase
   28::147     3e-17  39%  163 aa  CHED_BORBZ RecName: Full=Probable chemoreceptor glutamine deamidase
   28::147     3e-17  39%  163 aa  CHED_BORBU RecName: Full=Probable chemoreceptor glutamine deamidase
    5::149     5e-17  35%  162 aa  CHED_BACHD RecName: Full=Chemoreceptor glutamine deamidase cheD;   
    2::153     7e-17  35%  162 aa  CHED_PYRHO RecName: Full=Probable chemoreceptor glutamine deamidase
   16::147     9e-17  38%  163 aa  CHED_BORT9 RecName: Full=Probable chemoreceptor glutamine deamidase
    2::151     1e-16  38%  165 aa  CHED_GEOKA RecName: Full=Probable chemoreceptor glutamine deamidase
   15::151     2e-16  35%  166 aa  CHED_OCEIH RecName: Full=Probable chemoreceptor glutamine deamidase
    8::134     8e-16  38%  154 aa  CHED_METVS RecName: Full=Probable chemoreceptor glutamine deamidase
    1::153     8e-16  36%  168 aa  CHED_BACLD RecName: Full=Chemoreceptor glutamine deamidase cheD;   
    5::146     1e-15  35%  161 aa  CHED_CLOPH RecName: Full=Probable chemoreceptor glutamine deamidase
    8::134     1e-15  37%  154 aa  CHED_METMP RecName: Full=Probable chemoreceptor glutamine deamidase
    1::153     1e-15  35%  166 aa  CHED_DESRM RecName: Full=Probable chemoreceptor glutamine deamidase
    8::134     4e-15  37%  154 aa  CHED_METM7 RecName: Full=Probable chemoreceptor glutamine deamidase
    8::134     6e-15  35%  154 aa  CHED_METM6 RecName: Full=Probable chemoreceptor glutamine deamidase
   15::157     8e-15  36%  173 aa  CHED2_RHOFD RecName: Full=Probable chemoreceptor glutamine
   10::162     3e-14  33%  163 aa  CHED_PYRAB RecName: Full=Probable chemoreceptor glutamine deamidase
   12::143     3e-14  31%  162 aa  CHED_CLONN RecName: Full=Probable chemoreceptor glutamine deamidase
    4::149     3e-14  29%  162 aa  CHED_CLOBM RecName: Full=Probable chemoreceptor glutamine deamidase
    4::149     3e-14  29%  162 aa  CHED_CLOBL RecName: Full=Probable chemoreceptor glutamine deamidase
    4::149     3e-14  29%  162 aa  CHED_CLOBK RecName: Full=Probable chemoreceptor glutamine deamidase
    4::149     3e-14  29%  162 aa  CHED_CLOBJ RecName: Full=Probable chemoreceptor glutamine deamidase
    4::149     3e-14  29%  162 aa  CHED_CLOBH RecName: Full=Probable chemoreceptor glutamine deamidase
    4::149     3e-14  29%  162 aa  CHED_CLOB6 RecName: Full=Probable chemoreceptor glutamine deamidase
    4::149     3e-14  29%  162 aa  CHED_CLOB1 RecName: Full=Probable chemoreceptor glutamine deamidase
    5::151     4e-14  34%  166 aa  CHED_BACSU RecName: Full=Chemoreceptor glutamine deamidase cheD;   
   10::140     5e-14  39%  159 aa  CHED_BACSK RecName: Full=Chemoreceptor glutamine deamidase cheD;   
   12::145     5e-14  33%  159 aa  CHED1_METAC RecName: Full=Probable chemoreceptor glutamine
    8::134     7e-14  37%  154 aa  CHED_METM5 RecName: Full=Probable chemoreceptor glutamine deamidase
    4::130     9e-14  35%  151 aa  CHED_METBF RecName: Full=Probable chemoreceptor glutamine deamidase
   12::145     9e-14  31%  159 aa  CHED2_METMA RecName: Full=Probable chemoreceptor glutamine
    9::136     1e-13  32%  159 aa  CHED_CARHZ RecName: Full=Probable chemoreceptor glutamine deamidase
    4::143     2e-13  29%  162 aa  CHED_CLOK5 RecName: Full=Probable chemoreceptor glutamine deamidase
   16::167     2e-13  31%  183 aa  CHED2_LEPIN RecName: Full=Probable chemoreceptor glutamine
   16::167     2e-13  31%  183 aa  CHED2_LEPIC RecName: Full=Probable chemoreceptor glutamine
   18::142     1e-12  33%  172 aa  CHED2_SYNAS RecName: Full=Probable chemoreceptor glutamine
    9::158     3e-12  34%  170 aa  CHED_DESAD RecName: Full=Probable chemoreceptor glutamine deamidase
   12::149     3e-12  33%  162 aa  CHED_CLOBB RecName: Full=Probable chemoreceptor glutamine deamidase
    8::166     4e-12  28%  166 aa  CHED_CLOAB RecName: Full=Probable chemoreceptor glutamine deamidase
    4::142     9e-12  30%  165 aa  CHED_CLOTE RecName: Full=Probable chemoreceptor glutamine deamidase
   12::149     1e-11  33%  162 aa  CHED_CLOBA RecName: Full=Probable chemoreceptor glutamine deamidase
    5::151     2e-11  34%  166 aa  CHED_BACA2 RecName: Full=Chemoreceptor glutamine deamidase cheD;   
   41::192     3e-11  33%  193 aa  CHED1_CHRVO RecName: Full=Probable chemoreceptor glutamine
    1::153     3e-11  29%  167 aa  CHED_MOOTA RecName: Full=Probable chemoreceptor glutamine deamidase
    1::151     3e-11  32%  170 aa  CHED3_DECAR RecName: Full=Probable chemoreceptor glutamine
   26::164     6e-11  31%  177 aa  CHED_PSEU2 RecName: Full=Probable chemoreceptor glutamine deamidase
   26::164     6e-11  31%  177 aa  CHED_PSE14 RecName: Full=Probable chemoreceptor glutamine deamidase
   35::178     7e-11  30%  201 aa  CHED_PELLD RecName: Full=Probable chemoreceptor glutamine deamidase
    3::151     7e-11  30%  165 aa  CHED_GEOTN RecName: Full=Probable chemoreceptor glutamine deamidase
   11::165     3e-10  25%  167 aa  CHED_NATPD RecName: Full=Probable chemoreceptor glutamine deamidase
   19::147     3e-10  27%  160 aa  CHED1_SYNAS RecName: Full=Probable chemoreceptor glutamine
    9::147     6e-10  30%  159 aa  CHED2_ANADE RecName: Full=Probable chemoreceptor glutamine
   44::174     1e-09  33%  199 aa  CHED_DESVH RecName: Full=Probable chemoreceptor glutamine deamidase
   20::147     2e-09  32%  169 aa  CHED_SOLUE RecName: Full=Probable chemoreceptor glutamine deamidase
   26::192     5e-09  27%  212 aa  CHED_DESDG RecName: Full=Probable chemoreceptor glutamine deamidase
