[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for atum0:AAK86457.1

[Show Plain Result]


## Summary of Sequence Search
    1::418
  107::376     9e-55  41%  394 aa  YLP3_PSEPU RecName: Full=Uncharacterized methyltransferase in lpd-3
   48::372     3e-49  38%  382 aa  CFA_ECOLI RecName: Full=Cyclopropane-fatty-acyl-phospholipid
   48::372     3e-49  38%  382 aa  CFA_ECOL6 RecName: Full=Cyclopropane-fatty-acyl-phospholipid
   15::286     1e-38  34%  286 aa  MMA1_MYCTU RecName: Full=Methoxy mycolic acid synthase 1;       
   15::286     1e-38  34%  286 aa  MMA1_MYCTA RecName: Full=Methoxy mycolic acid synthase 1;       
   15::286     1e-38  34%  286 aa  MMA1_MYCBO RecName: Full=Methoxy mycolic acid synthase 1;       
   23::308     4e-35  37%  308 aa  CFA2_MYCLE RecName: Full=Cyclopropane-fatty-acyl-phospholipid
   20::302     1e-34  37%  302 aa  CFA2_MYCTU RecName: Full=Cyclopropane-fatty-acyl-phospholipid
   20::302     1e-34  37%  302 aa  CFA2_MYCBO RecName: Full=Cyclopropane-fatty-acyl-phospholipid
   10::273     3e-32  34%  287 aa  CFA1_MYCTU RecName: Full=Cyclopropane-fatty-acyl-phospholipid
   10::273     3e-32  34%  287 aa  CFA1_MYCTA RecName: Full=Cyclopropane-fatty-acyl-phospholipid
  115::240     1e-09  30%  390 aa  ERG6_MAGGR RecName: Full=Sterol 24-C-methyltransferase;       
   72::187     5e-09  29%  378 aa  ERG6_SCHPO RecName: Full=Sterol 24-C-methyltransferase;       
   81::208     7e-09  24%  379 aa  ERG6_NEUCR RecName: Full=Sterol 24-C-methyltransferase;       
   68::186     3e-08  31%  256 aa  UBIE_PSEMY RecName: Full=Ubiquinone/menaquinone biosynthesis
   79::201     3e-08  25%  377 aa  ERG6_PNECA RecName: Full=Sterol 24-C-methyltransferase;       
   99::230     4e-08  29%  363 aa  SMT2_ORYSJ RecName: Full=24-methylenesterol C-methyltransferase 2; 
   51::174     1e-07  27%  354 aa  SMT1_DICDI RecName: Full=Probable
  272::372     1e-07  35%  491 aa  PEAM1_ARATH RecName: Full=Phosphoethanolamine N-methyltransferase
   66::180     1e-07  29%  253 aa  UBIE_AZOVD RecName: Full=Ubiquinone/menaquinone biosynthesis
   51::175     1e-07  26%  344 aa  SMT1_ORYSJ RecName: Full=Cycloartenol-C-24-methyltransferase 1;    
  256::322     1e-07  40%  475 aa  PEAM2_ARATH RecName: Full=Putative phosphoethanolamine
   59::137     2e-07  44%  241 aa  UBIG_BORA1 RecName: Full=3-demethylubiquinone-9
   69::179     2e-07  28%  256 aa  UBIE_PSEU5 RecName: Full=Ubiquinone/menaquinone biosynthesis
   30::135     4e-07  36%  258 aa  UBIE_RHILO RecName: Full=Ubiquinone/menaquinone biosynthesis
   69::203     5e-07  27%  256 aa  UBIE_PSEFS RecName: Full=Ubiquinone/menaquinone biosynthesis
  275::341     5e-07  39%  494 aa  PEAMT_SPIOL RecName: Full=Phosphoethanolamine N-methyltransferase; 
   55::133     7e-07  37%  239 aa  UBIG_PECCP RecName: Full=3-demethylubiquinone-9
   19::172     9e-07  27%  234 aa  UBIG_COXBU RecName: Full=3-demethylubiquinone-9
   19::172     9e-07  27%  234 aa  UBIG_COXBR RecName: Full=3-demethylubiquinone-9
   19::172     9e-07  27%  234 aa  UBIG_COXBN RecName: Full=3-demethylubiquinone-9
   19::172     9e-07  27%  234 aa  UBIG_COXB2 RecName: Full=3-demethylubiquinone-9
   19::172     9e-07  27%  234 aa  UBIG_COXB1 RecName: Full=3-demethylubiquinone-9
  280::337     9e-07  43%  490 aa  PEAM3_ARATH RecName: Full=Putative phosphoethanolamine
   81::208     9e-07  22%  381 aa  ERG6_YARLI RecName: Full=Sterol 24-C-methyltransferase;       
    1::135     1e-06  30%  242 aa  UBIG_ENT38 RecName: Full=3-demethylubiquinone-9
   69::188     1e-06  28%  256 aa  UBIE_PSEPU RecName: Full=Ubiquinone/menaquinone biosynthesis
   69::188     1e-06  28%  256 aa  UBIE_PSEE4 RecName: Full=Ubiquinone/menaquinone biosynthesis
   49::131     1e-06  38%  234 aa  UBIG_ACTP2 RecName: Full=3-demethylubiquinone-9
   69::203     1e-06  27%  256 aa  UBIE_PSEPF RecName: Full=Ubiquinone/menaquinone biosynthesis
   45::169     1e-06  24%  336 aa  SMT1_ARATH RecName: Full=Cycloartenol-C-24-methyltransferase;      
    1::135     2e-06  28%  243 aa  UBIG_ENTS8 RecName: Full=3-demethylubiquinone-9
   59::137     2e-06  43%  241 aa  UBIG_BORPA RecName: Full=3-demethylubiquinone-9
   59::137     2e-06  43%  241 aa  UBIG_BORBR RecName: Full=3-demethylubiquinone-9
   49::131     2e-06  38%  234 aa  UBIG_ACTP7 RecName: Full=3-demethylubiquinone-9
   16::115     2e-06  36%  253 aa  UBIE_STRMK RecName: Full=Ubiquinone/menaquinone biosynthesis
   69::188     2e-06  27%  256 aa  UBIE_PSEPW RecName: Full=Ubiquinone/menaquinone biosynthesis
   69::188     2e-06  27%  256 aa  UBIE_PSEPG RecName: Full=Ubiquinone/menaquinone biosynthesis
  134::207     2e-06  37%  348 aa  GTOMC_ARATH RecName: Full=Tocopherol O-methyltransferase,
   16::130     3e-06  35%  253 aa  UBIE_XANCP RecName: Full=Ubiquinone/menaquinone biosynthesis
    1::135     3e-06  28%  242 aa  UBIG_SALPK RecName: Full=3-demethylubiquinone-9
    1::135     3e-06  28%  242 aa  UBIG_SALPA RecName: Full=3-demethylubiquinone-9
   55::133     3e-06  35%  241 aa  UBIG_ERWCT RecName: Full=3-demethylubiquinone-9
   59::137     3e-06  43%  241 aa  UBIG_BORPE RecName: Full=3-demethylubiquinone-9
   16::130     3e-06  35%  253 aa  UBIE_XANAC RecName: Full=Ubiquinone/menaquinone biosynthesis
   70::177     4e-06  32%  257 aa  UBIG_PSYA2 RecName: Full=3-demethylubiquinone-9
   30::135     4e-06  33%  258 aa  UBIE_RHIEC RecName: Full=Ubiquinone/menaquinone biosynthesis
   75::140     4e-06  39%  263 aa  UBIE_OCHA4 RecName: Full=Ubiquinone/menaquinone biosynthesis
   52::128     4e-06  31%  251 aa  UBIE_MARMS RecName: Full=Ubiquinone/menaquinone biosynthesis
   86::171     4e-06  34%  361 aa  SMT2_ARATH RecName: Full=24-methylenesterol C-methyltransferase 2; 
   70::177     6e-06  32%  257 aa  UBIG_PSYCK RecName: Full=3-demethylubiquinone-9
   69::188     6e-06  27%  256 aa  UBIE_PSEPK RecName: Full=Ubiquinone/menaquinone biosynthesis
   69::188     6e-06  27%  256 aa  UBIE_PSEP1 RecName: Full=Ubiquinone/menaquinone biosynthesis
    1::135     7e-06  28%  242 aa  UBIG_SALPC RecName: Full=3-demethylubiquinone-9
    1::135     7e-06  28%  242 aa  UBIG_SALG2 RecName: Full=3-demethylubiquinone-9
    1::135     7e-06  28%  242 aa  UBIG_SALEP RecName: Full=3-demethylubiquinone-9
    1::135     7e-06  28%  242 aa  UBIG_SALCH RecName: Full=3-demethylubiquinone-9
   57::135     7e-06  34%  239 aa  UBIG_NITMU RecName: Full=3-demethylubiquinone-9
   57::135     7e-06  33%  242 aa  UBIG_KLEP7 RecName: Full=3-demethylubiquinone-9
    7::135     7e-06  29%  240 aa  UBIG_ECO5E RecName: Full=3-demethylubiquinone-9
    7::135     7e-06  29%  240 aa  UBIG_ECO57 RecName: Full=3-demethylubiquinone-9
   41::189     7e-06  26%  252 aa  UBIG_CAUCR RecName: Full=3-demethylubiquinone-9
   41::189     7e-06  26%  252 aa  UBIG_CAUCN RecName: Full=3-demethylubiquinone-9
   69::135     7e-06  37%  258 aa  UBIE_RHIL3 RecName: Full=Ubiquinone/menaquinone biosynthesis
   52::162     7e-06  35%  243 aa  UBIE_RALME RecName: Full=Ubiquinone/menaquinone biosynthesis
   69::169     7e-06  31%  170 aa  UBIE_PSEOL RecName: Full=Ubiquinone/menaquinone biosynthesis
   62::126     7e-06  38%  249 aa  UBIE_CELJU RecName: Full=Ubiquinone/menaquinone biosynthesis
   25::173     7e-06  32%  203 aa  PIMT_METBU RecName: Full=Protein-L-isoaspartate
    7::135     1e-05  29%  240 aa  UBIG_SHIDS RecName: Full=3-demethylubiquinone-9
   57::135     1e-05  33%  242 aa  UBIG_SALAR RecName: Full=3-demethylubiquinone-9
   57::135     1e-05  33%  240 aa  UBIG_PHOLL RecName: Full=3-demethylubiquinone-9
   43::180     1e-05  24%  254 aa  UBIG_MARMM RecName: Full=3-demethylubiquinone-9
   57::135     1e-05  33%  240 aa  UBIG_ESCF3 RecName: Full=3-demethylubiquinone-9
    7::135     1e-05  29%  240 aa  UBIG_ECOUT RecName: Full=3-demethylubiquinone-9
    7::135     1e-05  29%  240 aa  UBIG_ECOLU RecName: Full=3-demethylubiquinone-9
    7::135     1e-05  29%  240 aa  UBIG_ECOLI RecName: Full=3-demethylubiquinone-9
    7::135     1e-05  29%  240 aa  UBIG_ECOL6 RecName: Full=3-demethylubiquinone-9
    7::135     1e-05  29%  240 aa  UBIG_ECOL5 RecName: Full=3-demethylubiquinone-9
    7::135     1e-05  29%  240 aa  UBIG_ECOHS RecName: Full=3-demethylubiquinone-9
    7::135     1e-05  29%  240 aa  UBIG_ECODH RecName: Full=3-demethylubiquinone-9
    7::135     1e-05  29%  240 aa  UBIG_ECOBW RecName: Full=3-demethylubiquinone-9
    7::135     1e-05  29%  240 aa  UBIG_ECO81 RecName: Full=3-demethylubiquinone-9
    7::135     1e-05  29%  240 aa  UBIG_ECO45 RecName: Full=3-demethylubiquinone-9
    7::135     1e-05  29%  240 aa  UBIG_ECO27 RecName: Full=3-demethylubiquinone-9
    7::135     1e-05  29%  240 aa  UBIG_ECO24 RecName: Full=3-demethylubiquinone-9
   16::130     1e-05  34%  253 aa  UBIE_XANOM RecName: Full=Ubiquinone/menaquinone biosynthesis
   55::235     1e-05  25%  254 aa  UBIE_THICR RecName: Full=Ubiquinone/menaquinone biosynthesis
   16::115     1e-05  34%  253 aa  UBIE_STRM5 RecName: Full=Ubiquinone/menaquinone biosynthesis
   69::135     1e-05  37%  258 aa  UBIE_RHILW RecName: Full=Ubiquinone/menaquinone biosynthesis
   52::130     1e-05  36%  237 aa  UBIG_SHEAM RecName: Full=3-demethylubiquinone-9
    1::135     1e-05  28%  242 aa  UBIG_SALTY RecName: Full=3-demethylubiquinone-9
    1::135     1e-05  28%  242 aa  UBIG_SALTI RecName: Full=3-demethylubiquinone-9
    1::135     1e-05  28%  242 aa  UBIG_SALSV RecName: Full=3-demethylubiquinone-9
    1::135     1e-05  28%  242 aa  UBIG_SALNS RecName: Full=3-demethylubiquinone-9
    1::135     1e-05  28%  242 aa  UBIG_SALHS RecName: Full=3-demethylubiquinone-9
    1::135     1e-05  28%  242 aa  UBIG_SALDC RecName: Full=3-demethylubiquinone-9
    1::135     1e-05  28%  242 aa  UBIG_SALA4 RecName: Full=3-demethylubiquinone-9
   81::146     1e-05  38%  269 aa  UBIE_BRUSI RecName: Full=Ubiquinone/menaquinone biosynthesis
   81::146     1e-05  38%  269 aa  UBIE_BRUME RecName: Full=Ubiquinone/menaquinone biosynthesis
   81::146     1e-05  38%  269 aa  UBIE_BRUMB RecName: Full=Ubiquinone/menaquinone biosynthesis
   81::146     1e-05  38%  269 aa  UBIE_BRUAB RecName: Full=Ubiquinone/menaquinone biosynthesis
   81::146     1e-05  38%  269 aa  UBIE_BRUA2 RecName: Full=Ubiquinone/menaquinone biosynthesis
   81::146     1e-05  38%  269 aa  UBIE_BRUA1 RecName: Full=Ubiquinone/menaquinone biosynthesis
   57::177     2e-05  23%  251 aa  UBIG_RICAH RecName: Full=3-demethylubiquinone-9
   57::135     2e-05  32%  242 aa  UBIG_KLEP3 RecName: Full=3-demethylubiquinone-9
   49::131     2e-05  34%  236 aa  UBIG_HAEDU RecName: Full=3-demethylubiquinone-9
   51::130     2e-05  41%  238 aa  UBIG_ACIAD RecName: Full=3-demethylubiquinone-9
   61::126     2e-05  33%  249 aa  UBIE_TERTT RecName: Full=Ubiquinone/menaquinone biosynthesis
   64::198     2e-05  26%  251 aa  UBIE_IDILO RecName: Full=Ubiquinone/menaquinone biosynthesis
  119::171     2e-05  40%  359 aa  SMT3B_ARATH RecName: Full=24-methylenesterol C-methyltransferase 3;
   48::126     2e-05  33%  232 aa  UBIG_PSEU5 RecName: Full=3-demethylubiquinone-9
   47::132     2e-05  35%  243 aa  UBIE_RALEJ RecName: Full=Ubiquinone/menaquinone biosynthesis
   65::169     3e-05  28%  248 aa  UBIG_RHIME RecName: Full=3-demethylubiquinone-9
   57::135     3e-05  29%  245 aa  UBIG_PROMH RecName: Full=3-demethylubiquinone-9
   57::135     3e-05  32%  242 aa  UBIG_CITK8 RecName: Full=3-demethylubiquinone-9
   69::189     3e-05  24%  252 aa  UBIG_CAUSK RecName: Full=3-demethylubiquinone-9
   30::135     3e-05  32%  258 aa  UBIE_RHIE6 RecName: Full=Ubiquinone/menaquinone biosynthesis
   69::203     3e-05  26%  256 aa  UBIE_PSEU2 RecName: Full=Ubiquinone/menaquinone biosynthesis
   69::203     3e-05  26%  256 aa  UBIE_PSESM RecName: Full=Ubiquinone/menaquinone biosynthesis
   69::203     3e-05  26%  256 aa  UBIE_PSE14 RecName: Full=Ubiquinone/menaquinone biosynthesis
   47::162     3e-05  34%  243 aa  UBIE_CUPTR RecName: Full=Ubiquinone/menaquinone biosynthesis