    9::141     2e-08  32%  162 aa  CHED_PELCD RecName: Full=Probable chemoreceptor glutamine deamidase
   11::157     2e-08  28%  160 aa  CHED2_GEOSL RecName: Full=Probable chemoreceptor glutamine
   26::109     3e-08  33%  168 aa  CHED_PSESM RecName: Full=Probable chemoreceptor glutamine deamidase
   26::98      4e-07  36%  177 aa  CHED_PSEFS RecName: Full=Probable chemoreceptor glutamine
   12::152     4e-06  29%  165 aa  CHED_SYMTH RecName: Full=Probable chemoreceptor glutamine deamidase
   24::151     5e-06  30%  166 aa  CHED1_LEPIN RecName: Full=Probable chemoreceptor glutamine
   24::151     5e-06  30%  166 aa  CHED1_LEPIC RecName: Full=Probable chemoreceptor glutamine
   14::139     1e-05  26%  156 aa  CHED_BDEBA RecName: Full=Probable chemoreceptor glutamine deamidase
    1::139     2e-04  36%  179 aa  CHED2_SILST RecName: Full=Probable chemoreceptor glutamine
    1::181

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MMEAAAKRVHIIQGEYKVVSDPDVVMTTILGSCVAACLRDPVAGLGGMNHFLLPGTGNVTGGDATRYGVH
CHED_AGRT5      MMEAAAKRVHIIQGEYKVVSDPDVVMTTILGSCVAACLRDPVAGLGGMNHFLLPGTGNVTGGDATRYGVH
CHED_AGRRK      ILEATARRVHIIQGEYKVIGDPEVVLATILGSCVAACLRDPVAGVGGMNHFLLPGMASTSGGDATRYGVH
CHED_RHILW      MTEGAARRVHIIQGEYKVLSDPNAVLSTILGSCVAACLRDPVAGIGGMNHFLLPGTSPTSGGDATRYGVH
CHED_RHIE6      --EGAARRVHIIQGEYKVLSDPNAVLSTILGSCVAACLRDPVAGIGGMNHFLLPGTSPTSGGDATRYGVH
CHED_RHIEC      IVEGAARRVHIIQGEYKVLSDPNAVLSTILGSCVAACLRDPVAGVGGMNHFLLPGTSPASGGDATRYGVH
CHED_RHIL3      --EGAARRVHIIQGEYKVLNDPNAVLSTILGSCVAACLRDPVAGVGGMNHFLLPGTSPTSGGDATRYGVH
CHED_RHISN      MLEAAGRRVHVIQGEFKVVNDPDVVLSTILGSCVAACMRDPVSGVGGMNHFLLPGTSPASAGDATRYGVH
CHED_RHIME      --EAAGRRVHVIQGEFKVVNDPDIVLSTILGSCVAACMRDPAAGVGGMNHFLLPGTSPSSGADATRYGVH
CHED_SINMW      --EAAGKRVHVIQGEFKVVNDPHIVLSTILGSCVAACLRDPVTGVGGMNHFXXXXXXXXXXXDATRYGVH
CHED_CAUSK      -----AIKVHVTQGESHVSADPQVVMTTVLGSCIAACLRDPTTGIGGMNHFLLPDSGDKDGGDAVRYGAY
CHED_CAUCR      -----AVKVHVTQGESHVTADPNVVMTTVLGSCIAACIRDPQSGVGGMNHFLLPDSGDGRDGDAVRYGAY
CHED_CAUCN      -----AVKVHVTQGESHVTADPNVVMTTVLGSCIAACIRDPQSGVGGMNHFLLPDSGDGRDGDAVRYGAY
CHED1_SILST     --------VTVLQGDYKVTTDPKVVFSTVLGSCIAACIYDEQVGVGGMNHFLLXXXXXXXXXXX-RYGVH
CHED_ACICJ      -----ARRINIVQGEHRVEHDPEAVLCTILGSCVAACLWDPGASVGGMNHFLLPXXXXXXXXXXXXXXXX
CHED_RHOS5      --DVAVQTIHVMQGAYVASDDPNIVYTTILGSCVCTCMCDPIARVGGINHFLLPYAG-VTKVENLRYGYH
CHED_RHOS4      ---------HVTQGSCVASSSPNEVYATILGSCICTCMCDPVAGVGGMNHFLLP-SADVEDAQHLRYGSH
CHED_RHOSH      ---------HVTQGSCVASSSPNEVYATILGSCICTCMCDPVAGVGGMNHFLLP-SADVEDAQHLRYGSH
CHED_RHOS1      ---------HVTQGSCVASASPNEVYATILGSCICTCMCDPVAGVGGMNHFLLP-SADVEDAQHLRYGSH
CHED_THICR      ----------ILPGEFYVTKDNERI-ETVLGSCISACVRDPVTGVGGMNHFMLPVDKNATGADANRYGNY
CHED_BORPD      --------VKVLPNEYYVAAGEDIMISTVLGSCVAACIRDPRAGVGGMNHFMLPGDGDSPSSATMRYGAF
CHED_BORA1      --------VKILPNEYFVTKGEDLMLSTVLGSCVAACLRDPLTGIGGMNHFMLPDGDAQSPASATRYGAF
CHED_RALEJ      --------IKLLPNEYYVTGE-DVVLTTVLGSCVAACIRDEKAGVGGMNHFMLPGTADRMLSASMRYGCY
CHED_RHOP5      --------VKVFPGEHYVTSNPDEMLVTILGSCVAACIRDPLAKVGGMNHFMLPGSGWDTASDSMRYGNV
CHED_BORPE      --------VKILPNEYYVTNGEDVMLSTVLGSCVAACIHDPVIGVGGMNHFMLPEGDIHSPASATRYGAF
CHED_BORPA      --------VKILPNEYYVTNGEDVMLSTVLGSCVAACIHDPVIGVGGMNHFMLPEGDIHSPASATRYGAF
CHED_BORBR      --------VKILPNEYYVTNGEDVMLSTVLGSCVAACIHDPVIGVGGMNHFMLPEGDIHSPASATRYGAF
CHED_ZYMMO      ------KRIDVMQGEKQVSSEDDVVFSTVLGSCIAACLYDPIAKIGGMNHFLLPSGSDHDPNSLKRYGVY
CHED_RALME      --------IKLLPNEYYVTAE-DVVLTTVLGSCVSACIRDEVAGVGGMNHFMLPDDEN-AGADSMRYGCY
CHED_METFK      ----------ILPGEY-YTTNQDIVIVTVLGSCVSACIRDKVSGIGGMNHFMLPADANNPVSESARYGTY
CHED1_DECAR     ----------ILPGEY-YVANQEALLVTVLGSCVAACIRDADSGIGGMNHFMLPDDGGRDKGMSARYGTY
CHED_XANC5      ------------------------------GSCVAACLRDPVLKIGGMNHFLLP-KGQVGDGAPTRYGSY
CHED_XANAC      ------------------------------GSCVAACLRDPVLKIGGMNHFLLP-EGQVGDGAPTRYGSY
CHED_HALHL      ----------ILPGEFYVTRGNEMIVTT-LGSCVSACVRDRRLGVGGMNHFMLPGDPNHWEGDATRYGNH
CHED1_GEOMG     --------VKILPGEYHA-TDSDTMIVTVLGSCVSVCIRDRLSGIGGMNHYMLPGEAGTDESPSPRYGTH
CHED_JANMA      ----------ILPGEY-YYTGKDMLIVTVLGSCVSACIRDRVTGVGGMNHFMLPDGG----GDAARYGTY
CHED_XANOR      ------------------------------GSCVAACLRDPVLKIGGMNHFLLP-EGQIGDGAPARYGSY
CHED_XANOM      ------------------------------GSCVAACLRDPVLKIGGMNHFLLP-EGQIGDGAPARYGSY
CHED1_RHOFD     --------VKVLPGEY-FVSAEDLVIMTVLGSCISACIWDGRVRAGGMNHFMLPDGDSVDGFG--RYGSY
CHED_STRMK      ------------------------------GSCVAACLRDPVLKIGGMNHFLLP-EGNAGDGAPARYGSY
CHED_STRM5      ------------------------------GSCVAACLRDPVLKIGGMNHFLLP-EGNAGDGAPARYGSY
CHED_HERAR      ----------ILPGEY-YYTGKDMLIVTVLGSCVSACIRDRVTGVGGMNHFMLPDSGDSPVSASARYGTY
CHED_RALPJ      ------RAMKVLPGEYSVTTE-DLMLVTVLGSCVSACVRDKTLGIGGMNHFMLPNEGESILSPSMRYGTH
CHED_BURVG      --------VKLLPNEFYTTSE-DIVLMTVLGSCVAACLHDPVSGIGGMNHFMLPXXXXXXXSESMRYGAY
CHED_RALSO      ------RAMKVLPGEYYVTTE-DLMLVTVLGSCVSACVRDKLLGIGGMNHFMLPSRNESESSPSMRYGTH
CHED_XANCP      ------------------------------GSCVAACLRDPVLKIGGMNHFLLP-EGQVGDGAPARYGSY
CHED_XANCB      ------------------------------GSCVAACLRDPVLKIGGMNHFLLP-EGQVGDGAPARYGSY
CHED_XANC8      ------------------------------GSCVAACLRDPVLKIGGMNHFLLP-EGQVGDGAPARYGSY
CHED_BURXL      --------VKLLPNEFYTTSE-DMVLVTVLGSCVAACIQDRTAGIGGMNHFMLPDDGADVGSDSMRYGAY
CHED_THIDA      ----------ILPGEYYFTAKP-MLIVTVLGSCVAACIRDRVSGIGGMNHFMLXXXXXXXXNPLSRYGAY
CHED_HAHCH      ----------IMPGEYYVTNQQELI-GTVLGSCISACVRDPASGIGGMNHFMLPQ--NAGGGDAFRYGNY
CHED_SACD2      ------------------VTKNDEMLVTVLGSCIAACIRDPVAGVGGMNHFMLPETRNSLSNPELCYGNW
CHED_BURCC      --------VKLLPNEFYTTAE-DMVLMTVLGSCVAACLHDPYAGIGGMNHFMLXXXXXXXXSESMRYGAY
CHED_BURCA      --------VKLLPNEFYTTAE-DMVLMTVLGSCVAACLHDPYAGIGGMNHFMLXXXXXXXXSESMRYGAY
CHED1_SHEON     --------VKILPGEYFATRE-NTMIVTVLGSCVAVCLYDPVLKIGGMNHFLLP-NDNVTATESARYGVF
CHED_BURS3      --------VKLLPNEFYTTSE-DMVLMTVLGSCVAACLHDPYAGIGGMNHFMLXXXXXXXXSESMRYGAY
CHED_LARHH      ----------VLPGEY-VATNRDMLLVTVLGSCVSCCLRDSAANVSGLNHFMLPDALMDSEAAATRYGMH
CHED_JANSC      ---------HVMQGQLYISQTPGESLTCILGSCVAACVHDPALRIGGMNHFLLPGRDPHDTG-SVRYGAR
CHED2_BURTA     --EFGRQAVRVNPGGFAIAS-ADVMLATVLGSCVSVCMFDSAARVGGMNHFMLPGSGNGARNDSSLYGVN
CHED1_BURTA     --------VKLLPNEFYTTRE-DMVLVTVLGSCVAACLHDPIARIGGMNHFMLXXXXXXXXXESMRYGAY
CHED1_GEOSL     --------IRIAPGEYHVTTGGGVI-STLLGSCVAACLFDSESGVAGMNHFLLSNTMPFCFTEAGRYGIH
CHED_BURPS      --------VKLLPNEFYTTRE-DMVLVTVLGSCVAACLHDPIGRIGGMNHFMLXXXXXXXXXESMRYGAY
CHED_BURP1      --------VKLLPNEFYTTRE-DMVLVTVLGSCVAACLHDPIGRIGGMNHFMLXXXXXXXXXESMRYGAY
CHED_BURP0      --------VKLLPNEFYTTRE-DMVLVTVLGSCVAACLHDPIGRIGGMNHFMLXXXXXXXXXESMRYGAY
CHED_BURMS      --------VKLLPNEFYTTRE-DMVLVTVLGSCVAACLHDPIGRIGGMNHFMLXXXXXXXXXESMRYGAY
CHED_BURMA      --------VKLLPNEFYTTRE-DMVLVTVLGSCVAACLHDPIGRIGGMNHFMLXXXXXXXXXESMRYGAY
CHED_BURM9      --------VKLLPNEFYTTRE-DMVLVTVLGSCVAACLHDPIGRIGGMNHFMLXXXXXXXXXESMRYGAY
CHED_BURM7      --------VKLLPNEFYTTRE-DMVLVTVLGSCVAACLHDPIGRIGGMNHFMLXXXXXXXXXESMRYGAY
CHED_NITEU      --------VKLLPGEY-FVTTRNMVLSTVLGSCVSACIYDGQSGVGGMNHFMLPRGEDDQGVECARFGGY
CHED_VIBVU      ------------------VSDQEELICTGLGSCVSACIWDPVKRVGGMNHFLLPFHNHFEESGASRYGSY
CHED_VIBVY      ------------------VSGQEELICTGLGSCVSACIWDPVKRVGGMNHFLLPFHNHFEESGASRYGSY
CHED_NITEC      --------VKLLPGEY-FVTTREMVLSTVLGSCVSACIYDQQSRIGGMNHFMLPSSENSSGFECARFGGY
CHED2_DECAR     -IERLARTIH--PGAWAI--EPERPLATLLGSCVAVCLFDPQARVGGLNHFMLPNRGSNDDVDSLLSGAY
CHED2_CHRVO     --------VKVFPGEFHATNQSRLLVT-LLGSCVAVCLSDRISGVAGMNHFLLP-EGSLAGTSAARFGVN
CHED_VIBCM      --------VKVMPGGVYATSDQEIIHTG-LGSCVSACAWDIEMKVGGMNHFLLPFNNQFESSDSSRYGCY
CHED_VIBCH      --------VKVMPGGVYATSDQEIIHTG-LGSCVSACAWDIEMKVGGMNHFLLPFNNQFESSDSSRYGCY
CHED_VIBC3      --------VKVMPGGVYATSDQEIIHTG-LGSCVSACAWDIEMKVGGMNHFLLPFNNQFESSDSSRYGCY
CHED_THEMA      -------------GEYAVMKNPGVIVTLGLGSCVAVCMRDPVAKVGAMAHVMLPDSGGKTDKPG-KYADT
CHED2_SHEON     --------VMIGPGEHYVTAKNEVIKT-LLGSCVAVCLYDPKAQVIGMNHFLLAADRHFLDSRAGYYGVH
CHED_DESHY      --------ISVGMADLKTTKAPNILMTAGLGSCIGICVHDPIQKVGGMAHIMLPTAGSAPGGNPAKYADT
CHED_DESHD      --------ISVGMADLKTTKAPNILMTAGLGSCIGICVHDPIQKVGGMAHIMLPTAGSAPGGNPAKYADT
CHED_THETN      -----SKILRVGMADAKVTKSPGILTTIGLGSCVGIVLYDPIAKVAGLVHIMLPYSNKISNSNKLKFADT
CHED2_GEOMG     -----SKIISVGISEHKVASDPVVLVTYGLGSCVGIALYDPEVRIGGLAHTLLPAVREVQGAERTKFTCW
CHED3_GEOSL     --------------EFKIASAPTILMTYGLGSCVGIALHDPVALTGGLAHTLLPAP--VRGMDSAKFTCW
CHED1_ANADE     -------QVYLHAGQIAVAAEPTAIVT-VLGSCVAVCLHDPVARVGGMNHFLLP--LHVEREQSARFGTV
CHED_GEOLS      -------------------------ITTVLGSCVAVCLWDQRHGGGGMNHFMLP-LWNGEGLATPKYGSI
CHED_RHORT      ------------------------VISTVLGSCVAVCLIDRHNRAAGMNHFVLP--HNPAGEDSLRYGDV
CHED_PYRKO      -------------GDYAVAKKTGIISTYGLGSCVGITLYDRLNRVGGLLHALLPESARYGGGNPAKYVDT
CHED_HALMA      --QSTPERIKVGIAEYKVTTEPAMLTTSGLGSCIGIAIYDTRNTVAGLVHVMLPSAADIDGGNHAKFADT
CHED_ARCFU      -------------GEFRVAKGA-VLKTIGLGSCVGIALYDPKLRLGGLAHVMLPQSGNGTKRSA-KYADH
CHED_SYNWW      -----SKIIQVGMADFKMATAPDKLITAGLGSCIGICLYDKVIKLGSLTHIMLPSSSQANASNEAKFADT
CHED_BORAP      ------------------------VISTILGSCVAVVLCDESSNLIGMNHYVLVKSDDISPAQRGRYGIY
CHED_METHJ      -------------------STGDTVMTSILGSCIGLVIHDETRKIGGLAHVMLPKSSGKPNERAGKYADT
CHED2_METAC     -------------GEYKI--GKNVLLKVMLGSCIGVILSDVSTGICGIAHVLLPGASN--SGEA-KYAET
CHED1_METMA     -------------GEYKI--GKNVLLKVMLGSCIGVILSDVSTGICGIAHVLLPGASD---RGETKYAET
CHED_SULDN      -MEYEKKYIH--SSQLFVAVRPSVIQT-VLGSCVAVCLYDSKMQISGMNHYLLP-LWNNDGLASPKYGNI
CHED_BORGA      ------------------------VISTILGSCVAVVLCDESNNLIGMNHYVLVRSDDISPDQRGRYGIY
CHED_BORBZ      ------------------------VISTILGSCVAVVLCDESNNLIGMNHYVLVKSDDISPDQRGRYGIY
CHED_BORBU      ------------------------VISTILGSCVAVVLCDESNNLIGMNHYVLVKSDDISPDQRGRYGIY
CHED_BACHD      --------VKVGMADLNVVTPPHTIRTAGLGSCVGVVLYDDVKKVAGMAHIMLPDSGKKQEFNRAKYADT
CHED_PYRHO      ------KEVKVGIGDYAVGKGNGIISTYGLGSCVGITLYDRVTKVGGLLHALLPEAARYHRGNPAKYVDT
CHED_BORT9      ----------IVPGEAFVSNDR--VISTILGSCVSVVLYDGVRRLIGVNHYXXXXXXXXXXXXXXRYGVY
CHED_GEOKA      ---STAQAVKIGIAEMEVVIAPNVIRTCGLGSCVGVVIYDAGKAVAGMAHVMLPHSSMARGGNAAKYADT
CHED_OCEIH      --------------DLKIIQFPQLIRTSGLGSCVGTVIYDDKKEIAGLSHVLLPYSGKQANTNPYKYADT
CHED_METVS      -------------GDIGVGKSPDSI-ETLLGSCVAIILYDRGKKIGGLAHIMLPKSRESDSKSPGKYADT
CHED_BACLD      -MKILEKETSIIRADVKIVRTPDKIRTSGLGSCVGLVLYDLEAKTAGLVHVMLPDSSLSKTPDVAKYADT
CHED_CLOPH      --------IKVGMADMNVCKPPDSITTLGLGSCVGIVLYDPGKKVSGMVHVMLPDSTKIKNNEIAKFADT
CHED_METMP      -------------GDIGVAKSPESI-ETLLGSCVAIILYDRGKKIGGVAHVMLPKSRNSSEKNPGKYANT
CHED_DESRM      -MELAKGNAEIQVGDYKVAASPNRLITLGLGSCVGVVLYDPVKKVGGLLHIMLPDSNNVT--KPAKFADT
CHED_METM7      -------------GDIGVAKSPESI-ETLLGSCVAIILYDRGKKVGGVAHVMLPKSRNTAERTPGKYANT
CHED_METM6      -------------GDIGVAKSPESI-ETLLGSCVAIILYDRGKKVGGVAHVMLPKSRNAAEKNPGKYADT
CHED2_RHOFD     -------------GEY-FVADAGYQIRTMLGSCVSITLWHPATRQGAMSHFLLPTRGASKPKQTARYGDE
CHED_PYRAB      -------------GDYAVGKGEGIISTYGLGSCVGITLYDRVTKVGGLLHALLPEAARYHRGNPAKYVDT
CHED_CLONN      --------------DLNVALPPKKLITVGLGSCIGIALYDSIKKIGGLAHIMLPDSTQFSNSNPMKFADL
CHED_CLOBM      ------KEIKVGIADLNVGKNPDKIITVGLGSCIGIALYDGIKCIGGLSHIMLPDSTQFSKTNPMKFADL