   81::146     3e-05  38%  269 aa  UBIE_BRUSU RecName: Full=Ubiquinone/menaquinone biosynthesis
   81::146     3e-05  38%  269 aa  UBIE_BRUC2 RecName: Full=Ubiquinone/menaquinone biosynthesis
   57::135     4e-05  32%  240 aa  UBIG_SHISS RecName: Full=3-demethylubiquinone-9
   57::135     4e-05  32%  240 aa  UBIG_SHIFL RecName: Full=3-demethylubiquinone-9
   57::135     4e-05  32%  240 aa  UBIG_SHIF8 RecName: Full=3-demethylubiquinone-9
   57::135     4e-05  32%  240 aa  UBIG_SHIBS RecName: Full=3-demethylubiquinone-9
   57::135     4e-05  32%  240 aa  UBIG_SHIB3 RecName: Full=3-demethylubiquinone-9
   48::126     4e-05  40%  232 aa  UBIG_PSEAB RecName: Full=3-demethylubiquinone-9
   57::135     4e-05  32%  240 aa  UBIG_ECOSM RecName: Full=3-demethylubiquinone-9
   57::135     4e-05  32%  240 aa  UBIG_ECOSE RecName: Full=3-demethylubiquinone-9
   57::135     4e-05  32%  240 aa  UBIG_ECOLC RecName: Full=3-demethylubiquinone-9
   57::135     4e-05  32%  240 aa  UBIG_ECO8A RecName: Full=3-demethylubiquinone-9
   57::135     4e-05  32%  240 aa  UBIG_ECO55 RecName: Full=3-demethylubiquinone-9
   49::127     4e-05  32%  233 aa  UBIG_AZOSB RecName: Full=3-demethylubiquinone-9
   16::141     4e-05  29%  253 aa  UBIE_XYLFM RecName: Full=Ubiquinone/menaquinone biosynthesis
   69::188     4e-05  25%  256 aa  UBIE_PSEA7 RecName: Full=Ubiquinone/menaquinone biosynthesis
   51::139     4e-05  28%  250 aa  UBIE_LEGPA RecName: Full=Ubiquinone/menaquinone biosynthesis
   48::126     5e-05  40%  232 aa  UBIG_PSEAE RecName: Full=3-demethylubiquinone-9
   48::126     5e-05  40%  232 aa  UBIG_PSEA8 RecName: Full=3-demethylubiquinone-9
   48::126     5e-05  39%  232 aa  UBIG_PSEA7 RecName: Full=3-demethylubiquinone-9
   52::130     5e-05  32%  235 aa  UBIG_PHOPR RecName: Full=3-demethylubiquinone-9
   57::135     5e-05  32%  240 aa  UBIG_ECO7I RecName: Full=3-demethylubiquinone-9
   16::141     5e-05  29%  253 aa  UBIE_XYLFA RecName: Full=Ubiquinone/menaquinone biosynthesis
   30::142     5e-05  34%  258 aa  UBIE_RHISN RecName: Full=Ubiquinone/menaquinone biosynthesis
   51::139     5e-05  28%  250 aa  UBIE_LEGPL RecName: Full=Ubiquinone/menaquinone biosynthesis
   51::139     5e-05  28%  250 aa  UBIE_LEGPC RecName: Full=Ubiquinone/menaquinone biosynthesis
   29::136     6e-05  33%  242 aa  UBIG_PASMU RecName: Full=3-demethylubiquinone-9
   58::136     6e-05  40%  243 aa  UBIG_IDILO RecName: Full=3-demethylubiquinone-9
   49::127     6e-05  42%  234 aa  UBIG_AZOSE RecName: Full=3-demethylubiquinone-9
   52::130     6e-05  32%  238 aa  UBIG_AERS4 RecName: Full=3-demethylubiquinone-9
   51::130     6e-05  40%  237 aa  UBIG_ACIBY RecName: Full=3-demethylubiquinone-9
   51::130     6e-05  40%  237 aa  UBIG_ACIBS RecName: Full=3-demethylubiquinone-9
   51::130     6e-05  40%  237 aa  UBIG_ACIB5 RecName: Full=3-demethylubiquinone-9
   51::130     6e-05  40%  237 aa  UBIG_ACIB3 RecName: Full=3-demethylubiquinone-9
   16::141     6e-05  29%  253 aa  UBIE_XYLFT RecName: Full=Ubiquinone/menaquinone biosynthesis
   16::141     6e-05  29%  253 aa  UBIE_XYLF2 RecName: Full=Ubiquinone/menaquinone biosynthesis
   61::194     6e-05  31%  258 aa  UBIE_BORPE RecName: Full=Ubiquinone/menaquinone biosynthesis
   61::194     6e-05  31%  258 aa  UBIE_BORPA RecName: Full=Ubiquinone/menaquinone biosynthesis
   61::194     6e-05  31%  258 aa  UBIE_BORBR RecName: Full=Ubiquinone/menaquinone biosynthesis
   27::132     6e-05  29%  245 aa  UBIE_BACTN RecName: Full=Menaquinone biosynthesis methyltransferase
   52::130     8e-05  35%  235 aa  UBIG_VIBPA RecName: Full=3-demethylubiquinone-9
   52::130     8e-05  32%  234 aa  UBIG_VIBFM RecName: Full=3-demethylubiquinone-9
   48::126     8e-05  39%  232 aa  UBIG_THIDA RecName: Full=3-demethylubiquinone-9
   52::130     8e-05  32%  236 aa  UBIG_SHEPA RecName: Full=3-demethylubiquinone-9
   52::130     8e-05  32%  236 aa  UBIG_SHEHH RecName: Full=3-demethylubiquinone-9
   52::130     8e-05  30%  236 aa  UBIG_SHEB9 RecName: Full=3-demethylubiquinone-9
   52::130     8e-05  30%  236 aa  UBIG_SHEB8 RecName: Full=3-demethylubiquinone-9
   52::130     8e-05  30%  236 aa  UBIG_SHEB5 RecName: Full=3-demethylubiquinone-9
   52::130     8e-05  30%  236 aa  UBIG_SHEB2 RecName: Full=3-demethylubiquinone-9
   58::135     8e-05  32%  241 aa  UBIG_SERP5 RecName: Full=3-demethylubiquinone-9
   37::142     8e-05  30%  249 aa  UBIG_METS4 RecName: Full=3-demethylubiquinone-9
   51::130     8e-05  38%  237 aa  UBIG_ACIBC RecName: Full=3-demethylubiquinone-9
   62::126     8e-05  35%  249 aa  UBIE_SACD2 RecName: Full=Ubiquinone/menaquinone biosynthesis
   69::188     8e-05  25%  256 aa  UBIE_PSEAE RecName: Full=Ubiquinone/menaquinone biosynthesis
   69::188     8e-05  25%  256 aa  UBIE_PSEAB RecName: Full=Ubiquinone/menaquinone biosynthesis
   69::188     8e-05  25%  256 aa  UBIE_PSEA8 RecName: Full=Ubiquinone/menaquinone biosynthesis
   51::139     8e-05  28%  250 aa  UBIE_LEGPH RecName: Full=Ubiquinone/menaquinone biosynthesis
   26::132     8e-05  34%  243 aa  UBIE_BURTA RecName: Full=Ubiquinone/menaquinone biosynthesis
   26::132     8e-05  34%  243 aa  UBIE_BURPS RecName: Full=Ubiquinone/menaquinone biosynthesis
   26::132     8e-05  34%  243 aa  UBIE_BURP6 RecName: Full=Ubiquinone/menaquinone biosynthesis
   26::132     8e-05  34%  243 aa  UBIE_BURP1 RecName: Full=Ubiquinone/menaquinone biosynthesis
   26::132     8e-05  34%  243 aa  UBIE_BURP0 RecName: Full=Ubiquinone/menaquinone biosynthesis
   26::132     8e-05  34%  243 aa  UBIE_BURMS RecName: Full=Ubiquinone/menaquinone biosynthesis
   26::132     8e-05  34%  243 aa  UBIE_BURMA RecName: Full=Ubiquinone/menaquinone biosynthesis
   26::132     8e-05  34%  243 aa  UBIE_BURM9 RecName: Full=Ubiquinone/menaquinone biosynthesis
   26::132     8e-05  34%  243 aa  UBIE_BURM7 RecName: Full=Ubiquinone/menaquinone biosynthesis
   26::132     8e-05  32%  243 aa  UBIE_BURM1 RecName: Full=Ubiquinone/menaquinone biosynthesis
   32::111     1e-04  32%  248 aa  YJHP_ECOLI RecName: Full=Uncharacterized protein yjhP;
   52::130     1e-04  33%  235 aa  UBIG_VIBVY RecName: Full=3-demethylubiquinone-9
   52::130     1e-04  33%  235 aa  UBIG_VIBVU RecName: Full=3-demethylubiquinone-9
   52::130     1e-04  32%  234 aa  UBIG_VIBF1 RecName: Full=3-demethylubiquinone-9
   63::142     1e-04  36%  252 aa  UBIG_RHOFD RecName: Full=3-demethylubiquinone-9
   49::158     1e-04  30%  236 aa  UBIG_HAEPS RecName: Full=3-demethylubiquinone-9
    5::141     1e-04  23%  246 aa  UBIG_COLP3 RecName: Full=3-demethylubiquinone-9
   45::132     1e-04  34%  243 aa  UBIE_BURVG RecName: Full=Ubiquinone/menaquinone biosynthesis
   52::130     1e-04  35%  235 aa  UBIG_VIBHB RecName: Full=3-demethylubiquinone-9
   64::168     1e-04  32%  248 aa  UBIG_ROSDO RecName: Full=3-demethylubiquinone-9
    3::126     1e-04  28%  249 aa  UBIE_ACICJ RecName: Full=Ubiquinone/menaquinone biosynthesis
   58::135     2e-04  32%  242 aa  UBIG_YERPY RecName: Full=3-demethylubiquinone-9
   58::135     2e-04  32%  242 aa  UBIG_YERPS RecName: Full=3-demethylubiquinone-9
   58::135     2e-04  32%  242 aa  UBIG_YERPP RecName: Full=3-demethylubiquinone-9
   58::135     2e-04  32%  242 aa  UBIG_YERPN RecName: Full=3-demethylubiquinone-9
   58::135     2e-04  32%  242 aa  UBIG_YERPG RecName: Full=3-demethylubiquinone-9
   58::135     2e-04  32%  242 aa  UBIG_YERPE RecName: Full=3-demethylubiquinone-9
   58::135     2e-04  32%  242 aa  UBIG_YERPB RecName: Full=3-demethylubiquinone-9
   58::135     2e-04  32%  242 aa  UBIG_YERPA RecName: Full=3-demethylubiquinone-9
   58::135     2e-04  32%  242 aa  UBIG_YERP3 RecName: Full=3-demethylubiquinone-9
   65::169     2e-04  29%  248 aa  UBIG_RHISN RecName: Full=3-demethylubiquinone-9
   57::135     2e-04  30%  243 aa  UBIG_ERWT9 RecName: Full=3-demethylubiquinone-9
   47::108     2e-04  37%  243 aa  UBIE_RALEH RecName: Full=Ubiquinone/menaquinone biosynthesis
   45::132     2e-04  33%  243 aa  UBIE_BURXL RecName: Full=Ubiquinone/menaquinone biosynthesis
   45::132     2e-04  33%  243 aa  UBIE_BURPP RecName: Full=Ubiquinone/menaquinone biosynthesis
   45::132     2e-04  33%  243 aa  UBIE_BURCM RecName: Full=Ubiquinone/menaquinone biosynthesis
   45::132     2e-04  33%  243 aa  UBIE_BURCH RecName: Full=Ubiquinone/menaquinone biosynthesis
   45::132     2e-04  33%  243 aa  UBIE_BURCA RecName: Full=Ubiquinone/menaquinone biosynthesis
   45::132     2e-04  33%  243 aa  UBIE_BURA4 RecName: Full=Ubiquinone/menaquinone biosynthesis
    1::140     2e-04  26%  245 aa  UBIG_VIBCM RecName: Full=3-demethylubiquinone-9
    1::140     2e-04  26%  245 aa  UBIG_VIBCH RecName: Full=3-demethylubiquinone-9
    1::140     2e-04  26%  245 aa  UBIG_VIBC3 RecName: Full=3-demethylubiquinone-9
   65::143     2e-04  32%  249 aa  UBIG_SODGM RecName: Full=3-demethylubiquinone-9
   50::129     2e-04  30%  238 aa  UBIG_HAHCH RecName: Full=3-demethylubiquinone-9
   48::126     2e-04  30%  232 aa  UBIG_CHRVO RecName: Full=3-demethylubiquinone-9
    3::98      2e-04  35%  220 aa  UBIE_THET2 RecName: Full=Menaquinone biosynthesis methyltransferase
   18::123     2e-04  25%  235 aa  UBIE_GEOSF RecName: Full=Ubiquinone/menaquinone biosynthesis
   45::132     2e-04  33%  243 aa  UBIE_BURP8 RecName: Full=Ubiquinone/menaquinone biosynthesis
   45::132     2e-04  33%  243 aa  UBIE_BURCJ RecName: Full=Ubiquinone/menaquinone biosynthesis
   45::132     2e-04  33%  243 aa  UBIE_BURCC RecName: Full=Ubiquinone/menaquinone biosynthesis
   35::119     2e-04  37%  217 aa  PIMT_METTH RecName: Full=Protein-L-isoaspartate
   58::135     3e-04  32%  242 aa  UBIG_YERE8 RecName: Full=3-demethylubiquinone-9
   36::167     3e-04  28%  247 aa  UBIG_RHOS5 RecName: Full=3-demethylubiquinone-9
   52::130     3e-04  30%  238 aa  UBIG_RALSO RecName: Full=3-demethylubiquinone-9
   52::130     3e-04  35%  236 aa  UBIG_NITOC RecName: Full=3-demethylubiquinone-9
   54::142     3e-04  35%  258 aa  UBIE_SINMW RecName: Full=Ubiquinone/menaquinone biosynthesis
   64::203     3e-04  28%  251 aa  UBIE_SERP5 RecName: Full=Ubiquinone/menaquinone biosynthesis
   68::180     3e-04  33%  236 aa  PIMT3_GEOUR RecName: Full=Protein-L-isoaspartate
   46::158     3e-04  37%  211 aa  PIMT2_POLSJ RecName: Full=Protein-L-isoaspartate
   47::139     4e-04  26%  207 aa  Y1399_STACT RecName: Full=Uncharacterized methyltransferase
   52::130     4e-04  33%  237 aa  UBIG_VIBSL RecName: Full=3-demethylubiquinone-9
   57::134     4e-04  28%  241 aa  UBIG_THICR RecName: Full=3-demethylubiquinone-9
   36::167     4e-04  27%  247 aa  UBIG_RHOSK RecName: Full=3-demethylubiquinone-9
   48::126     4e-04  30%  232 aa  UBIG_PSEU2 RecName: Full=3-demethylubiquinone-9
   48::126     4e-04  30%  232 aa  UBIG_PSE14 RecName: Full=3-demethylubiquinone-9
   50::173     4e-04  32%  238 aa  UBIG_HAES2 RecName: Full=3-demethylubiquinone-9
   52::139     4e-04  24%  251 aa  UBIE_SHESR RecName: Full=Ubiquinone/menaquinone biosynthesis
   52::139     4e-04  24%  251 aa  UBIE_SHESM RecName: Full=Ubiquinone/menaquinone biosynthesis
   52::139     4e-04  24%  251 aa  UBIE_SHESA RecName: Full=Ubiquinone/menaquinone biosynthesis
  272::318     5e-04  38%  410 aa  Y1145_PYRAB RecName: Full=Uncharacterized RNA methyltransferase
   52::130     5e-04  30%  236 aa  UBIG_SHESW RecName: Full=3-demethylubiquinone-9
   52::130     5e-04  30%  236 aa  UBIG_SHEPC RecName: Full=3-demethylubiquinone-9
   54::131     5e-04  29%  235 aa  UBIG_NITEU RecName: Full=3-demethylubiquinone-9
   50::173     5e-04  32%  238 aa  UBIG_HAES1 RecName: Full=3-demethylubiquinone-9
   48::126     5e-04  38%  232 aa  UBIG_DECAR RecName: Full=3-demethylubiquinone-9
   38::136     5e-04  27%  247 aa  UBIG_ALHEH RecName: Full=3-demethylubiquinone-9
   20::139     5e-04  22%  251 aa  UBIE_SHEFN RecName: Full=Ubiquinone/menaquinone biosynthesis
   45::132     5e-04  31%  243 aa  UBIE_BURS3 RecName: Full=Ubiquinone/menaquinone biosynthesis