CHED_CLOBL      ------KEIKVGIADLNVGKNPDKIITVGLGSCIGIALYDGIKCIGGLSHIMLPDSTQFSKTNPMKFADL
CHED_CLOBK      ------KEIKVGIADLNVGKNPDKIITVGLGSCIGIALYDGIKCIGGLSHIMLPDSTQFSKTNPMKFADL
CHED_CLOBJ      ------KEIKVGIADLNVGKNPDKIITVGLGSCIGIALYDGIKCIGGLSHIMLPDSTQFSKTNPMKFADL
CHED_CLOBH      ------KEIKVGIADLNVGKNPDKIITVGLGSCIGIALYDGIKCIGGLSHIMLPDSTQFSKTNPMKFADL
CHED_CLOB6      ------KEIKVGIADLNVGKNPDKIITVGLGSCIGIALYDGIKCIGGLSHIMLPDSTQFSKTNPMKFADL
CHED_CLOB1      ------KEIKVGIADLNVGKNPDKIITVGLGSCIGIALYDGIKCIGGLSHIMLPDSTQFSKTNPMKFADL
CHED_BACSU      --EAVVIKVGI--ADVKIARFPDTIRTSGLGSCVGLVLYDKEKQTAGLVHVMLPDSTLSKTAELNRYADT
CHED_BACSK      -------------GEWKVVKGEGVLRTCGLGSCIGIVLYDQERVIAGMVHVMLPSTKARKGANPWRYADT
CHED1_METAC     -------------GDCAIARCPVKIKTSGLGSCVGVTIYDRHEKIGGLLHTMLPNIKKAGIKDPTKFTDA
CHED_METM5      -------------GDIGVGKSPESI-ETLLGSCVAIILYDKGKKIGGLAHVMLPKSRMQKEKNPGKYVDT
CHED_METBF      -------------GACALARSPVKIKTFGLGSCVVITLYDRQERIGGLVHTMLPSISDARIKDKPKYTDS
CHED2_METMA     -------------GDCAIARSPMKIKTSGLGSCLGITLYDRQKKIGGLLHTMLPNIKDAKLKDPAKFTDA
CHED_CARHZ      --------------DYKLGSSPVKIVTYGLGSCVGVSFYEPRLKLGALLHIMLPDSTQFSGKKPEKFADT
CHED_CLOK5      ------KEIKVGIADMNTAGSPHRLITIGLGSCVGIALYDKVKGIGGLAHIMLPDSTQFSNKNPVKFADL
CHED2_LEPIN     MLTKGSKVVNVGIADMQGAQSPEILRTT-LGSCIGVVFYAPDKKIGAMAHFMLSKSGKDSQKNPFKYAET
CHED2_LEPIC     MLTKGSKVVNVGIADMQGAQSPEILRTT-LGSCIGVVFYAPDKKIGAMAHFMLSKSGKDSQKNPFKYAET
CHED2_SYNAS     ---------------YIFMSPEPYLISTVVGSSVAVALWDADSKLGGMLSFLYPFRESSAESTAI-YGNV
CHED_DESAD      ------RRVFLHTGDAYLGVKPTIV-STVLGSCVAISMFSPRKRQGIICHAFLPSRAEIKDVNEPRYVDT
CHED_CLOBB      --------------DLNLVSSPNKIMTIGLGSCIGIALYDRRSKLAGLSHIMLPDSKNVT--NPMKFADL
CHED_CLOAB      ------KEIRVGIADLNTAFSPNRIITVGLGSCIGIAIYDSKNKLGGLSHIMLPDSTQFSKTNPYKFADL
CHED_CLOTE      -MEVKEYRVGI--ADLNVAKSPDRIITVGLGSCIGIALYDRINGVGGLLHIMLPDSTQFKNSNPLKFPDL
CHED_CLOBA      --------------DLNLVSSPGKIMTIGLGSCIGIALYDRRSKLAGLSHIMLPDSKNVT--NPMKFADL
CHED_BACA2      --EAAVVKVGI--ADVQVARYPDKIRTSGLGSCVGLVLYDKDKQTAGLVHVMLPDSGLSKTAELNRYADT
CHED1_CHRVO     --------------------DSQTRIRTLLGSCVSITLWHPQAKVGGMCHYLLPHRGESLSG---RYGDE
CHED_MOOTA      -MEAIIKPQEVKVGEWQVLRAPGRLITLGLGSCVGIALYDSLNRMGGLAHIMLPDSSQFQDSNRAKFXXX
CHED3_DECAR     -MSAAPSELHEVPGEFHF-GESNTRISTLLGSCVSITLWHPRKRIGGMCHYMLPPNAALDG----RFGSE
CHED_PSEU2      -------------------------LRTLLGSCVAITFWHPWRRIGGMCHFMLPGRIRRHQPLDGRYADE
CHED_PSE14      -------------------------LRTLLGSCVAITFWHPWRRIGGMCHFMLPGRIRRHQPLDGRYADE
CHED_PELLD      ---------HIVAGEVTAAGPGRVLISSPLGSCIAVCAYDPGTRVGGLAHVMLPGVPPATGKD--RYAAH
CHED_GEOTN      ----AIETVKVGIAEMKVVVAPTVIRTCGLGSCVGVVIYDSGKALAGMAHVMLPHSSMARGGNEAKYADT
CHED_NATPD      -----SERIKVSIADY-AVAEAGTISTSGLGSCLGLAIYDPEAGVSALVHPMLPRRDGNDDRPPERFVDS
CHED1_SYNAS     ----------------------DILVTYALGSCIAVAIYDPKVKVGGLLHYMLPDSSLDVDKAKTTPGMF
CHED2_ANADE     -------------GDLAVTGDPRAVIVTHLGSCIALVAWDPGLRVGGMLHFQLPASALSPERALDAPGTF
CHED_DESVH      ------------------------LIATVLGSCVSVTFHHPSTETGGIFHAMLPTVLGAADGARTKYVDA
CHED_SOLUE      -----------------------VLATYALGSCIGLSIYDPKAAIGGMLHYMLPSTIDPARGRENPYADT
CHED_DESDG      LADCGLPHVHLKIGE-GIVTRRALLISTVLGSCVSVTFFSRRLQLAGIFHAMLPVITQSYRNEPCRFVDS
CHED_PELCD      -------------GEYGVSKTPSMVKTYALGSCVAVTMYEPNLKIAGMVHVALPESNTAKGEQCPGYFAD
CHED2_GEOSL     --------VYLKPGEFHFATKPTVV-TTVLGSCVSVTMFDVFSRTAAICHALLP---DGPRDDVFRYVDS
CHED_PSESM      -------------------------LRTLLGSCVAITFWHPQQHIGGMCHFMLPHRPHKHKALDGRYGDE
CHED_PSEFS      -------------------------LRTLLGSCVAITFWHPQRLIGGMCHFMLPGRLRKHQPLDGRYADE
CHED_SYMTH      -------------GELKVADRPDQVLVCYLGSCVGLALYDPVVRIGAMVHVVLPDSSMGRGREAPKYADT
CHED1_LEPIN     ----------------------NIRIRTLLGSCVSICFWHPSLLYGGMAHVMLPFRPSSIHSDDSKYAED
CHED1_LEPIC     ----------------------NIRIRTLLGSCVSICFWHPSLLYGGMAHVMLPFRPSSIHSDDSKYAED
CHED_BDEBA      -----------------LIAENGEVLKTVLGSCVGIALVWRRQNKWALAHCLLPYPETFKEDKEARYVSQ
CHED2_SILST     MDKVEVSELHVRIGQVKIGS-PGQVLTAILGSCVGIGFFFPQRQIYGLAHCLLXXTGRTEDGQLVGNGRH


                         .         .         *         .         .         .         .:140
query           LMELLINGLLKQGARRDRLEAKVFGGAKTIASFSNVGEQNAIFAMQFLKDEGIPVISSSTGGDHGRKIEF
CHED_AGRT5      LMELLINGLLKQGARRDRLEAKVFGGAKTIASFSNVGEQNAIFAMQFLKDEGIPVISSSTGGDHGRKIEF
CHED_AGRRK      LMELLINGLLKQGARRDRLEAKVFGGAKTIATFSNVGEQNAAFAMQFLRDEGIPVVSSSTGGEHGRKVEY
CHED_RHILW      LMELLINGLLKQGARRDRLEAKIFGGAKTISTFSNVGEQNAAFAMQFLRDEGIPVVGSSTGGDHGRKLEF
CHED_RHIE6      LMELLINGLLKQGARRDRLEAKIFGGAKTISTFSNVGEQNAAFAMQFLRDEGIPVVGSSTGGEHGRKLEY
CHED_RHIEC      LMELLINGLLKQGARRDRLEAKIFGGAKTISTFSNVGEQNAAFAMQFLRDEGIPVVGSSTGGEHGRKLEY
CHED_RHIL3      LMELLINGLLKQGARRDRLEAKIFGGAKTISTFSNVGEQNAAFAVQFLRDEGIPVVGSSTGGEHGRKLEY
CHED_RHISN      LMELLINGLLKQGARRDRLEAKIFGGAKTIARFSNVGEQNAAFARQFLLDEGIRVVGESTGGEHGRKLEY
CHED_RHIME      LMELLINGLLKQGARRDRLEAKIFGGARTIARFSNVGEQNAAFARQFLMDEGIRIVGESTGGDHGRKLEY
CHED_SINMW      LMELLINGLLKQGARRDRLEAKIFGGARTIARFSNVGEQNAAFARRFLMDEGIRIVGESTGGDHGRKLEY
CHED_CAUSK      AMELLINGLLKKGARRDRLEAKIFGGGKLFDGLSDVGASNAAFAERFLRDEGIPIVSSSTGGLSARRVEF
CHED_CAUCR      AMEVLINDLLKRGARRERLEAKIFGGAKLFDGLSDVGASNAAFAERFLRDEGIPIVSSSTGGVSARRVEF
CHED_CAUCN      AMEVLINDLLKRGARRERLEAKIFGGAKLFDGLSDVGASNAAFAERFLRDEGIPIVSSSTGGVSARRVEF
CHED1_SILST     AMELLINGIMKKGALRSNLKAKVFGGAKMSANLSDIGANNADFVQRFLRDEGIPVISSSVGGTSARRVRF
CHED_ACICJ      XMELLINDLLRHGARRDRLKAKLFGGACLMKGLTDIGRLNADFAERFLAAEGIEIVGGSLRGERGRRIQF
CHED_RHOS5      AIEILINSLLKLGANRHRLEAKLFGGGSMTLQLGAVGPANAVFAQKYLRDESINCVARSLGGTRARKIRF
CHED_RHOS4      AMELLINALLKLGAARQRIEAKIFGGAMMTPQLGAIGQANAAFARRYLKDEGIRCTAHSLGGNRARRIRF