   82::191     5e-04  26%  291 aa  MTL10_HUMAN RecName: Full=Methyltransferase-like protein 10;       
   45::149     5e-04  24%  202 aa  CBIT_THEAC RecName: Full=Probable cobalt-precorrin-6Y
   64::142     7e-04  32%  249 aa  UBIG_RALEJ RecName: Full=3-demethylubiquinone-9
   48::126     7e-04  33%  232 aa  UBIG_BURP8 RecName: Full=3-demethylubiquinone-9
   52::131     7e-04  37%  238 aa  UBIG_ACIAC RecName: Full=3-demethylubiquinone-9
   54::142     7e-04  35%  258 aa  UBIE_RHIME RecName: Full=Ubiquinone/menaquinone biosynthesis
   69::135     7e-04  32%  258 aa  UBIE_AGRVS RecName: Full=Ubiquinone/menaquinone biosynthesis
   70::136     7e-04  31%  259 aa  UBIE_AGRT5 RecName: Full=Ubiquinone/menaquinone biosynthesis
   30::135     7e-04  30%  258 aa  UBIE_AGRRK RecName: Full=Ubiquinone/menaquinone biosynthesis
   50::128     0.001  29%  237 aa  UBIG_METCA RecName: Full=3-demethylubiquinone-9
   52::139     0.001  23%  251 aa  UBIE_SHESW RecName: Full=Ubiquinone/menaquinone biosynthesis
   52::139     0.001  23%  251 aa  UBIE_SHEPC RecName: Full=Ubiquinone/menaquinone biosynthesis
   80::153     0.001  34%  220 aa  PIMT_PYRHO RecName: Full=Protein-L-isoaspartate
   71::170     0.001  43%  210 aa  PIMT_DESVV RecName: Full=Protein-L-isoaspartate
   71::170     0.001  43%  210 aa  PIMT_DESVH RecName: Full=Protein-L-isoaspartate
    1::418

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQEIAADPALKLAEMYMEGRAKVA
YLP3_PSEPU      ----------------------------------------------------------------------
CFA_ECOLI       -----------------------------------------------KRVLQEGSLGLGESYMDGWWECD
CFA_ECOL6       -----------------------------------------------KRVLQEGSLGLGESYMDGWWECD
MMA1_MYCTU      ----------------------------------------------------------------------
MMA1_MYCTA      ----------------------------------------------------------------------
MMA1_MYCBO      ----------------------------------------------------------------------
CFA2_MYCLE      ----------------------------------------------------------------------
CFA2_MYCTU      ----------------------------------------------------------------------
CFA2_MYCBO      ----------------------------------------------------------------------
CFA1_MYCTU      ----------------------------------------------------------------------
CFA1_MYCTA      ----------------------------------------------------------------------
ERG6_MAGGR      ----------------------------------------------------------------------
ERG6_SCHPO      ----------------------------------------------------------------------
ERG6_NEUCR      ----------------------------------------------------------------------
UBIE_PSEMY      ----------------------------------------------------------------------
ERG6_PNECA      ----------------------------------------------------------------------
SMT2_ORYSJ      ----------------------------------------------------------------------
SMT1_DICDI      ----------------------------------------------------------------------
PEAM1_ARATH     ----------------------------------------------------------------------
UBIE_AZOVD      ----------------------------------------------------------------------
SMT1_ORYSJ      ----------------------------------------------------------------------
PEAM2_ARATH     ----------------------------------------------------------------------
UBIG_BORA1      ----------------------------------------------------------------------
UBIE_PSEU5      ----------------------------------------------------------------------
UBIE_RHILO      ----------------------------------------------------------------------
UBIE_PSEFS      ----------------------------------------------------------------------
PEAMT_SPIOL     ----------------------------------------------------------------------
UBIG_PECCP      ----------------------------------------------------------------------
UBIG_COXBU      ----------------------------------------------------------------------
UBIG_COXBR      ----------------------------------------------------------------------
UBIG_COXBN      ----------------------------------------------------------------------
UBIG_COXB2      ----------------------------------------------------------------------
UBIG_COXB1      ----------------------------------------------------------------------
PEAM3_ARATH     ----------------------------------------------------------------------
ERG6_YARLI      ----------------------------------------------------------------------
UBIG_ENT38      ----------------------------------------------------------------------
UBIE_PSEPU      ----------------------------------------------------------------------
UBIE_PSEE4      ----------------------------------------------------------------------
UBIG_ACTP2      ----------------------------------------------------------------------
UBIE_PSEPF      ----------------------------------------------------------------------
SMT1_ARATH      ----------------------------------------------------------------------
UBIG_ENTS8      ----------------------------------------------------------------------
UBIG_BORPA      ----------------------------------------------------------------------
UBIG_BORBR      ----------------------------------------------------------------------
UBIG_ACTP7      ----------------------------------------------------------------------
UBIE_STRMK      ----------------------------------------------------------------------
UBIE_PSEPW      ----------------------------------------------------------------------
UBIE_PSEPG      ----------------------------------------------------------------------
GTOMC_ARATH     ----------------------------------------------------------------------
UBIE_XANCP      ----------------------------------------------------------------------
UBIG_SALPK      ----------------------------------------------------------------------
UBIG_SALPA      ----------------------------------------------------------------------
UBIG_ERWCT      ----------------------------------------------------------------------
UBIG_BORPE      ----------------------------------------------------------------------
UBIE_XANAC      ----------------------------------------------------------------------
UBIG_PSYA2      ----------------------------------------------------------------------
UBIE_RHIEC      ----------------------------------------------------------------------
UBIE_OCHA4      ----------------------------------------------------------------------
UBIE_MARMS      ----------------------------------------------------------------------
SMT2_ARATH      ----------------------------------------------------------------------
UBIG_PSYCK      ----------------------------------------------------------------------
UBIE_PSEPK      ----------------------------------------------------------------------
UBIE_PSEP1      ----------------------------------------------------------------------
UBIG_SALPC      ----------------------------------------------------------------------
UBIG_SALG2      ----------------------------------------------------------------------
UBIG_SALEP      ----------------------------------------------------------------------
UBIG_SALCH      ----------------------------------------------------------------------
UBIG_NITMU      ----------------------------------------------------------------------
UBIG_KLEP7      ----------------------------------------------------------------------
UBIG_ECO5E      ----------------------------------------------------------------------
UBIG_ECO57      ----------------------------------------------------------------------
UBIG_CAUCR      ----------------------------------------------------------------------
UBIG_CAUCN      ----------------------------------------------------------------------
UBIE_RHIL3      ----------------------------------------------------------------------
UBIE_RALME      ----------------------------------------------------------------------
UBIE_PSEOL      ----------------------------------------------------------------------
UBIE_CELJU      ----------------------------------------------------------------------
PIMT_METBU      ----------------------------------------------------------------------
UBIG_SHIDS      ----------------------------------------------------------------------
UBIG_SALAR      ----------------------------------------------------------------------
UBIG_PHOLL      ----------------------------------------------------------------------
UBIG_MARMM      ----------------------------------------------------------------------
UBIG_ESCF3      ----------------------------------------------------------------------
UBIG_ECOUT      ----------------------------------------------------------------------
UBIG_ECOLU      ----------------------------------------------------------------------
UBIG_ECOLI      ----------------------------------------------------------------------
UBIG_ECOL6      ----------------------------------------------------------------------
UBIG_ECOL5      ----------------------------------------------------------------------
UBIG_ECOHS      ----------------------------------------------------------------------
UBIG_ECODH      ----------------------------------------------------------------------
UBIG_ECOBW      ----------------------------------------------------------------------
UBIG_ECO81      ----------------------------------------------------------------------
UBIG_ECO45      ----------------------------------------------------------------------
UBIG_ECO27      ----------------------------------------------------------------------
UBIG_ECO24      ----------------------------------------------------------------------
UBIE_XANOM      ----------------------------------------------------------------------
UBIE_THICR      ----------------------------------------------------------------------
UBIE_STRM5      ----------------------------------------------------------------------
UBIE_RHILW      ----------------------------------------------------------------------
UBIG_SHEAM      ----------------------------------------------------------------------
UBIG_SALTY      ----------------------------------------------------------------------
UBIG_SALTI      ----------------------------------------------------------------------
UBIG_SALSV      ----------------------------------------------------------------------
UBIG_SALNS      ----------------------------------------------------------------------
UBIG_SALHS      ----------------------------------------------------------------------
UBIG_SALDC      ----------------------------------------------------------------------
UBIG_SALA4      ----------------------------------------------------------------------
UBIE_BRUSI      ----------------------------------------------------------------------
UBIE_BRUME      ----------------------------------------------------------------------
UBIE_BRUMB      ----------------------------------------------------------------------
UBIE_BRUAB      ----------------------------------------------------------------------
UBIE_BRUA2      ----------------------------------------------------------------------
UBIE_BRUA1      ----------------------------------------------------------------------
UBIG_RICAH      ----------------------------------------------------------------------
UBIG_KLEP3      ----------------------------------------------------------------------
UBIG_HAEDU      ----------------------------------------------------------------------
UBIG_ACIAD      ----------------------------------------------------------------------
UBIE_TERTT      ----------------------------------------------------------------------
UBIE_IDILO      ----------------------------------------------------------------------
SMT3B_ARATH     ----------------------------------------------------------------------
UBIG_PSEU5      ----------------------------------------------------------------------
UBIE_RALEJ      ----------------------------------------------------------------------
UBIG_RHIME      ----------------------------------------------------------------------
UBIG_PROMH      ----------------------------------------------------------------------
UBIG_CITK8      ----------------------------------------------------------------------
UBIG_CAUSK      ----------------------------------------------------------------------
UBIE_RHIE6      ----------------------------------------------------------------------
UBIE_PSEU2      ----------------------------------------------------------------------
UBIE_PSESM      ----------------------------------------------------------------------
UBIE_PSE14      ----------------------------------------------------------------------
UBIE_CUPTR      ----------------------------------------------------------------------
UBIE_BRUSU      ----------------------------------------------------------------------
UBIE_BRUC2      ----------------------------------------------------------------------
UBIG_SHISS      ----------------------------------------------------------------------
UBIG_SHIFL      ----------------------------------------------------------------------
UBIG_SHIF8      ----------------------------------------------------------------------
UBIG_SHIBS      ----------------------------------------------------------------------
UBIG_SHIB3      ----------------------------------------------------------------------
UBIG_PSEAB      ----------------------------------------------------------------------
UBIG_ECOSM      ----------------------------------------------------------------------
UBIG_ECOSE      ----------------------------------------------------------------------
UBIG_ECOLC      ----------------------------------------------------------------------
UBIG_ECO8A      ----------------------------------------------------------------------
UBIG_ECO55      ----------------------------------------------------------------------
UBIG_AZOSB      ----------------------------------------------------------------------
UBIE_XYLFM      ----------------------------------------------------------------------
UBIE_PSEA7      ----------------------------------------------------------------------
UBIE_LEGPA      ----------------------------------------------------------------------
UBIG_PSEAE      ----------------------------------------------------------------------
UBIG_PSEA8      ----------------------------------------------------------------------
UBIG_PSEA7      ----------------------------------------------------------------------
UBIG_PHOPR      ----------------------------------------------------------------------
UBIG_ECO7I      ----------------------------------------------------------------------
UBIE_XYLFA      ----------------------------------------------------------------------
UBIE_RHISN      ----------------------------------------------------------------------
UBIE_LEGPL      ----------------------------------------------------------------------
UBIE_LEGPC      ----------------------------------------------------------------------
UBIG_PASMU      ----------------------------------------------------------------------
UBIG_IDILO      ----------------------------------------------------------------------
UBIG_AZOSE      ----------------------------------------------------------------------
UBIG_AERS4      ----------------------------------------------------------------------
UBIG_ACIBY      ----------------------------------------------------------------------
UBIG_ACIBS      ----------------------------------------------------------------------
UBIG_ACIB5      ----------------------------------------------------------------------
UBIG_ACIB3      ----------------------------------------------------------------------
UBIE_XYLFT      ----------------------------------------------------------------------
UBIE_XYLF2      ----------------------------------------------------------------------
UBIE_BORPE      ----------------------------------------------------------------------
UBIE_BORPA      ----------------------------------------------------------------------
UBIE_BORBR      ----------------------------------------------------------------------
UBIE_BACTN      ----------------------------------------------------------------------
UBIG_VIBPA      ----------------------------------------------------------------------
UBIG_VIBFM      ----------------------------------------------------------------------
UBIG_THIDA      ----------------------------------------------------------------------
UBIG_SHEPA      ----------------------------------------------------------------------
UBIG_SHEHH      ----------------------------------------------------------------------
UBIG_SHEB9      ----------------------------------------------------------------------
UBIG_SHEB8      ----------------------------------------------------------------------
UBIG_SHEB5      ----------------------------------------------------------------------
UBIG_SHEB2      ----------------------------------------------------------------------
UBIG_SERP5      ----------------------------------------------------------------------
UBIG_METS4      ----------------------------------------------------------------------
UBIG_ACIBC      ----------------------------------------------------------------------
UBIE_SACD2      ----------------------------------------------------------------------
UBIE_PSEAE      ----------------------------------------------------------------------
UBIE_PSEAB      ----------------------------------------------------------------------
UBIE_PSEA8      ----------------------------------------------------------------------
UBIE_LEGPH      ----------------------------------------------------------------------
UBIE_BURTA      ----------------------------------------------------------------------
UBIE_BURPS      ----------------------------------------------------------------------
UBIE_BURP6      ----------------------------------------------------------------------
UBIE_BURP1      ----------------------------------------------------------------------
UBIE_BURP0      ----------------------------------------------------------------------
UBIE_BURMS      ----------------------------------------------------------------------
UBIE_BURMA      ----------------------------------------------------------------------
UBIE_BURM9      ----------------------------------------------------------------------
UBIE_BURM7      ----------------------------------------------------------------------
UBIE_BURM1      ----------------------------------------------------------------------
YJHP_ECOLI      ----------------------------------------------------------------------
UBIG_VIBVY      ----------------------------------------------------------------------
UBIG_VIBVU      ----------------------------------------------------------------------
UBIG_VIBF1      ----------------------------------------------------------------------
UBIG_RHOFD      ----------------------------------------------------------------------
UBIG_HAEPS      ----------------------------------------------------------------------
UBIG_COLP3      ----------------------------------------------------------------------
UBIE_BURVG      ----------------------------------------------------------------------
UBIG_VIBHB      ----------------------------------------------------------------------
UBIG_ROSDO      ----------------------------------------------------------------------
UBIE_ACICJ      ----------------------------------------------------------------------
UBIG_YERPY      ----------------------------------------------------------------------
UBIG_YERPS      ----------------------------------------------------------------------
UBIG_YERPP      ----------------------------------------------------------------------
UBIG_YERPN      ----------------------------------------------------------------------
UBIG_YERPG      ----------------------------------------------------------------------
UBIG_YERPE      ----------------------------------------------------------------------
UBIG_YERPB      ----------------------------------------------------------------------
UBIG_YERPA      ----------------------------------------------------------------------
UBIG_YERP3      ----------------------------------------------------------------------
UBIG_RHISN      ----------------------------------------------------------------------
UBIG_ERWT9      ----------------------------------------------------------------------
UBIE_RALEH      ----------------------------------------------------------------------
UBIE_BURXL      ----------------------------------------------------------------------
UBIE_BURPP      ----------------------------------------------------------------------
UBIE_BURCM      ----------------------------------------------------------------------
UBIE_BURCH      ----------------------------------------------------------------------
UBIE_BURCA      ----------------------------------------------------------------------
UBIE_BURA4      ----------------------------------------------------------------------
UBIG_VIBCM      ----------------------------------------------------------------------
UBIG_VIBCH      ----------------------------------------------------------------------
UBIG_VIBC3      ----------------------------------------------------------------------
UBIG_SODGM      ----------------------------------------------------------------------
UBIG_HAHCH      ----------------------------------------------------------------------
UBIG_CHRVO      ----------------------------------------------------------------------
UBIE_THET2      ----------------------------------------------------------------------
UBIE_GEOSF      ----------------------------------------------------------------------
UBIE_BURP8      ----------------------------------------------------------------------
UBIE_BURCJ      ----------------------------------------------------------------------
UBIE_BURCC      ----------------------------------------------------------------------
PIMT_METTH      ----------------------------------------------------------------------
UBIG_YERE8      ----------------------------------------------------------------------
UBIG_RHOS5      ----------------------------------------------------------------------
UBIG_RALSO      ----------------------------------------------------------------------
UBIG_NITOC      ----------------------------------------------------------------------
UBIE_SINMW      ----------------------------------------------------------------------
UBIE_SERP5      ----------------------------------------------------------------------
PIMT3_GEOUR     ----------------------------------------------------------------------
PIMT2_POLSJ     ----------------------------------------------------------------------
Y1399_STACT     ----------------------------------------------------------------------
UBIG_VIBSL      ----------------------------------------------------------------------
UBIG_THICR      ----------------------------------------------------------------------
UBIG_RHOSK      ----------------------------------------------------------------------
UBIG_PSEU2      ----------------------------------------------------------------------
UBIG_PSE14      ----------------------------------------------------------------------
UBIG_HAES2      ----------------------------------------------------------------------
UBIE_SHESR      ----------------------------------------------------------------------
UBIE_SHESM      ----------------------------------------------------------------------
UBIE_SHESA      ----------------------------------------------------------------------