CHED_RHOSH      AMELLINALLKLGAARQRIEAKIFGGAMMTPQLGAIGQANAAFARRYLRDEGIRCTAHSLGGNRARRIRF
CHED_RHOS1      AMELLINALLKLGAARQRIEAKIFGGAMMTPQLGAIGQANAAFARRYLRDEGIRCTAHSLGGNRARRIRF
CHED_THICR      AMENLVNALLNAGARRERLEFKLFGGGRIMSSTTNIGWYNIGFAFDYIYTEGFKIVSQDIGDVYPRKILY
CHED_BORPD      AMEVLINELLKAGAARERLEAKVFGGGAVLSAMQNIGERNARFVLNYLNTEGIPVLAQDLGDVHARRIGY
CHED_BORA1      AMEVLINELLKAGAARDRLEAKVFGGGAVLSAMQNIGERNGQFVLSYLKTENIPVRAQDLGDTHARRIHY
CHED_RALEJ      ALEVLINELLKMGARRERLEAKVFGGGAVLANMTNIGDRNADFVLRYLKTEEIRVAAQDLRGPHARRVSY
CHED_RHOP5      AMERLINDILVRGGMRQRLEIKVFGGGNVMKSTANIGHRNADFVEEYLAAESLPIAARHLRGHLPRRVHY
CHED_BORPE      AMEVLINELLKAGAVRERLEAKVFGGGAVLSAMQNIGERNGQFVLNYLKTEGIPVRAQDLGDVHARRINY
CHED_BORPA      AMEVLINELLKAGAVRERLEAKVFGGGAVLSAMQNIGERNGQFVLNYLKTEGIPVRAQDLGDVHARRINY
CHED_BORBR      AMEVLINELLKAGAVRERLEAKVFGGGAVLSAMQNIGERNGQFVLNYLKTEGIPVRAQDLGDVHARRINY
CHED_ZYMMO      AMEVLINAMLAKGAHRNRLRARLYGGATMRSGFGDIGIKNAEFARRFLQDEHILLNAEDIGGTTARRVDF
CHED_RALME      ALEVLINELLKMGARRERLEAKVFGGGAVLANMTNIGDRNADFVLKYLRTEEVRVAAQDLRGPHARRVSY
CHED_METFK      AMEVLINQLLKNGARRENLEAKIFGGGNVLSGFTNIGEKNAAFVRKYLRDENIRVVGEDLNDIYPRKVYF
CHED1_DECAR     AMEVLINHLLKLGARRNRFEAKVFGGGAVLASLSNVGARNAEFVLDFLKTEKIPVVAKDLLDSYPRKVYY
CHED_XANC5      AMELLINDMLKRGAHRKRIEAKVFGGANVLKGFTSVGTRNAEFVRQYLQAEHIPIIAEDLCGIHPRKVWF
CHED_XANAC      AMELLINDMLKRGAHRKRIEAKVFGGANVLKGFTSVGTRNAEFVRQYLQAEHIPIIAEDLCGIHPRKVWF
CHED_HALHL      AMEQLINRVLALGGQRQELEVKLFGGGRVLAGVTDVGKRNIEFAESYVRTEGLRLIGRDLGGQYPRKVQY
CHED1_GEOMG     AMELLIDHLIQLGGRLPYLEAKVFGAGRVINGVTDVGERNAEFALRYLEEREIPVTAVDVGDIYPRKVYF
CHED_JANMA      AMEILINDLLKAGARRENLEAKVFGGGNVLSGFSNVGERNAQFVRNFLKVENIRIVAEDLNDVHPRKVYY
CHED_XANOR      AMELLINDMLKRGAHRKRIEAKVFGGANVLKGFTSVGTRNAEFVRQYLQAEHIPIIAEDLCGIHPRKVWF
CHED_XANOM      AMELLINDMLKRGAHRKRIEAKVFGGANVLKGFTSVGTRNAEFVRQYLQAEHIPIIAEDLCGIHPRKVWF
CHED1_RHOFD     AMELLINELLKKGARRESMQAKVFGGAAVMAGFTNVGERNTKFVLDYLATERIPVVSQDVLDIHPRKVCF
CHED_STRMK      AMELLINDMLKRGAHRKRIEAKVFGGANVLKGFTSVGTRNAEFVRQYLQAEHIPIIAEDLCGIHPRKIWF
CHED_STRM5      AMELLINDMLKRGAHRKRIEAKVFGGANVLKGFTSVGTRNAEFVRQYLQAEHIPIIAEDLCGIHPRKIWF
CHED_HERAR      AMEVLINDLLKAGAKRENLEAKVFGGGAVLRGFMNVGERNAQFVRDFLKVEGIRIIAEDLNDIHPRKVYY
CHED_RALPJ      AMEVLLNQLYKAGAKRERLEIKVFGGAAVLAGMSDVGERNGKFVLEFLRNEGLTVAAKDLFDVHPRKVYF
CHED_BURVG      AMEVLINELIKAGGRRERFEAKVFGGAAVLAGMTNIGDRNADFVRRYLALERIRITAEDLQGVHPRKVAF
CHED_RALSO      AMEVLLNQLYRAGARREHLEIKVFGGAAVLAGMSDVGERNGKFVLEFLRSEGLPVAAKDLFDVHPRKVYF
CHED_XANCP      AMELLINDMLKRGAHRKRIEAKVFGGANVLKGFTSVGTRNAEFVRQYLQAEHIPIIAEDLCGIHPRKVWF
CHED_XANCB      AMELLINDMLKRGAHRKRIEAKVFGGANVLKGFTSVGTRNAEFVRQYLQAEHIPIIAEDLCGIHPRKVWF
CHED_XANC8      AMELLINDMLKRGAHRKRIEAKVFGGANVLKGFTSVGTRNAEFVRQYLQAEHIPIIAEDLCGIHPRKVWF
CHED_BURXL      AMEVLINELIKAGGRRERFEAKVFGGGAVLAGMTNIGDRNSEFVRRYLALEKIRIVAEDLQGSHPRKVAF
CHED_THIDA      AMEVLINQLLKAGARRENLEAKVFGGGNVLRGFTNVGERNAQFVRDFLRAENIRVVAEDLNDVHPRKVYF
CHED_HAHCH      AMEHLINDVMKLTGKRSTLEVKIFGGANVIRGMSSVGDKNIEFVRRYLEVDGFKIASEDVGGDYPRKILY
CHED_SACD2      AMEHLINSIIKCGGMRNRLEIKLFGGGRVLANMMDIGQRNIEFVESFLANDELPVIAKDLGGNYPRKILY
CHED_BURCC      AMEVLINELIKAGGRRERFEAKVFGGAAVLAGMTNIGDRNADFVRRYLALERIRITAEDLQGVHPRKVAF
CHED_BURCA      AMEVLINELIKAGGRRERFEAKVFGGAAVLAGMTNIGDRNADFVRRYLALERIRITAEDLQGVHPRKVAF
CHED1_SHEON     AMELLINHVLKLGARRNALEAKVFGGGNVLRGLTNIGERNAEFVLDYLQMEQIPVIAADLLDIYPRKVYF
CHED_BURS3      AMEVLINEMIKAGGRRERFEAKVFGGAAVLAGMTNIGDRNADFVRRYLALERIRITAEDLQGVHPRKVAF
CHED_LARHH      AMEILINEMIKLGADRQRMEAKIFGGGNVLKGISNIGERNVDFVRQYLAKEGIPVMAEDVLDSYPRKLYF
CHED_JANSC      SMEALIDALLHKGADRQRLNVWLFGGANVLGTQTGIGAANSAFAVDFTRAQGLTLRGSDLGGTRGRRVHF
CHED2_BURTA     AMELLINGLLRRGALKWRLRAKLFGGGCVMQSLSDIGERNAAFVRAYLDAEGIRSVGGDMLGTRPRRVCY
CHED1_BURTA     AMEVLINELIKAGGRRERFEAKVFGGAAVLAGMTNIGDRNADFVRRYLALERIRITAEDLQGVHPRKVAF
CHED1_GEOSL     SMELLINSLMRHGARRENLRAKAFGGASEVGNFSCVGSVNARFVREFLANEGIPLLSADLEGERGRVIYF
CHED_BURPS      AMEVLINELIKAGGRRERFEAKVFGGAAVLAGMTNIGDRNADFVRRYLALERIRITAEDLQGVHPRKVAF
CHED_BURP1      AMEVLINELIKAGGRRERFEAKVFGGAAVLAGMTNIGDRNADFVRRYLALERIRITAEDLQGVHPRKVAF
CHED_BURP0      AMEVLINELIKAGGRRERFEAKVFGGAAVLAGMTNIGDRNADFVRRYLALERIRITAEDLQGVHPRKVAF
CHED_BURMS      AMEVLINELIKAGGRRERFEAKVFGGAAVLAGMTNIGDRNADFVRRYLALERIRITAEDLQGVHPRKVAF
CHED_BURMA      AMEVLINELIKAGGRRERFEAKVFGGAAVLAGMTNIGDRNADFVRRYLALERIRITAEDLQGVHPRKVAF
CHED_BURM9      AMEVLINELIKAGGRRERFEAKVFGGAAVLAGMTNIGDRNADFVRRYLALERIRITAEDLQGVHPRKVAF
CHED_BURM7      AMEVLINELIKAGGRRERFEAKVFGGAAVLAGMTNIGDRNADFVRRYLALERIRITAEDLQGVHPRKVAF
CHED_NITEU      AMDILIRELLRNGAHKENLVSKVFGGGNVQRAMSMIGSQNTRFVKKYLAERGIPILAADLEGNHPRKIHF
CHED_VIBVU      AMEMLLNQLLSLGARRERLRMKLFGGAQMMGFHSMIGEKNVEFVLHYAEQEGLEVVAYDLGGLEPRKIMF
CHED_VIBVY      AMEMLLNQLLSLGARRERLRMKLFGGAQMMGFHSMIGEKNVEFVLHYAEQEGLEVVAYDLGGLEPRKIMF
CHED_NITEC      AMGILIRELLKNGARKQNLVAKVFGGGNVQPAMSAIGSQNARFVKKYLAEYEIPILAGDLEGFYPRKLHF
CHED2_DECAR     AMEALLNALLQRGAKKLRLQAKAFGGGNTSGPSMSIGLRNAEFTKEWLDREGIPLLASDFLGPWSRKVLF
CHED2_CHRVO     AMELLITDMQKLGAMRNRLEAKIFGAGNVLDGMTKVGERNTNFIRSYLANEQIPILAEDLLGECARKVYF
CHED_VIBCM      AMEVLINRLLSMGAERERLKFKLFGGAHLMGYQSLVGEKNVEFVLEYAKREKLNVVAQDLGGAQPRKLLF
CHED_VIBCH      AMEVLINRLLSMGAERERLKFKLFGGAHLMGYQSLVGEKNVEFVLEYAKREKLNVVAQDLGGAQPRKLLF
CHED_VIBC3      AMEVLINRLLSMGAERERLKFKLFGGAHLMGYQSLVGEKNVEFVLEYAKREKLNVVAQDLGGAQPRKLLF
CHED_THEMA      AVKTLVEELKKMGAKVERLEAKIAGGASMFESKGNIGARNVEAVKKHLKDFGIKLLAEDTGGNRARSVEY
CHED2_SHEON     AMEILINAMLKRGAQRKYLQSKIFGGANNILNHYDIGGMNIDFVRHFLQRERIPIISEDIGGHCGRVIYF