Y1145_PYRAB     ----------------------------------------------------------------------
UBIG_SHESW      ----------------------------------------------------------------------
UBIG_SHEPC      ----------------------------------------------------------------------
UBIG_NITEU      ----------------------------------------------------------------------
UBIG_HAES1      ----------------------------------------------------------------------
UBIG_DECAR      ----------------------------------------------------------------------
UBIG_ALHEH      ----------------------------------------------------------------------
UBIE_SHEFN      ----------------------------------------------------------------------
UBIE_BURS3      ----------------------------------------------------------------------
MTL10_HUMAN     ----------------------------------------------------------------------
CBIT_THEAC      ----------------------------------------------------------------------
UBIG_RALEJ      ----------------------------------------------------------------------
UBIG_BURP8      ----------------------------------------------------------------------
UBIG_ACIAC      ----------------------------------------------------------------------
UBIE_RHIME      ----------------------------------------------------------------------
UBIE_AGRVS      ----------------------------------------------------------------------
UBIE_AGRT5      ----------------------------------------------------------------------
UBIE_AGRRK      ----------------------------------------------------------------------
UBIG_METCA      ----------------------------------------------------------------------
UBIE_SHESW      ----------------------------------------------------------------------
UBIE_SHEPC      ----------------------------------------------------------------------
PIMT_PYRHO      ----------------------------------------------------------------------
PIMT_DESVV      ----------------------------------------------------------------------
PIMT_DESVH      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KGDIYDFLALVKGNTLSEALSFGMIWRGMARIIAARIKMRLPVNHNKSNVAHHYDLSAKLFDLFLDEDWQ
YLP3_PSEPU      -------------------------------------------------ISYHYDVSNAFYQLWLDQDMA
CFA_ECOLI       RLDMFFSKVLRAGNQLPHHFKDTLRIAG-ARLFNLQSKKRAWIVGKE-----HYDLGNDLFSRMLDPFMQ
CFA_ECOL6       RLDMFFSKVLRAGNQLPHHFKDTLRIAG-ARLFNLQSKKRAWIVGKE-----HYDLGNDLFSRMLDPFMQ
MMA1_MYCTU      -----------------------------------------------------YDISDDFFALFLDPTWV
MMA1_MYCTA      -----------------------------------------------------YDISDDFFALFLDPTWV
MMA1_MYCBO      -----------------------------------------------------YDISDDFFALFLDPTWV
CFA2_MYCLE      -------------------------------------------------VQSHYDRSNEFFKLWLDPSMT
CFA2_MYCTU      -------------------------------------------------VRSHYDKSNEFFKLWLDPSMT
CFA2_MYCBO      -------------------------------------------------VRSHYDKSNEFFKLWLDPSMT
CFA1_MYCTU      -----------------------------------------------ANVQAHYXXXXXXXXXXXXPTQT
CFA1_MYCTA      -----------------------------------------------ANVQAHYXXXXXXXXXXXXPTQT
ERG6_MAGGR      ----------------------------------------------------------------------
ERG6_SCHPO      ----------------------------------------------KSVVNSYYDLATDLYEYGWSQSFH
ERG6_NEUCR      ---------------------------------------------------HYYNLATDIYEYGWGQCFH
UBIE_PSEMY      ----------------------------------------------------------------------
ERG6_PNECA      ---------------------------------------------------HYYNLVTDFYEYGWSTSFH
SMT2_ORYSJ      ----------------------------------------------------------------------
SMT1_DICDI      ------------------------------------------IQARKNNYTHMVNTFYDLATDFYEFGWG
PEAM1_ARATH     ----------------------------------------------------------------------
UBIE_AZOVD      ----------------------------------------------------------------------
SMT1_ORYSJ      -------------------------------------------------VNKYYDLATSFYEYGWGESFH
PEAM2_ARATH     ----------------------------------------------------------------------
UBIG_BORA1      ----------------------------------------------------------------------
UBIE_PSEU5      ----------------------------------------------------------------------
UBIE_RHILO      ------------------------------------------VNDVFHKVANRYDLMNDLMSAGLHRLWK
UBIE_PSEFS      ----------------------------------------------------------------------
PEAMT_SPIOL     ----------------------------------------------------------------------
UBIG_PECCP      ----------------------------------------------------------------------
UBIG_COXBU      ----------------------------------------------------------------LAQDWW
UBIG_COXBR      ----------------------------------------------------------------LAQDWW
UBIG_COXBN      ----------------------------------------------------------------LAQDWW
UBIG_COXB2      ----------------------------------------------------------------LAQDWW
UBIG_COXB1      ----------------------------------------------------------------LAQDWW
PEAM3_ARATH     ----------------------------------------------------------------------
ERG6_YARLI      ---------------------------------------------------HYYNLVTDFYEYGWGSSFH
UBIG_ENT38      ------------------------------------------MNAEKSPVAHNVDAEIAKFEAVASRWWD
UBIE_PSEPU      ----------------------------------------------------------------------
UBIE_PSEE4      ----------------------------------------------------------------------
UBIG_ACTP2      ----------------------------------------------------------------------
UBIE_PSEPF      ----------------------------------------------------------------------
SMT1_ARATH      -------------------------------------------------VNKYYDLATSFYEYGWGESFH
UBIG_ENTS8      ------------------------------------------MNAEKPPVAHNVDLEEIAKFEAVASRWW
UBIG_BORPA      ----------------------------------------------------------------------
UBIG_BORBR      ----------------------------------------------------------------------
UBIG_ACTP7      ----------------------------------------------------------------------
UBIE_STRMK      ------------------------------RDVAAKDKQKL-VGQVFTSVARNYDLMNDLMSLGVHRAW-
UBIE_PSEPW      ----------------------------------------------------------------------
UBIE_PSEPG      ----------------------------------------------------------------------
GTOMC_ARATH     ----------------------------------------------------------------------
UBIE_XANCP      ------------------------------RDVAAKDKQKL-VGEVFTSVARNYDLMNDLMSLGIHRAW-
UBIG_SALPK      ------------------------------------------MNTEKPSVAHNVDHNEAKFEAVASRWWD
UBIG_SALPA      ------------------------------------------MNTEKPSVAHNVDHNEAKFEAVASRWWD
UBIG_ERWCT      ----------------------------------------------------------------------
UBIG_BORPE      ----------------------------------------------------------------------
UBIE_XANAC      ------------------------------RDVAAKDKQKL-VGEVFTSVARNYDLMNDLMSLGVHRAW-
UBIG_PSYA2      ----------------------------------------------------------------------
UBIE_RHIEC      ------------------------------------------VNQVFHKVAKRYDIMNDVMSMGMHRAWK
UBIE_OCHA4      ----------------------------------------------------------------------
UBIE_MARMS      ----------------------------------------------------------------------
SMT2_ARATH      -------------------------------------------------------------------EWG
UBIG_PSYCK      ----------------------------------------------------------------------
UBIE_PSEPK      ----------------------------------------------------------------------
UBIE_PSEP1      ----------------------------------------------------------------------
UBIG_SALPC      ------------------------------------------MNTEKPSVAHNVDHNEAKFEAVASRWWD
UBIG_SALG2      ------------------------------------------MNTEKPSVAHNVDHNEAKFEAVASRWWD
UBIG_SALEP      ------------------------------------------MNTEKPSVAHNVDHNEAKFEAVASRWWD
UBIG_SALCH      ------------------------------------------MNTEKPSVAHNVDHNEAKFEAVASRWWD
UBIG_NITMU      ----------------------------------------------------------------------
UBIG_KLEP7      ----------------------------------------------------------------------
UBIG_ECO5E      -----------------------------------------PVNHN----VDHEEIAK--FEAVASRWWD
UBIG_ECO57      -----------------------------------------PVNHN----VDHEEIAK--FEAVASRWWD
UBIG_CAUCR      ----------------------------------------------------------------------
UBIG_CAUCN      ----------------------------------------------------------------------
UBIE_RHIL3      ----------------------------------------------------------------------
UBIE_RALME      ----------------------------------------------------------------------
UBIE_PSEOL      ----------------------------------------------------------------------
UBIE_CELJU      ----------------------------------------------------------------------
PIMT_METBU      --------------------------------------------------------------LFLPEDMQ
UBIG_SHIDS      -----------------------------------------PVNHN----VDHEEIAK--FEAVASRWWD
UBIG_SALAR      ----------------------------------------------------------------------
UBIG_PHOLL      ----------------------------------------------------------------------
UBIG_MARMM      ----------------------------------------------------------------------
UBIG_ESCF3      ----------------------------------------------------------------------
UBIG_ECOUT      -----------------------------------------PVNHN----VDHEEIAK--FEAVASRWWD
UBIG_ECOLU      -----------------------------------------PVNHN----VDHEEIAK--FEAVASRWWD
UBIG_ECOLI      -----------------------------------------PVNHN----VDHEEIAK--FEAVASRWWD
UBIG_ECOL6      -----------------------------------------PVNHN----VDHEEIAK--FEAVASHWWD
UBIG_ECOL5      -----------------------------------------PVNHN----VDHKEIAK--FEAVASRWWD
UBIG_ECOHS      -----------------------------------------PVNHN----VDHEEIAK--FEAVASRWWD
UBIG_ECODH      -----------------------------------------PVNHN----VDHEEIAK--FEAVASRWWD
UBIG_ECOBW      -----------------------------------------PVNHN----VDHEEIAK--FEAVASRWWD
UBIG_ECO81      -----------------------------------------PVNHN----VDHKEIAK--FEAVASRWWD
UBIG_ECO45      -----------------------------------------PVNHN----VDHEEIAK--FEAVASRWWD
UBIG_ECO27      -----------------------------------------PVNHN----VDHEEIAK--FEAVASRWWD
UBIG_ECO24      -----------------------------------------PVNHN----VDHEEIAK--FEAVASRWWD
UBIE_XANOM      ------------------------------RDVAAKDKQKL-VGEVFTSVARNYDLMNDLMSLGVHRAW-
UBIE_THICR      ----------------------------------------------------------------------
UBIE_STRM5      ------------------------------RDVAAKDKQKL-VGQVFTSVARNYDLMNDLMSMGVHRAW-
UBIE_RHILW      ----------------------------------------------------------------------
UBIG_SHEAM      ----------------------------------------------------------------------
UBIG_SALTY      ------------------------------------------MNTEKPSVAHNVDHNEAKFEAVASRWWD
UBIG_SALTI      ------------------------------------------MNTEKPSVAHNVDHNEAKFEAVASRWWD
UBIG_SALSV      ------------------------------------------MNTEKPSVAHNVDHNEAKFEAVASRWWD
UBIG_SALNS      ------------------------------------------MNTEKPSVAHNVDHNEAKFEAVASRWWD
UBIG_SALHS      ------------------------------------------MNTEKPSVAHNVDHNEAKFEAVASRWWD
UBIG_SALDC      ------------------------------------------MNTEKPSVAHNVDHNEAKFEAVASRWWD
UBIG_SALA4      ------------------------------------------MNTEKPSVAHNVDHNEAKFEAVASRWWD
UBIE_BRUSI      ----------------------------------------------------------------------
UBIE_BRUME      ----------------------------------------------------------------------
UBIE_BRUMB      ----------------------------------------------------------------------
UBIE_BRUAB      ----------------------------------------------------------------------
UBIE_BRUA2      ----------------------------------------------------------------------
UBIE_BRUA1      ----------------------------------------------------------------------
UBIG_RICAH      ----------------------------------------------------------------------
UBIG_KLEP3      ----------------------------------------------------------------------
UBIG_HAEDU      ----------------------------------------------------------------------
UBIG_ACIAD      ----------------------------------------------------------------------
UBIE_TERTT      ----------------------------------------------------------------------
UBIE_IDILO      ----------------------------------------------------------------------
SMT3B_ARATH     ----------------------------------------------------------------------
UBIG_PSEU5      ----------------------------------------------------------------------
UBIE_RALEJ      ----------------------------------------------------------------------
UBIG_RHIME      ----------------------------------------------------------------------
UBIG_PROMH      ----------------------------------------------------------------------
UBIG_CITK8      ----------------------------------------------------------------------
UBIG_CAUSK      ----------------------------------------------------------------------
UBIE_RHIE6      ------------------------------------------VNQVFHKVAKRYDIMNDVMSMGMHRVWK
UBIE_PSEU2      ----------------------------------------------------------------------
UBIE_PSESM      ----------------------------------------------------------------------
UBIE_PSE14      ----------------------------------------------------------------------
UBIE_CUPTR      ----------------------------------------------------------------------
UBIE_BRUSU      ----------------------------------------------------------------------
UBIE_BRUC2      ----------------------------------------------------------------------
UBIG_SHISS      ----------------------------------------------------------------------
UBIG_SHIFL      ----------------------------------------------------------------------
UBIG_SHIF8      ----------------------------------------------------------------------
UBIG_SHIBS      ----------------------------------------------------------------------
UBIG_SHIB3      ----------------------------------------------------------------------
UBIG_PSEAB      ----------------------------------------------------------------------
UBIG_ECOSM      ----------------------------------------------------------------------
UBIG_ECOSE      ----------------------------------------------------------------------
UBIG_ECOLC      ----------------------------------------------------------------------
UBIG_ECO8A      ----------------------------------------------------------------------
UBIG_ECO55      ----------------------------------------------------------------------
UBIG_AZOSB      ----------------------------------------------------------------------
UBIE_XYLFM      ------------------------------RQVAAKDKKTL-VAEVFTSVSRRYDLMNDLMSLGIHRAW-
UBIE_PSEA7      ----------------------------------------------------------------------
UBIE_LEGPA      ----------------------------------------------------------------------
UBIG_PSEAE      ----------------------------------------------------------------------
UBIG_PSEA8      ----------------------------------------------------------------------
UBIG_PSEA7      ----------------------------------------------------------------------
UBIG_PHOPR      ----------------------------------------------------------------------
UBIG_ECO7I      ----------------------------------------------------------------------
UBIE_XYLFA      ------------------------------RQVAAKDKKTL-VAEVFTSVSRRYDLMNDLMSLGIHRAW-
UBIE_RHISN      ------------------------------------------VNDVFHKVAKRYDVMNDVMSAGLHRVWK
UBIE_LEGPL      ----------------------------------------------------------------------
UBIE_LEGPC      ----------------------------------------------------------------------
UBIG_PASMU      ----------------------------------------------------------------------
UBIG_IDILO      ----------------------------------------------------------------------
UBIG_AZOSE      ----------------------------------------------------------------------
UBIG_AERS4      ----------------------------------------------------------------------
UBIG_ACIBY      ----------------------------------------------------------------------
UBIG_ACIBS      ----------------------------------------------------------------------
UBIG_ACIB5      ----------------------------------------------------------------------
UBIG_ACIB3      ----------------------------------------------------------------------
UBIE_XYLFT      ------------------------------RQVAAKDKKTL-VAEVFTSVSRRYDLMNDLMSLGIHRAW-
UBIE_XYLF2      ------------------------------RQVAAKDKKTL-VAEVFTSVSRRYDLMNDLMSLGIHRAW-
UBIE_BORPE      ----------------------------------------------------------------------
UBIE_BORPA      ----------------------------------------------------------------------
UBIE_BORBR      ----------------------------------------------------------------------
UBIE_BACTN      ------------------------------------------------NIAHAYDKLNHTLSLGIDRSW-
UBIG_VIBPA      ----------------------------------------------------------------------
UBIG_VIBFM      ----------------------------------------------------------------------
UBIG_THIDA      ----------------------------------------------------------------------
UBIG_SHEPA      ----------------------------------------------------------------------
UBIG_SHEHH      ----------------------------------------------------------------------
UBIG_SHEB9      ----------------------------------------------------------------------
UBIG_SHEB8      ----------------------------------------------------------------------
UBIG_SHEB5      ----------------------------------------------------------------------
UBIG_SHEB2      ----------------------------------------------------------------------
UBIG_SERP5      ----------------------------------------------------------------------
UBIG_METS4      ----------------------------------------------------------------------
UBIG_ACIBC      ----------------------------------------------------------------------
UBIE_SACD2      ----------------------------------------------------------------------
UBIE_PSEAE      ----------------------------------------------------------------------
UBIE_PSEAB      ----------------------------------------------------------------------
UBIE_PSEA8      ----------------------------------------------------------------------
UBIE_LEGPH      ----------------------------------------------------------------------
UBIE_BURTA      ------------------------------------------------SVASNYDLMNDLMSAGLHRAW-
UBIE_BURPS      ------------------------------------------------SVASNYDLMNDLMSAGLHRAW-
UBIE_BURP6      ------------------------------------------------SVASNYDLMNDLMSAGLHRAW-
UBIE_BURP1      ------------------------------------------------SVASNYDLMNDLMSAGLHRAW-
UBIE_BURP0      ------------------------------------------------SVASNYDLMNDLMSAGLHRAW-
UBIE_BURMS      ------------------------------------------------SVASNYDLMNDLMSAGLHRAW-
UBIE_BURMA      ------------------------------------------------SVASNYDLMNDLMSAGLHRAW-
UBIE_BURM9      ------------------------------------------------SVASNYDLMNDLMSAGLHRAW-
UBIE_BURM7      ------------------------------------------------SVASNYDLMNDLMSAGLHRAW-
UBIE_BURM1      ------------------------------------------------SVANNYDLMNDLMSAGMHRAW-
YJHP_ECOLI      ----------------------------------------------------------------------
UBIG_VIBVY      ----------------------------------------------------------------------
UBIG_VIBVU      ----------------------------------------------------------------------
UBIG_VIBF1      ----------------------------------------------------------------------
UBIG_RHOFD      ----------------------------------------------------------------------
UBIG_HAEPS      ----------------------------------------------------------------------
UBIG_COLP3      -----------------------------------------PLNVNEDEIAKFEQVASQWWDLTGDFKPL
UBIE_BURVG      ----------------------------------------------------------------------
UBIG_VIBHB      ----------------------------------------------------------------------
UBIG_ROSDO      ----------------------------------------------------------------------
UBIE_ACICJ      -------------DTSSETVDFGFS-------TVPRGEKRHKVREVFDSVAGRYDIMNDLMSLGVHRLW-
UBIG_YERPY      ----------------------------------------------------------------------
UBIG_YERPS      ----------------------------------------------------------------------
UBIG_YERPP      ----------------------------------------------------------------------
UBIG_YERPN      ----------------------------------------------------------------------
UBIG_YERPG      ----------------------------------------------------------------------
UBIG_YERPE      ----------------------------------------------------------------------
UBIG_YERPB      ----------------------------------------------------------------------
UBIG_YERPA      ----------------------------------------------------------------------
UBIG_YERP3      ----------------------------------------------------------------------
UBIG_RHISN      ----------------------------------------------------------------------
UBIG_ERWT9      ----------------------------------------------------------------------
UBIE_RALEH      ----------------------------------------------------------------------
UBIE_BURXL      ----------------------------------------------------------------------
UBIE_BURPP      ----------------------------------------------------------------------
UBIE_BURCM      ----------------------------------------------------------------------
UBIE_BURCH      ----------------------------------------------------------------------
UBIE_BURCA      ----------------------------------------------------------------------
UBIE_BURA4      ----------------------------------------------------------------------
UBIG_VIBCM      ----------------------------MASIDLASTPLTATQNVDPNEIKKFEDMASRWWDLEGE----
UBIG_VIBCH      ----------------------------MASIDLASTPLTATQNVDPNEIKKFEDMASRWWDLEGE----
UBIG_VIBC3      ----------------------------MASIDLASTPLTATQNVDPNEIKKFEDMASRWWDLEGE----
UBIG_SODGM      ----------------------------------------------------------------------
UBIG_HAHCH      ----------------------------------------------------------------------
UBIG_CHRVO      ----------------------------------------------------------------------
UBIE_THET2      -----------------------------------------------SEIAPRYDLLNRLLSFGADLRW-
UBIE_GEOSF      -------------------------------------------------IAPRYDFLNRVLSFGIDRSW-
UBIE_BURP8      ----------------------------------------------------------------------
UBIE_BURCJ      ----------------------------------------------------------------------
UBIE_BURCC      ----------------------------------------------------------------------
PIMT_METTH      ---------------------------------------------------------------FVPEDEM
UBIG_YERE8      ----------------------------------------------------------------------
UBIG_RHOS5      ----------------------------------------------------------------------
UBIG_RALSO      ----------------------------------------------------------------------
UBIG_NITOC      ----------------------------------------------------------------------
UBIE_SINMW      ----------------------------------------------------------------------
UBIE_SERP5      ----------------------------------------------------------------------
PIMT3_GEOUR     ----------------------------------------------------------------------
PIMT2_POLSJ     ----------------------------------------------------------------------
Y1399_STACT     ----------------------------------------------------------------------
UBIG_VIBSL      ----------------------------------------------------------------------