CHED_DESHY      AMDLLVTEILRLGASKSRLRAKMAGGAQMFSPVLKIGDRNAEQVIVELKRLGIPLLVSDVGGSFGRTIHF
CHED_DESHD      AMDLLVTEILRLGASKSRLRAKMAGGAQMFSPVLKIGDRNAEQVIVELKRLGIPLLVSDVGGSFGRTIHF
CHED_THETN      GIEILIEEMLKEGANPKRLISKLAGGAQMFSSIMNIGERNVIATKEVLKKLGIPIVAEDTGGNYGRTIEF
CHED2_GEOMG     AVDLMVEELLKCGCAPERLVAKLAGGATMFSAHGGIGERNVAAAREALERSGIPLVAEDTGGDYGRSLEF
CHED3_GEOSL     AVDLMVEELIKCGCVAERLVAKLAGGATMFTTHSGIGERNVTAAKEALERRGIPLVASDTGDDYGRSLEF
CHED1_ANADE     AVPQLVEXXXXXXXXXXXXXXKVFGGASVIGAFRNLGDENVQLALRLLDEARIPVLDRDVGGARGRKLIF
CHED_GEOLS      AMERLLEQVLAIGARKEHLVAKVFGGANLLSTSSPIGERNIELAMTQLEEWRIAVVATDLGGRVGRKI--
CHED_RHORT      ALDRLHARMGELGCETKDLRAKVFGGAAVLATGDSVGTKNVKIAIEWLHAQGIPTLARRTGGENGLLIRF
CHED_PYRKO      GLELLIKDMMKLGASPRRLEAKLFGGAHMFTNVSNVGKKNVEVAKRELKKRGIRLVAEDTGGKGGRTIYL
CHED_HALMA      GIQALIEAMADAGASTEAMEAKIAGGSDMLENGSSIGSRNAKKVRETLDEHGVPVVGEDLGGDHGRSVK-
CHED_ARCFU      AVEMMTEAMERLGSDRKRIVAKMAGGAQIFKHMTRIGDRNAEAIRTILRDYGIRIVSEDLGGDEGRTVYF
CHED_SYNWW      GLKLAIREMEKNGAQASRLLAKIAGGAQMFSDIMKIGERNSVAVKENLQLHRIKLLSSDTGGNYGRTIIF
CHED_BORAP      AIPMLINAMLENGANKSNLKAKLFGGTNFMAKGSKVGLENSEFAINTLNKYRIPILAKDFDQSKSRKIFA
CHED_METHJ      AVEVLIKELTQKGSKVSNLKAKLAGGASMFQNFSNIGERNAEALKAILKELSIPIVREDLGGTIGRTVTY
CHED2_METAC     AIENMFEDMIRMGARKNRITAKFAGGAQVFKHMSKIGDRNAISVEETLVKRNIPILAKDVGGEVGRNVIF
CHED1_METMA     AIEKMVEDMVKMGARRSRITAKFAGGAQVFKHMSKIGDRNAISVEETLIKKNIPILAKDVGGEVGRNVIF
CHED_SULDN      AISKLIEAMEAVGCQRRDMVAKLFGGASNAQNGMLVGEKNIQIAHHILSEQRIKIVASDLGGTRGRKISL
CHED_BORGA      AIPMLINAMLENGANKSNLKAKLFGGTNFMAKGSKVGLENSEFAVHTLNKYRIPILAKDFDQSKSRKIFA
CHED_BORBZ      AIPMLINAMLENGASKSNLKAKLFGGTNFMAKGSKVGLENSEFAVNTLNKYRIPILAKDFDQSKSRKIFA
CHED_BORBU      AIPMLINAMLENGASKSNLKAKLFGGTNFMAKGSKVGLENSEFAVNTLNKYRIPILAKDFDQSKSRKIFA
CHED_BACHD      ALDLLLSKLEAIGAKRYSLKAKMAGGAQMFSFASNIGQRNVEAVKKKLRELSIPILAEDVGGSNGRTIEF
CHED_PYRHO      GLQLLLKEVIKLGASKFRLEAKLFGGAQMFDNIRSIGEKNVQVAKRELRKLGIRLVAEDTGGKGGRTIYL
CHED_BORT9      AIPMLIDAMIENGASKSNLKAKLFGGANFMAKGTRVGVENSEFAVNSLTKYGIPVVAQDFDQSKSRKIFV
CHED_GEOKA      AVEALVQLVIAAGGRKGMLKAKLAGGAQ-MFSFSTVGARNVEEVKKQLERLHIPVVAEDVGGHSGRTIEF
CHED_OCEIH      AISYLYNELLKRGANQSSLKAKLAGGARTGSDLMRIGPRNVESVELALAEFGIPIVSKDVGGNLGRTIEF
CHED_METVS      AVPELLERLVKLGARRDKLVAKIAGGAAMFKANTNVGKKNIDASKDELKKVGLRVSSEDTGGESGRTV--
CHED_BACLD      AVEATVKMLLEAGCRKYALKAKMAGGAKMTNDLMKVGPRNVLAIKKHLSLLNIPIVSEDTGGNSGRTIEF
CHED_CLOPH      GIDELVRRLLVLGATRSSLVAKIAGGAQMFAFSSNVGERNVEATKEKLNSLRIPILAQDTGLNYGRTIEF
CHED_METMP      AIPELINRMAKLGARKDKLTTKLAGGAAMFKCNSNVGKKNIEASREEVKKMGLRIASEDLGGDTGRTI--
CHED_DESRM      GIPLMIDEIKRLGGIPSRLTAKLAGGAQMFSGLDNIGQRNSKMVKEILSRMGIRILAEELGGNRGRTMIF
CHED_METM7      AIPELIDRLTKLGARKDKLTAKLAGGAAMFKCNSNVGKKNIEASKEEVRKVGLRIASEDLGGDTGRTI--
CHED_METM6      ALPELLDRMTKLGARKDKLTAKLAGGAAMFKCNSNVGKKNIEASKEEVRKVGLRIASEDLGGDIGRTI--
CHED2_RHOFD     ALKLMLIELQRLGIPSAQCQGKIFGGGNMFSGALNVGQRNGEAALTLLREHGIPVMSESLFGIGHRQIVF
CHED_PYRAB      GXXXXXXXXXXXGASKFRLEAKLFGGAQMFQNIKSIGERNVQTAKRELKKLGIRLVAEDTGGRGGRTIYL
CHED_CLONN      AIPMLLEKMEKQGAVKRHLKAKIAGGASMFSMIMDIGNRNSKSVKKVLGEYGIPIISEDTGGNKGRTMIF
CHED_CLOBM      AIPILVEKMEKLGARKNGLKAKICGGA-SMFNFSDIGNRNGKAVKEKLKELSIPLLAEDIGGNKGRTMIF
CHED_CLOBL      AIPILVEKMEKLGARKNGLKAKICGGA-SMFNFSDIGNRNGKAVKEKLKELSIPLLAEDIGGNKGRTMIF
CHED_CLOBK      AIPILVEKMEKLGARKNGLKAKICGGA-SMFNFSDIGNRNGKAVKEKLKELSIPLLAEDIGGNKGRTMIF
CHED_CLOBJ      AIPILVEKMEKLGARKNGLKAKICGGA-SMFNFSDIGNRNGKAVKEKLKELSIPLLAEDIGGNKGRTMIF
CHED_CLOBH      AIPILVEKMEKLGARKNGLKAKICGGA-SMFNFSDIGNRNGKAVKEKLKELSIPLLAEDIGGNKGRTMIF
CHED_CLOB6      AIPILVEKMEKLGARKNGLKAKICGGA-SMFNFSDIGNRNGKAVKEKLKELSIPLLAEDIGGNKGRTMIF
CHED_CLOB1      AIPILVEKMEKLGARKNGLKAKICGGA-SMFNFSDIGNRNGKAVKEKLKELSIPLLAEDIGGNKGRTMIF
CHED_BACSU      AVQTTIDMLIEAGCRKFALKAKLAGGSKSTNDLMKIGPRNVLAIKEQLSLFNIPIISEDTGGSSGRTIEF
CHED_BACSK      AIASLQAELKKQGAR--KLCAKMAGGAQMFREFMQIGERNAAAARETLARLGITLVAEDIGGTKGRTIQY
CHED1_METAC     GIEYLVAEIIENGGSRRKLEAKLVGGSSMFESHMNIGERNIKSAKETLKKLGLEIIAEDTGKNYGRTIIF
CHED_METM5      AIPELITKIVKMGARKDRLTVKLAGGAAMFGNNSNVGKKNIEASKIEIKKIGLRVSSEDLGGDTGRTI--
CHED_METBF      GIEHLATEILREGSPRKRFEAKLVGGAHMFENRNNIGERNIKYAKNTLEKFEIPIISEDTGKNYGRTI--
CHED2_METMA     GIEYLVDEMIRRGGSIDKLEAKVVGGAGMFESRLNIGERNIKSARETMKKLGVSIIAEDVGKNYGRTVIF
CHED_CARHZ      GIPLVVRELEKQGARKSSLEVKMVGGAQMFSTVMNIGERNIEMCRKVIARMGLKLVAEDVGGNKGR----
CHED_CLOK5      AVPLLIKDLEKLGVNKRNLKAKIAGGASMFSMIMDIGNRNSAAVKKILEKCSVPILSEDLGGNKGRTMIF
CHED2_LEPIN     AIPLLIKKMNEMGCNPGEYSVRLFGGASMFSSFQNIGEQNILTARAILEQSKIPLILEDVGGNDGRTISL
CHED2_LEPIC     AIPLLIKKMNEMGCNPGEYSVRLFGGASMFSSFQNIGEQNILTARAILEQSKIPLILEDVGGNDGRTISL
CHED2_SYNAS     AITYMVRMFREEGAKKKNLRSQIFGGAESCCEADQIAHENVKTARSVLKKHGIKVISEDVGGRLGRKIVY
CHED_DESAD      AVDHLLKSMRRLGVRKNELEVKLFGGA-TGLSYSQVGNRNVDAALENLEAKGLKPVSMDVGGNVGRKLLF
CHED_CLOBB      AIPLLIKKMEAKGCQKRNLIAKIAGGA-SMFSFSDIGKRNIQAVKKSLSEERIQIIAEDVGGNKGRTMIL
CHED_CLOAB      AIPILIKKMEGMGANIRNMKAKIAGGA-SMFNFSDIGNRNGISVKKVLKELNVPLLSQDIGGNKGRTMIF
CHED_CLOTE      GIIIMTDKMKEKGANIRNIKAKISGGA-SMFNFSDIGRRNIEAVRKKLKELSIPIVAEEVGGNKGR----
CHED_CLOBA      AIPLLIKKMEAKGCLKRNLIAKIAGGA-SMFSFSDIGKRNIQAVKKSLSEERIQIIAEDVGGNKGRTMIL
CHED_BACA2      AVKMTIDMLLKAGCRKFXXXXXXXXXXKMTNDLMKIGPRNVAAIKEQLSLYNIPVISEDTGGSSGRTIEF
CHED1_CHRVO     AMLLLLREILDTGLPLQEFQARLIGGASMLLSSHDVPSRNIQQARLMVKQLGLKLLAEDLGGNCPRMVLF
CHED_MOOTA      XXXXXXXXXXXXXXXXXXXXXKIAGGAQMFTSLLNIGQRNAAMVRQTLQELAIPLVAEDTGGNYGRTMIF
CHED3_DECAR     AFELFLQHVAAAGTRPGEYQAKLFGGANMLTGPTDIGPRNVALGRQLLAANHIALMVEHVGGSGRRKLHF
CHED_PSEU2      AMEILIRHALANGTLPEEYQVKLFGGGEMFPAMRNVADSNVHAALALAEQNRLKLMAQDLGSTGHRSIIF