UBIG_THICR      ----------------------------------------------------------------------
UBIG_RHOSK      ----------------------------------------------------------------------
UBIG_PSEU2      ----------------------------------------------------------------------
UBIG_PSE14      ----------------------------------------------------------------------
UBIG_HAES2      ----------------------------------------------------------------------
UBIE_SHESR      ----------------------------------------------------------------------
UBIE_SHESM      ----------------------------------------------------------------------
UBIE_SHESA      ----------------------------------------------------------------------
Y1145_PYRAB     ----------------------------------------------------------------------
UBIG_SHESW      ----------------------------------------------------------------------
UBIG_SHEPC      ----------------------------------------------------------------------
UBIG_NITEU      ----------------------------------------------------------------------
UBIG_HAES1      ----------------------------------------------------------------------
UBIG_DECAR      ----------------------------------------------------------------------
UBIG_ALHEH      ----------------------------------------------------------------------
UBIE_SHEFN      ----------------------------------------------------------KKADLVADVFHS
UBIE_BURS3      ----------------------------------------------------------------------
MTL10_HUMAN     ----------------------------------------------------------------------
CBIT_THEAC      ----------------------------------------------------------------------
UBIG_RALEJ      ----------------------------------------------------------------------
UBIG_BURP8      ----------------------------------------------------------------------
UBIG_ACIAC      ----------------------------------------------------------------------
UBIE_RHIME      ----------------------------------------------------------------------
UBIE_AGRVS      ----------------------------------------------------------------------
UBIE_AGRT5      ----------------------------------------------------------------------
UBIE_AGRRK      ------------------------------------------VNEVFHKVAKRYDIMNDVMSMGLHRAWK
UBIG_METCA      ----------------------------------------------------------------------
UBIE_SHESW      ----------------------------------------------------------------------
UBIE_SHEPC      ----------------------------------------------------------------------
PIMT_PYRHO      ----------------------------------------------------------------------
PIMT_DESVV      ----------------------------------------------------------------------
PIMT_DESVH      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           YSCAYFNPPDIGLYEAQVAKKRHIAAKLMTEPGQSVLEIGSGWGGMAMYIAESAGADVTGITLSEEQLRV
YLP3_PSEPU      YSCAYFREPDNTLDQAQQDKFDHLCRKLRLNAGDYLLDVGCGWGGLARFAAREYDAKVFGITLSKEQLKL
CFA_ECOLI       YSCAYWKDAD-NLESAQQAKLKMICEKLQLKPGMRVLDIGCGWGGLAHYMASNYDVSVVGVTISAEQQKM
CFA_ECOL6       YSCAYWKDAD-NLESAQQAKLKMICEKLQLKPGMRVLDIGCGWGGLAHYMASNYDVSVVGVTISAEQQKM
MMA1_MYCTU      YTCAYFERDDMTLEEAQLAKVDLALDKLNLEPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHYER
MMA1_MYCTA      YTCAYFERDDMTLEEAQLAKVDLALDKLNLEPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHYER
MMA1_MYCBO      YTCAYFERDDMTLEEAQLAKVDLALDKLNLEPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHYER
CFA2_MYCLE      YSCAYFERPDLTLEEAQRAKRDLALSKLGLEPGMTLLDIGCGWGSTMLHAIEKYDVNVIGLTLSANQLAH
CFA2_MYCTU      YSCAYFERPDMTLEEAQYAKRKLALDKLNLEPGMTLLDIGCGWGSTMRHAVAEYDVNVIGLTLSENQ--Y
CFA2_MYCBO      YSCAYFERPDMTLEEAQYAKRKLALDKLNLEPGMTLLDIGCGWGSTMRHAVAEYDVNVIGLTLSENQ--Y
CFA1_MYCTU      YSCAYFERDDMTLQEAQIAKIDLALGKLGLQPGMTLLDVGCGWGATMMRAVEKYDVNVVGLTLSKNQANH
CFA1_MYCTA      YSCAYFERDDMTLQEAQIAKIDLALGKLGLQPGMTLLDVGCGWGATMMRAVEKYDVNVVGLTLSKNQANH
ERG6_MAGGR      -------------FASAITRYEHLAHRIGIKKGMKVLDIGCGVGGPARQIAKFTGANITGITINEYQVER
ERG6_SCHPO      FSRFYKGEA----FAQSIARHEHLAYRMGIKPGSRVLDVGCGVGGPAREITEFTGCNLVGLNNNDYQISR
ERG6_NEUCR      F-CRY--SPGESFYQAIARHEHYLAAQIGIKKDMKVLDVGCGVGGPAREIAKFTDAHITGLNNNDYQIDR
UBIE_PSEMY      -------------------------------PGNRVLDIAGGTGDLTRKFASIVGGEVVLADINDSMLKV
ERG6_PNECA      F-CRFAK--DESFSQAIARHEHYIALHAGIREGETVLDVGCGVGGPACQISVFTGANIVGLNNNDYQIQR
SMT2_ORYSJ      ----HFSPPGRSHREATRVHEERVADLLQAKPGHRLLDVGCGVGGPMRAIAAHSGSNVVGITINEYQVNR
SMT1_DICDI      QSFHFATRHKYESFEASIAREMYMAHQLGLFPGMKVIDIGCGVGGPMRTIARFSGANVVGLNNNEYQIQR
PEAM1_ARATH     ---------------------KEFVEKMNLKPGQKVLDVGCGIGGGDFYMAEKFDVHVVGIDLSVNMISF
UBIE_AZOVD      --------------------------------GNRVLDIAGGTGDLTLQFSRLVGGEVLLADINDSMLKV
SMT1_ORYSJ      FAHRWNGE---SLRESIKRHEHFLALQLGVKPGMKVLDVGCGIGGPLREIAKFSLASVTGLNNNEYQITR
PEAM2_ARATH     ---------------------KEFVAKMDLKPGQKVLDVGCGIGGGDFYMAENFDVHVVGIDLSVNMISF
UBIG_BORA1      --------------------------------GRRVLDVGCGGGILSEAMAQ-AGADVTGIDLAEKSLKI
UBIE_PSEU5      --------------------------------GNRILDIAGGTGDLTRQFSRIVGGEVVLADINASMLKV
UBIE_RHILO      DAMVWLNPPK--------------------RPGWKVLDVAGGTGDIAFRIVDASNAHATVLDINGSMLGV
UBIE_PSEFS      --------------------------------GNRVLDIAGGTGDLAAKFSKLVGGQVVLADINGSMLKV
PEAMT_SPIOL     ---------------------KEFVSKLDLKPGQKVLDVGCGIGGGDFYMAENYDVEVVGIDLSINMISF
UBIG_PECCP      --------------------------------GKKVLDVGCGGGILAESMARE-GADVTGLDMGAEPLQV
UBIG_COXBU      NPAGKMKP----LHLINPVRLKYIEQQI-TLKGKHVLDVGCGGGLLSEALAKH-GAIVTGVDMSESLIDV
UBIG_COXBR      NPAGKMKP----LHLINPVRLKYIEQQI-TLKGKHVLDVGCGGGLLSEALAKH-GAIVTGVDMSESLIDV
UBIG_COXBN      NPAGKMKP----LHLINPVRLKYIEQQI-TLKGKHVLDVGCGGGLLSEALAKH-GAIVTGVDMSESLIDV
UBIG_COXB2      NPAGKMKP----LHLINPVRLKYIEQQI-TLKGKHVLDVGCGGGLLSEALAKH-GAIVTGVDMSESLIDV
UBIG_COXB1      NPAGKMKP----LHLINPVRLKYIEQQI-TLKGKHVLDVGCGGGLLSEALAKH-GAIVTGVDMSESLIDV
PEAM3_ARATH     ------------------------------KPGQKVLDVGCGIGGGDFYMAENFDVDVVGIDLSVNMISF
ERG6_YARLI      FSRYYKGE---AFRQATARHEHYLAYKMGIQPGMKVLDVGCGVGGPAREIARFTGANIVGLNNNDYQVER
UBIG_ENT38      LD-GEFKP----LHRINPLRLGYIAERSGGLFGKKVLDVGCGGGILAESMARE-GATVTGLDMGFEPLQV
UBIE_PSEPU      --------------------------------GNRVLDIAGGTGDLAAKFSRLVGGQVVLADINESMLKV
UBIE_PSEE4      --------------------------------GNRVLDIAGGTGDLAAKFSRLVGGQVVLADINESMLKV
UBIG_ACTP2      --------------------------------GKKVLDVGCG-GGILSEAMARAGATVTGIDMTTEPLEV
UBIE_PSEPF      --------------------------------GNRVLDIAGGTGDLTKKFSHLVGGQVVLADINESMLKV
SMT1_ARATH      FAQRWKGE---SLRESIKRHEHFLALQLGIQPGQKVLDVGCGIGGPLREIARFSNSVVTGLNNNEYQITR
UBIG_ENTS8      DTEGEFKP----LHRINPLRLGYIAERAGGLFGKKVLDVGCGGGILSESMARE-GANVTGLDMGAEPLAV
UBIG_BORPA      --------------------------------GKRVLDVGCG-GGILSESMAVAGAQVTGIDLAEKSLKI
UBIG_BORBR      --------------------------------GKRVLDVGCG-GGILSESMAVAGAQVTGIDLAEKSLKI
UBIG_ACTP7      --------------------------------GKKVLDVGCG-GGILSEAMAKAGANVTGIDMTTEPLDV
UBIE_STRMK      --------------------KRYYVATAQVKPGDRVLDLAGGTGDIAALLKERVGAEGSVVDINAGMLSV
UBIE_PSEPW      --------------------------------GNRVLDIAGGTGDLAAKFSRLVGGQVVLADINDSMLKV
UBIE_PSEPG      --------------------------------GNRVLDIAGGTGDLAAKFSRLVGGQVVLADINDSMLKV
GTOMC_ARATH     ---------------------------------------GCGIGGSSRYLASKFGAECIGITLSPVQAKR
UBIE_XANCP      --------------------KRYFVATAQVKPGDRVLDLAGGTGDIAVLLKENEGAVVLG-DINAGMLSV
UBIG_SALPK      LE-GEFKP----LHRINPLRLGYITERSGGLFGKKVLDVGCGGGILAESMARE-GATVTGLDMGFEPLQV
UBIG_SALPA      LE-GEFKP----LHRINPLRLGYITERSGGLFGKKVLDVGCGGGILAESMARE-GATVTGLDMGFEPLQV
UBIG_ERWCT      --------------------------------GKKVLDVGCGGGILAESMARE-GADVTGLDMGAEPLQV
UBIG_BORPE      --------------------------------GKRVLDMGCG-GGILSESMAVAGAQVTGIDLAEKSLKI
UBIE_XANAC      --------------------KRYFVATAQVKPGDRVLDLAGGTGDIAVLLKENEGAVVLG-DINAGMLSV
UBIG_PSYA2      --------------------------------GKKVLDVGCG-GGILSEAMARRGADVTGIDLGTENLKA
UBIE_RHIEC      --------------DAMIA-----ALNPRKEPGYKVLDVAGGTGDIAFRIVEASGAHATVLDINGSMLGV
UBIE_OCHA4      -------------------------------PGWTSLDVAGGTGDIAFRIVEASGAHVTILDINGSMLGV
UBIE_MARMS      --------------------KRHTISQSGVRAGNCVLDIAGGTGDLTVKFSRLVGSEVILADINDSMLKV
SMT2_ARATH      WGQSFHFSPSIPGKSHKDATRLHMAVDLIVKPGQKILDVGCGVGGPMRAIASHSRANVVGITINEYQVNR
UBIG_PSYCK      --------------------------------GKKVLDVGCGGGILSESMARR-GADVTGIDLGTENLKA
UBIE_PSEPK      --------------------------------GNRVLDIAGGTGDLAAKFSRLVGGQVVLADINDSMLKV
UBIE_PSEP1      --------------------------------GNRVLDIAGGTGDLAAKFSRLVGGQVVLADINDSMLKV
UBIG_SALPC      LE-GEFKP----LHRINPLRLGYITERSGGLFGKKVLDVGCGGGILAESMARE-GATVTGLDMGFEPLQV
UBIG_SALG2      LE-GEFKP----LHRINPLRLGYITERSGGLFGKKVLDVGCGGGILAESMARE-GATVTGLDMGFEPLQV
UBIG_SALEP      LE-GEFKP----LHRINPLRLGYITERSGGLFGKKVLDVGCGGGILAESMARE-GATVTGLDMGFEPLQV
UBIG_SALCH      LE-GEFKP----LHRINPLRLGYITERSGGLFGKKVLDVGCGGGILAESMARE-GATVTGLDMGFEPLQV
UBIG_NITMU      --------------------------------GKDVLDVGCGGGILSESMAES-GAQVTGIDLGDKALKV
UBIG_KLEP7      --------------------------------GKKVLDVGCGGGILAESMARE-GATVTGLDMGAEPLQV
UBIG_ECO5E      LE-GEFKP----LHRINPLRLSYIAERAGGLFGKKVLDVGCGGGILAESMARE-GATVTGLDMGFEPLQV
UBIG_ECO57      LE-GEFKP----LHRINPLRLSYIAERAGGLFGKKVLDVGCGGGILAESMARE-GATVTGLDMGFEPLQV
UBIG_CAUCR      -----FNPCRLAFIREQALARRDGAARAPFE-GLTLLDIGCG-GGLLSEPMARLGFAVTAIDASEKNIKT
UBIG_CAUCN      -----FNPCRLAFIREQALARRDGAARAPFE-GLTLLDIGCG-GGLLSEPMARLGFAVTAIDASEKNIKT
UBIE_RHIL3      ------------------------------EPGYKVLDVAGGTGDIAFRIVEASGAHATVLDINGSMLGV
UBIE_RALME      -------------------------AQANVRPGQKVLDIAGGTGDLAKAFAKQAGGEVWLTDINESMLRV
UBIE_PSEOL      --------------------------------GNRVLDIAGGTGDLAAKFSRLVGGQVVLADINESMLKV
UBIE_CELJU      --------------------------------GHKVLDIAGGTGDLSYQFARLVGSSVILADINASMLGV
PIMT_METBU      -SFAYADTPLPIGYDQTISAPHMVAIMLKITEGMTILEIGSGSGYNAAVMAELAGENGKVYTVERELVDL
UBIG_SHIDS      LE-GEFKP----LHRINPLRLGYIAERAGGLFGKKVLDVGCGGGILAESMARE-GATVTGLDMGFEPLQV
UBIG_SALAR      --------------------------------GKKVLDVGCGGGILAESMARE-GATVTGLDMGFEPLQV
UBIG_PHOLL      --------------------------------GKKVLDVGCGGGILSESMARE-GADVTGLDMGTEPLQV
UBIG_MARMM      -----FNPIRLGFMRDTICDHFGLSGERPFE-GLRILDIGCG-GGLVCEPMARLGAHVTGVDAAEANIKT
UBIG_ESCF3      --------------------------------GKKVLDVGCGGGILAESMARE-GATVTGLDMGFEPLQV
UBIG_ECOUT      LE-GEFKP----LHRINPLRLGYIAERAGGLFGKKVLDVGCGGGILAESMARE-GATVTGLDMGFEPLQV
UBIG_ECOLU      LE-GEFKP----LHRINPLRLGYIAERAGGLFGKKVLDVGCGGGILAESMARE-GATVTGLDMGFEPLQV
UBIG_ECOLI      LE-GEFKP----LHRINPLRLGYIAERAGGLFGKKVLDVGCGGGILAESMARE-GATVTGLDMGFEPLQV
UBIG_ECOL6      LE-GEFKP----LHRINPLRLGYIAERAGGLFGKKVLDVGCGGGILAESMARE-GATVTGLDMGFEPLQV
UBIG_ECOL5      LE-GEFKP----LHRINPLRLGYIAERAGGLFGKKVLDVGCGGGILAESMARE-GATVTGLDMGFEPLQV
UBIG_ECOHS      LE-GEFKP----LHRINPLRLGYIAERAGGLFGKKVLDVGCGGGILAESMARE-GATVTGLDMGFEPLQV
UBIG_ECODH      LE-GEFKP----LHRINPLRLGYIAERAGGLFGKKVLDVGCGGGILAESMARE-GATVTGLDMGFEPLQV
UBIG_ECOBW      LE-GEFKP----LHRINPLRLGYIAERAGGLFGKKVLDVGCGGGILAESMARE-GATVTGLDMGFEPLQV
UBIG_ECO81      LE-GEFKP----LHRINPLRLGYIAERAGGLFGKKVLDVGCGGGILAESMARE-GATVTGLDMGFEPLQV
UBIG_ECO45      LE-GEFKP----LHRINPLRLGYIAERAGGLFGKKVLDVGCGGGILAESMARE-GATVTGLDMGFEPLQV
UBIG_ECO27      LE-GEFKP----LHRINPLRLGYIAERAGGLFGKKVLDVGCGGGILAESMARE-GATVTGLDMGFEPLQV
UBIG_ECO24      LE-GEFKP----LHRINPLRLGYIAERAGGLFGKKVLDVGCGGGILAESMARE-GATVTGLDMGFEPLQV
UBIE_XANOM      --------------------KRYFVTTAQVKPGDRVLDLAGGTGDIAVLLKENEGAVVLG-DINAGMLSV
UBIE_THICR      --------------------KRHAIELSGIRPGNVVLDLAGGTGDLTKAFAKRVGKTVVLADINESMVRV
UBIE_STRM5      --------------------KRYYVATAQVKPGDRVLDLAGGTGDIAALLKERVGVEGSVVDINAGMLSV
UBIE_RHILW      ------------------------------EPGYRVLDVAGGTGDIAFRIVEASGAHATVLDINGSMLGV
UBIG_SHEAM      --------------------------------GKKVLDVGCGGGILSESMAR-LGANVTGIDMGNEPLEV
UBIG_SALTY      LE-GEFKP----LHRINPLRLGYITERSGGLFGKKVLDVGCGGGILAESMARE-GATVTGLDMGFEPLQV
UBIG_SALTI      LK-GEFKP----LHRINPLRLGYITERSGGLFGKKVLDVGCGGGILAESMARE-GATVTGLDMGFEPLQV
UBIG_SALSV      LE-GEFKP----LHRINPLRLGYITERSGGLFGKKVLDVGCGGGILAESMARE-GATVTGLDMGFEPLQV