CHED_PSE14      AMEILIRHALANGTLPEEYQVKLFGGGEMFPAMQNVADSNVHAALALAEQHRLKLMAQDLGSTGHRNIIF
CHED_PELLD      ALETLFSVMQNEGADPGNLLICLIGGANVLREHDTIHIDNLRSLTSLILQRNLPICRTMTGGSERMMARM
CHED_GEOTN      AVEALCKLVIXXXXXXXXXXXQMFSFSSTSGDMMRIGARNVEEVKRQLERLHIPVVAEDVGGHSGRTIEF
CHED_NATPD      GIDVVVDALLEHGASKASLRAKIXXXXXXXXXXXXXXXRNIEVAREELSDRGIELVGEEVGGDCGRTVKV
CHED1_SYNAS     AIPLLFKACYSLGAQKKSMIVKVAGGASILTNFFRIGQKNIMMARKMFWKNNVLINGEDTGSNCNRTVRL
CHED2_ANADE     AIPLLFHRLYARGCRKEALVVKAAGGGNDRGGAFDIGRRNHAAMWRILRHARVAVVAEDVGGSRSRTVRL
CHED_DESVH      AIETLLGQFARRGIAANDLVVKLFGGAFTLRCIVDVGGRNVEVARATLQRFGIEPQSEHILGDRGRKLFF
CHED_SOLUE      GIPKLVEQVCGRGANRRRLIAHAAGGASMMQAVFDIGKRNYLALRKILWKAGILLAGEAVGGTNSRTVRL
CHED_DESDG      AIEAVYGNFEKRGLHPEEVEVKLFGGAFSMGCMIDVGGRNVLTAREVLAAKGLEIRSEQVQGTRGRKLLF
CHED_PELCD      LVPLLFKEMVRLGARGRGLVVKMLGGAAVMAGNDNIGKRNILAVKKILWKLGMGPVAEDVGANYSRTV--
CHED2_GEOSL     SIIRMLEMFMSRGITPRQLQVKLFGGSDMLASRPGVGSRNVDIARQXXXXXXXXXXXXXXXXTRGRKLFF
CHED_PSESM      ALEMLIRHALANHTKPRDYQVKLFGGGQMFPEQQNDSQQ-------------------------------
CHED_PSEFS      ALELLLRHAQVNGTHARDYQVKLFGGGE------------------------------------------
CHED_SYMTH      GXXXXXXXXXXXXXSRSRLXXXXXXXXXXXXXXSNIGARNTEAVRAALARHQIRLVAEDMGGTYGRTLQL
CHED1_LEPIN     AFQLFFEKL--EGFKK-QYQIKLFGGASMFSSVRDIGMKNILSIKEHLIRNQLLISSEDLGGFSHRRIFF
CHED1_LEPIC     AFQLFFEKL--EGFKK-QYQIKLFGGASMFSSVRDIGMKNILSIKEHLIRNQLLISSEDLGGFSHRRIFF
CHED_BDEBA      TIPRMLERMGATMADVSELEAIVAGGGRMMDGDKNVGDENLKAAKAVLEKHRIRIVAFEPGGEQGTKM--
CHED2_SILST     -VDKAIESLLKQDEERRQLRVVLAGGANMSMPFDTVGSVNAKFARQAIR---------------------


                         +         .         .         .         .         *         .:210
query           WPVSGRARQHPLSGAETQKTVAMETRPVPAPKPVANDIEFF
CHED_AGRT5      WPVSGRARQHPLSGAETQKTVAMETRPVPAPKPVANDIEFF
CHED_AGRRK      WPVSGRARQYPLTGAETQKTVALEQRPVAAPKPVDNAIEFF
CHED_RHILW      WPVSGRARQYPLTGAETQRTVALEQRPAAPPKPVETSIEFF
CHED_RHIE6      WPVSGRARQYPLTGAETQRTVALEQRPAAPQKPVETSIEFF
CHED_RHIEC      WPVSGRARQYPLTGAETQRTVALEQRPAAPQKPAETSIEFF
CHED_RHIL3      WPVSGRARQYPLTGAETQRTVALEQRPAAPQKPVETSIEFF
CHED_RHISN      WPVTGRARQYALTGVEAQRAIHQDQRPAPAPKPVESSIEFF
CHED_RHIME      WPSSGRARQYALTGVEAQRALQMDQRPA-VPKPAESPIEFF
CHED_SINMW      WPSSGRARQYALTGVEAQRAMQMDQRPA-APKPVESSIEFF
CHED_CAUSK      WPASGRVRQRLVA---VDNAPAEVRRPTPAVAPTANDLELF
CHED_CAUCR      WPASGRVRQRLVAVDNAPQDVRRPT-PPPMPAVASGDVDLF
CHED_CAUCN      WPASGRVRQRLVAVDNAPQDVRRPT-PPPMPAVASGDVDLF
CHED1_SILST     HACSGAAQQ--------------------------------
CHED_ACICJ      WPVSGRARQTLLAADQPALLRAPDLRTLRAPPP-SGAVELF
CHED_RHOS5      HPTSGRVQQMFLTEIE-------------------------
CHED_RHOS4      WPKTGRVQQMFLGSED----VVPNEQPQFRLQGGAGDVTFF
CHED_RHOSH      WPKTGRVQQMFLGSED----VVPNEQPQFRLQGGAGDVTFF
CHED_RHOS1      WPKTGRVQQMFLGSED----VVPNEQPQFRLQGGAGDVTFF
CHED_THICR      YPNSGRVRVRRLNAMHNQSLAAEESRYINGSKPVEGDVELF
CHED_BORPD      FPRDGR-----------------------------------
CHED_BORA1      FPFDGR-----------------------------------
CHED_RALEJ      FPVTGLALVRRLTRQDDQVSVERDER---------------
CHED_RHOP5      FPITGRVMLLELARTEQEAVVRLERKSKIQVEPVAGSAELF
CHED_BORPE      FPRDGR-----------------------------------
CHED_BORPA      FPRDGR-----------------------------------
CHED_BORBR      FPRDGR-----------------------------------
CHED_ZYMMO      CPALGLAR---CRHVENQRPV--ERLEVVPDK--AGDVTFF
CHED_RALME      FPRTGLARQDDTVGIEREERALARALSTSTKAPARGAVELF
CHED_METFK      FPRTGRVLVKKLKQMHNNTLISREESYAKRLKKVAGEVELF
CHED1_DECAR     FPYSGKVLVKKLHRVHNDTLFSRENKVRLSGAPMDGDIELF
CHED_XANC5      FATTGRVVVQRLPHAHEAEVAATESRARLSKAPVTGGVELF
CHED_XANAC      FATTGRVVVQRLPHAHEAEVAATESRARLSKAPVTGGVELF
CHED_HALHL      FPESGRARSKKLLRTRNDTVVRREEHYLHEEQPVSGDVDLF
CHED1_GEOMG     APATGRA----------------------------------
CHED_JANMA      FPRNGK-----------------------------------
CHED_XANOR      FATTGRVAVQRLPHAHEAEVAATESRARLSKAPVTGGVELF
CHED_XANOM      FATTGRVAVQRLPHAHEAEVAATESRARLSKAPVTGGVELF
CHED1_RHOFD     FPVTGKVLVKRLAHSHPE-TLAVEER---------------
CHED_STRMK      FADTGRVVVQRLPHAHEAEVAATESRARLSKAPVTGGVELF
CHED_STRM5      FADTGRVVVQRLPHAHEAEVAATESRARLSKAPVTGGVELF
CHED_HERAR      FPRSG------------------------------------
CHED_RALPJ      VPSTGQ-----------------------------------
CHED_BURVG      MPRTGRA----------------------------------
CHED_RALSO      VPSTGQ-----------------------------------
CHED_XANCP      FPTTGR-----------------------------------
CHED_XANCB      FPTTGR-----------------------------------
CHED_XANC8      FPTTGR-----------------------------------
CHED_BURXL      MPRTGQ-----------------------------------
CHED_THIDA      FPRTGR-----------------------------------
CHED_HAHCH      DPTNGKVMMKRLKSLHNDTVIQREEHYMDSHTKVAGDVDLF
CHED_SACD2      FAATGQAKMKKMGIASDTNLVKQEKAYLDATKPSAGDVELF
CHED_BURCC      MPHSGRA----------------------------------
CHED_BURCA      MPHSGRA----------------------------------
CHED1_SHEON     FPETGLVKVRKIKTIHNSTIMDRESEYRLRIKPSGGDVELF
CHED_BURS3      MAATGRA----------------------------------
CHED_LARHH      FSRSGR-----------------------------------
CHED_JANSC      TPATGDPR---------------------------------
CHED2_BURTA     FPSTGRALCKRLVRGSDVADIATSERDLARRLPVAGSVELF
CHED1_BURTA     MPHTGQA----------------------------------
CHED1_GEOSL     -----------------------------------------
CHED_BURPS      MPHTGQA----------------------------------
CHED_BURP1      MPHTGQA----------------------------------
CHED_BURP0      MPHTGQA----------------------------------
CHED_BURMS      MPHTGQA----------------------------------
CHED_BURMA      MPHTGQA----------------------------------
CHED_BURM9      MPHTGQA----------------------------------
CHED_BURM7      MPHTGQA----------------------------------
CHED_NITEU      FPKNGRVLQKKLYVSRNDTIVERE-----------------
CHED_VIBVU      DPLTGKA----------------------------------
CHED_VIBVY      DPLTGKAWLKRIPFAEINRLRREEER---------------
CHED_NITEC      FPKSGR-----------------------------------
CHED2_DECAR     LPMTGDACRRMVTNMATAETIAREEKSAQKPKSTEKKIELF
CHED2_CHRVO     FTATGK-----------------------------------
CHED_VIBCM      DPQTGQA----------------------------------
CHED_VIBCH      DPQTGQA----------------------------------
CHED_VIBC3      DPQAGQA----------------------------------
CHED_THEMA      NIETGKLLVRKVGGGE-------------------------
CHED2_SHEON     DP---------------------------------------
CHED_DESHY      -----------------------------------------
CHED_DESHD      -----------------------------------------
CHED_THETN      YSEDGR-----------------------------------
CHED2_GEOMG     NTATGRALQQPI-----------------------------
CHED3_GEOSL     NTVTGRALQRPI-----------------------------
CHED1_ANADE     HVDDGAA----------------------------------
CHED_GEOLS      -----------------------------------------
CHED_RHORT      YTATGRVLVRTIQSAIT------------------------
CHED_PYRKO      DVSTGKVRMRKVSNGKVIEAV--------------------
CHED_HALMA      -----------------------------------------
CHED_ARCFU      FTNDGR-----------------------------------
CHED_SYNWW      DPETG------------------------------------
CHED_BORAP      FPES-------------------------------------
CHED_METHJ      YP---------------------------------------
CHED2_METAC     NPVDG------------------------------------
CHED1_METMA     NPADG------------------------------------
CHED_SULDN      ESNSGR-----------------------------------
CHED_BORGA      FP---------------------------------------
CHED_BORBZ      FP---------------------------------------
CHED_BORBU      FP---------------------------------------
CHED_BACHD      NPETKR-----------------------------------
CHED_PYRHO      DLSTGKVRMRKVT----------------------------
CHED_BORT9      FP---------------------------------------
CHED_GEOKA      NPQTG------------------------------------
CHED_OCEIH      DPRS-------------------------------------
CHED_METVS      -----------------------------------------
CHED_BACLD      DPQS-------------------------------------
CHED_CLOPH      NPES-------------------------------------
CHED_METMP      -----------------------------------------
CHED_DESRM      DIASGQ-----------------------------------
CHED_METM7      -----------------------------------------
CHED_METM6      -----------------------------------------
CHED2_RHOFD     DVSNGDVWSH-------------------------------
CHED_PYRAB      DLSTGKVRMRKVIGGQVIEKV--------------------
CHED_CLONN      -----------------------------------------
CHED_CLOBM      DTSTGK-----------------------------------
CHED_CLOBL      DTSTGK-----------------------------------
CHED_CLOBK      DTSTGK-----------------------------------
CHED_CLOBJ      DTSTGK-----------------------------------
CHED_CLOBH      DTSTGK-----------------------------------
CHED_CLOB6      DTSTGK-----------------------------------
CHED_CLOB1      DTSTGK-----------------------------------
CHED_BACSU      EPKS-------------------------------------
CHED_BACSK      -----------------------------------------
CHED1_METAC     DTLTG------------------------------------
CHED_METM5      -----------------------------------------
CHED_METBF      -----------------------------------------
CHED2_METMA     DTLTG------------------------------------
CHED_CARHZ      -----------------------------------------
CHED_CLOK5      -----------------------------------------
CHED2_LEPIN     YLDDGR-----------------------------------
CHED2_LEPIC     YLDDGR-----------------------------------
CHED2_SYNAS     -----------------------------------------
CHED_DESAD      CTYSG------------------------------------
CHED_CLOBB      DALDGK-----------------------------------
CHED_CLOAB      ---------NTLDGSVDIRTVGMGIRKI-------------
CHED_CLOTE      -----------------------------------------
CHED_CLOBA      DALDGK-----------------------------------
CHED_BACA2      EPKS-------------------------------------
CHED1_CHRVO     DVASGNVWIKQSQEAELEQAPHTRTR---------------
CHED_MOOTA      DLESG------------------------------------
CHED3_DECAR     DVWSG------------------------------------
CHED_PSEU2      WDGNVWVRHQPMEAME-------------------------
CHED_PSE14      WNGNVWVRHQPMEAIE-------------------------
CHED_PELLD      ETKTGRIFQ--------------------------------
CHED_GEOTN      NPQTG------------------------------------
CHED_NATPD      DAATGDVNVSRTDGEET------------------------
CHED1_SYNAS     EIKTGK-----------------------------------
CHED2_ANADE     FLDSGR-----------------------------------
CHED_DESVH      HSGTG------------------------------------
CHED_SOLUE      EIGSGR-----------------------------------
CHED_DESDG      NTRTGEVWVKLLNNAANQ-----------------------
CHED_PELCD      -----------------------------------------
CHED2_GEOSL     YTHTGEVLLKRLNRTE-------------------------
CHED_PSESM      -----------------------------------------
CHED_PSEFS      -----------------------------------------
CHED_SYMTH      FIETGR-----------------------------------
CHED1_LEPIN     -----------------------------------------
CHED1_LEPIC     -----------------------------------------
CHED_BDEBA      -----------------------------------------
CHED2_SILST     -----------------------------------------