UBIG_SALNS      LE-GEFKP----LHRINPLRLGYITERSGGLFGKKVLDVGCGGGILAESMARE-GATVTGLDMGFEPLQV
UBIG_SALHS      LE-GEFKP----LHRINPLRLGYITERSGGLFGKKVLDVGCGGGILAESMARE-GATVTGLDMGFEPLQV
UBIG_SALDC      LE-GEFKP----LHRINPLRLGYITERSGGLFGKKVLDVGCGGGILAESMARE-GATVTGLDMGFEPLQV
UBIG_SALA4      LE-GEFKP----LHRINPLRLGYITERSGGLFGKKVLDVGCGGGILAESMARE-GATVTGLDMGFEPLQV
UBIE_BRUSI      -------------------------------PGWTSLDVAGGTGDIAFRIVEASGAHVTILDINGSMLGV
UBIE_BRUME      -------------------------------PGWTSLDVAGGTGDIAFRIVEASGAHVTILDINGSMLGV
UBIE_BRUMB      -------------------------------PGWTSLDVAGGTGDIAFRIVEASGAHVTILDINGSMLGV
UBIE_BRUAB      -------------------------------PGWTSLDVAGGTGDIAFRIVEASGAHVTILDINGSMLGV
UBIE_BRUA2      -------------------------------PGWTSLDVAGGTGDIAFRIVEASGAHVTILDINGSMLGV
UBIE_BRUA1      -------------------------------PGWTSLDVAGGTGDIAFRIVEASGAHVTILDINGSMLGV
UBIG_RICAH      -----------------------------------ILDVGCGGGLIAMPLA-AQGFNVTAIDALQSNIET
UBIG_KLEP3      --------------------------------GKKVLDVGCGGGILAESMARE-GATVTGLDMGAEPLQV
UBIG_HAEDU      --------------------------------GKKVLDVGCGGGILSEAMAQ-AGAIVTGIDMTTEPLEI
UBIG_ACIAD      --------------------------------GKKVLDVGCGGGILAESMARR-GADVLGIDMGEAPLNV
UBIE_TERTT      -------------------------------PGDRVLDIAGGTGDLTAKFARLVGDEVVLADINDSMLKV
UBIE_IDILO      --------------------------------GMKVLDIAGGTGDLTAQFSRRVGAEVVLADINDAMLKV
SMT3B_ARATH     ---------------------------IKVKPGQKILDAGCGVGGPMRAIAAHSKAQVTGITINEYQVQR
UBIG_PSEU5      --------------------------------GKKVIDIGCGGGILSEAMAQR-GAQVTGIDMGEAPLSV
UBIE_RALEJ      --------------------KMFTIAQANVRPGHKVLDIAGGTGDLAKAFAKQAGGQVWLTDINESMLRV
UBIG_RHIME      --------------------------------GLRVLDIGCG-GGLLSEPMARMGADVVGADASEKNIGI
UBIG_PROMH      --------------------------------GKKVLDVGCGGGILSESMAR-VGAEVTGLDMGKEPLEV
UBIG_CITK8      --------------------------------GKKVLDVGCGGGILAESMARE-GATVTGLDMGFEPLQV
UBIG_CAUSK      --------------------------------GLRLLDIGCG-GGLLSEPMARLGFTVTAVDASEKNIKT
UBIE_RHIE6      --------------DAMIA-----ALNPRKEPGYKVLDVAGGTGDIAFRIVEASGAHATVLDINGSMLGV
UBIE_PSEU2      --------------------------------GNRVLDIAGGTGDLTRKFSNLVGGQVVLADINASMLKV
UBIE_PSESM      --------------------------------GNRVLDIAGGTGDLTRKFSNLVGGQVVLADINASMLKV
UBIE_PSE14      --------------------------------GNRVLDIAGGTGDLTRKFSNLVGGQVVLADINASMLKV
UBIE_CUPTR      --------------------KMFTIAQAGVRPGHKVLDIAGGTGDLAKAFAKQAGGQVWLTDINESMLRV
UBIE_BRUSU      -------------------------------PGWTSLDVAGGTGDIAFRIVEVSGAHVTILDINGSMLGV
UBIE_BRUC2      -------------------------------PGWTSLDVAGGTGDIAFRIVEVSGAHVTILDINGSMLGV
UBIG_SHISS      --------------------------------GKKVLDVGCGGGILAESMARE-GATVTGLDMGFEPLQV
UBIG_SHIFL      --------------------------------GKKVLDVGCGGGILAESMARE-GATVTGLDMGFEPLQV
UBIG_SHIF8      --------------------------------GKKVLDVGCGGGILAESMARE-GATVTGLDMGFEPLQV
UBIG_SHIBS      --------------------------------GKKVLDVGCGGGILAESMARE-GATVTGLDMGFEPLQV
UBIG_SHIB3      --------------------------------GKKVLDVGCGGGILAESMARE-GATVTGLDMGFEPLQV
UBIG_PSEAB      --------------------------------GKKVLDIGCGGGILSEAMAQR-GANVTGIDMGEAPLAV
UBIG_ECOSM      --------------------------------GKKVLDVGCGGGILAESMARE-GATVTGLDMGFEPLQV
UBIG_ECOSE      --------------------------------GKKVLDVGCGGGILAESMARE-GATVTGLDMGFEPLQV
UBIG_ECOLC      --------------------------------GKKVLDVGCGGGILAESMARE-GATVTGLDMGFEPLQV
UBIG_ECO8A      --------------------------------GKKVLDVGCGGGILAESMARE-GATVTGLDMGFEPLQV
UBIG_ECO55      --------------------------------GKKVLDVGCGGGILAESMARE-GATVTGLDMGFEPLQV
UBIG_AZOSB      --------------------------------GKKVLDVGCGGGLLSEGMAQR-GAEVSGIDLSEKALGV
UBIE_XYLFM      --------------------KRYFVATAQVKSGDRVLDLAGGTGDIAMLLKNRVGAEGSIVDINASMLSV
UBIE_PSEA7      --------------------------------GNRVLDIAGGTGDLTRQFSRLVGGEVVLADINASMLKV
UBIE_LEGPA      --------------------KRYTIELSHVRPGQSVLDLAGGSGDLTRLLSQKVGGQVVLADINAAMLHV
UBIG_PSEAE      --------------------------------GKKVLDIGCGGGILSEAMAQR-GASVTGIDMGEAPLAV
UBIG_PSEA8      --------------------------------GKKVLDIGCGGGILSEAMAQR-GASVTGIDMGEAPLAV
UBIG_PSEA7      --------------------------------GKTVLDVGCGGGILSEAMAQR-GASVTGIDMGEAPLAV
UBIG_PHOPR      --------------------------------GKKILDVGCGGGILAESMAIE-GADVTGLDMGKEPLTV
UBIG_ECO7I      --------------------------------GKKVLDVGCGGGILAESMARE-GATVTGLDMGFEPLQV
UBIE_XYLFA      --------------------KRYFVATAQVKSGDRVLDLAGGTGDIAMLLKNRVGAEGSIVDINASMLSV
UBIE_RHISN      DAMAALNPPRRENYR--------------------VLDVAGGTGDIAFRIVEASGAHATVLDINGSMLAV
UBIE_LEGPL      --------------------KRYTIELSHVRPGQSVLDLAGGSGDLTRLLSQKVGGQVILADINAAMLHV
UBIE_LEGPC      --------------------KRYTIELSHVRPGQSVLDLAGGSGDLTRLLSQKVGGQVILADINAAMLHV
UBIG_PASMU      ------------IHQLNPLRLSYIAQQANGLTGKKVLDVGCGGGILSESMAKQ-GAIVTGIDMSSAPLQV
UBIG_IDILO      --------------------------------GKKVLDVGCGGGLLSEAMAER-GAQVTGVDLAEQSLKV
UBIG_AZOSE      --------------------------------GKRVLDIGCG-GGILSESMAAAGAHVTGIDLSEKALGV
UBIG_AERS4      --------------------------------GKRILDIGCGGGILSESMARR-GAHVTGIDMGKEPLGV
UBIG_ACIBY      --------------------------------GKKVLDVGCGGGILAESMARR-GADVLGIDMGEAPLAV
UBIG_ACIBS      --------------------------------GKKVLDVGCGGGILAESMARR-GADVLGIDMGEAPLAV
UBIG_ACIB5      --------------------------------GKKVLDVGCGGGILAESMARR-GADVLGIDMGEAPLAV
UBIG_ACIB3      --------------------------------GKKVLDVGCGGGILAESMARR-GADVLGIDMGEAPLAV
UBIE_XYLFT      --------------------KRYFVATAQVKSGDRVLDLAGGTGDIAMLLKNRVGAEGSIVDINASMLSV
UBIE_XYLF2      --------------------KRYFVATAQVKSGDRVLDLAGGTGDIAMLLKNRVGAEGSIVDINASMLSV
UBIE_BORPE      --------------------KAFTIGRAAVRPGMKVLDIAGGTGDLARAFAKRAGGEVWLTDINESMLRV
UBIE_BORPA      --------------------KAFTIGRAAVRPGMKVLDIAGGTGDLARAFAKRAGGEVWLTDINESMLRV
UBIE_BORBR      --------------------KAFTIGRAAVRPGMKVLDIAGGTGDLARAFAKRAGGEVWLTDINESMLRV
UBIE_BACTN      --------------------RRKAIAWLRPFRPQHIMDVATGTGDFAILACRELNPDLIGTDISEGMMNV
UBIG_VIBPA      --------------------------------GKKVLDVGCGGGILAESMAKE-GATVTGLDMGKEPLEV
UBIG_VIBFM      --------------------------------GKKVLDVGCGGGILAESMAKQ-GADVVGLDMGKEPLTV
UBIG_THIDA      --------------------------------GKKVLDVGCGGGILAEAMA-GVGATVSGIDLSEKALKV
UBIG_SHEPA      --------------------------------GKQVLDVGCGGGILSESMAR-IGANVTGLDMGDEPLDV
UBIG_SHEHH      --------------------------------GKQVLDVGCGGGILSESMAK-IGAQVTGLDMGDEPLDV
UBIG_SHEB9      --------------------------------GKKVLDVGCGGGILSESMAR-IGAEVDGLDMGDEPLEV
UBIG_SHEB8      --------------------------------GKKVLDVGCGGGILSESMAR-IGAEVDGLDMGDEPLEV
UBIG_SHEB5      --------------------------------GKKVLDVGCGGGILSESMAR-IGAEVDGLDMGDEPLEV
UBIG_SHEB2      --------------------------------GKKVLDVGCGGGILSESMAR-IGAEVDGLDMGDEPLEV
UBIG_SERP5      ---------------------------------KTVLDVGCGGGILAESMARE-GAQVTGLDMGAEPLQV
UBIG_METS4      -----FNPVRLA-YIRDAACRHHGRDPLGPEPGLTLVDIGCGGGVLSEPLAR-LGARVTGLDPAPTNIRV
UBIG_ACIBC      --------------------------------GKKVLDVGCGGGILAESMARR-GADVLGIDMGEAPLAI
UBIE_SACD2      --------------------------------GHKVLDIAGGTGDLTKKFSRIVGGQVVLADINESMLNV
UBIE_PSEAE      --------------------------------GNRVLDIAGGTGDLTRQFSRLVGGEVVLADINASMLKV
UBIE_PSEAB      --------------------------------GNRVLDIAGGTGDLTRQFSRLVGGEVVLADINASMLKV
UBIE_PSEA8      --------------------------------GNRVLDIAGGTGDLTRQFSRLVGGEVVLADINASMLKV
UBIE_LEGPH      --------------------KRYTIELSHVRPGQSVLDLAGGSGDLTRLLLQKVGGQVILADINAAMLHV
UBIE_BURTA      --------------------KAFTIAQANVRPGGKVLDIAAGTGDLTKAFAKAAGGEVWHTDINESMLRV
UBIE_BURPS      --------------------KAFTIAQANVRPGGKVLDIAAGTGDLTKAFAKAAGGEVWHTDINESMLRV
UBIE_BURP6      --------------------KAFTIAQANVRPGGKVLDIAAGTGDLTKAFAKAAGGEVWHTDINESMLRV
UBIE_BURP1      --------------------KAFTIAQANVRPGGKVLDIAAGTGDLTKAFAKAAGGEVWHTDINESMLRV
UBIE_BURP0      --------------------KAFTIAQANVRPGGKVLDIAAGTGDLTKAFAKAAGGEVWHTDINESMLRV
UBIE_BURMS      --------------------KAFTIAQANVRPGGKVLDIAAGTGDLTKAFAKAAGGEVWHTDINESMLRV
UBIE_BURMA      --------------------KAFTIAQANVRPGGKVLDIAAGTGDLTKAFAKAAGGEVWHTDINESMLRV
UBIE_BURM9      --------------------KAFTIAQANVRPGGKVLDIAAGTGDLTKAFAKAAGGEVWHTDINESMLRV
UBIE_BURM7      --------------------KAFTIAQANVRPGGKVLDIAAGTGDLTKAFAKAAGGEVWHTDINESMLRV
UBIE_BURM1      --------------------KAFTIAQANVRPGYKVLDIAAGTGDLTKAFAKAAGGEVWHTDINESMLRV
YJHP_ECOLI      ---------------------------LRMKPGTRILDLGSGSGEMLCTWARDHGITGTGIDMSSLFTAQ
UBIG_VIBVY      --------------------------------GKKVLDVGCGGGILAESMAKE-GAVVTGLDMGKEPLEV
UBIG_VIBVU      --------------------------------GKKVLDVGCGGGILAESMAKE-GAVVTGLDMGKEPLEV
UBIG_VIBF1      --------------------------------GKKVLDVGCGGGILAESMAKQ-GADVIGLDMGKEPLTV
UBIG_RHOFD      --------------------------------GQQVLDVGCGGGILADSMAR-LGAQVTGIDLASKALRV
UBIG_HAEPS      --------------------------------GKKVLDIGCG-GGILSESMAGLGAIVTGIDMAADALLV
UBIG_COLP3      HQ---INPLRVQFISQHIALQVEGIDSKNGFYDMQIIDVGCGGGILSESLAK-LGANVTGIDMGTEPLNV
UBIE_BURVG      ------------------AWKAFTIAQANVRPGFKVLDIAAGTGDLTRAFAKAAGGEVWHTDINESMLRV
UBIG_VIBHB      --------------------------------GKKVLDVGCGGGILAESMAKE-GAVVTGLDMGKEPLEV
UBIG_ROSDO      --------------------------------GLRILDIGCGGGLLAEPMAR-LGADVVGADAAERNIPV
UBIE_ACICJ      --------------------KREFVAMMDPRPHRTLLDLAGGTGDISLRWLAAGGGPVLMTDINEAMLRV
UBIG_YERPY      ---------------------------------KKVLDVGCGGGILAESMARE-GAQVTGLDMGYEPLQV
UBIG_YERPS      ---------------------------------KKVLDVGCGGGILAESMARE-GAQVTGLDMGYEPLQV
UBIG_YERPP      ---------------------------------KKVLDVGCGGGILAESMARE-GAQVTGLDMGYEPLQV
UBIG_YERPN      ---------------------------------KKVLDVGCGGGILAESMARE-GAQVTGLDMGYEPLQV
UBIG_YERPG      ---------------------------------KKVLDVGCGGGILAESMARE-GAQVTGLDMGYEPLQV
UBIG_YERPE      ---------------------------------KKVLDVGCGGGILAESMARE-GAQVTGLDMGYEPLQV
UBIG_YERPB      ---------------------------------KKVLDVGCGGGILAESMARE-GAQVTGLDMGYEPLQV
UBIG_YERPA      ---------------------------------KKVLDVGCGGGILAESMARE-GAQVTGLDMGYEPLQV
UBIG_YERP3      ---------------------------------KKVLDVGCGGGILAESMARE-GAQVTGLDMGYEPLQV
UBIG_RHISN      --------------------------------GLRLLDIGCG-GGLLSEPMARMGADVLGADASEKNIGI
UBIG_ERWT9      --------------------------------GKKVLDVGCGGGILSESMARE-GANVTGLDMGAEPLQV
UBIE_RALEH      --------------------KMFTIAQAGVRPGHKVLDIAGGTGDLAKAFAKQAGGEVWLTDINESMLRV
UBIE_BURXL      ------------------AWKMFTIAQANVRPGYKVLDIAGGTGDLSKAFAKQAGGEVWHTDINESMLRV
UBIE_BURPP      ------------------AWKMFTIAQANVRPGYKVLDIAGGTGDLSKAFAKQAGGEVWHTDINESMLRV
UBIE_BURCM      ------------------AWKAFTIAQANVRPGFKVLDIAAGTGDLTKSFAKAAGGEVWHTDINESMLRV
UBIE_BURCH      ------------------AWKAFTIAQANVRPGFKVLDIAAGTGDLTKSFAKAAGGEVWHTDINESMLRV
UBIE_BURCA      ------------------AWKAFTIAQANVRPGFKVLDIAAGTGDLTKSFAKAAGGEVWHTDINESMLRV
UBIE_BURA4      ------------------AWKAFTIAQANVRPGFKVLDIAAGTGDLTKSFAKAAGGEVWHTDINESMLRV
UBIG_VIBCM      -----FKP----LHQINPLRLNYVLEKANGLFGKRVLDVGCGGGILAESMARE-GAQVTGLDMGKEPLEV
UBIG_VIBCH      -----FKP----LHQINPLRLNYVLEKANGLFGKRVLDVGCGGGILAESMARE-GAQVTGLDMGKEPLEV
UBIG_VIBC3      -----FKP----LHQINPLRLNYVLEKANGLFGKRVLDVGCGGGILAESMARE-GAQVTGLDMGKEPLEV
UBIG_SODGM      --------------------------------GKNVLDVGCGGGILAESMARE-GAKVTGLDMGAEPLAV
UBIG_HAHCH      -------------------------------PGKRVLDVGCG-GGILSESMARRGAHVVGIDMGEAPLSV
UBIG_CHRVO      --------------------------------GKKVLDVGCGGGILAESMA-LRGAQVTGIDLAKKSLKV
UBIE_THET2      -------------------RRRAVDLALEKAP-KRILDLATGTGDLALMLKERAGAEVVGADFAPPMLAI
UBIE_GEOSF      --------------------RRFAVKKIKYAPNGRILDVATGTGDVALEIAARSSVSITGIDFSGEMVEL
UBIE_BURP8      ------------------AWKAFTIAQANVRPGYKVLDIAGGTGDLSKAFAKRAGGEVWHTDINESMLRV
UBIE_BURCJ      ------------------AWKAFTIAQANVRPGFKVLDIAAGTGDLTKSFAKAAGGEVWHTDINESMLRV
UBIE_BURCC      ------------------AWKAFTIAQANVRPGFKVLDIAAGTGDLTKSFAKAAGGEVWHTDINESMLRV
PIMT_METTH      HRAYMDMPLPIG--EGQTISAPHMVAMIAEEPGMKVLEIGTGCGYNAAVIAEIIGPE--GHLYTVERIGI
UBIG_YERE8      ---------------------------------KKVLDVGCGGGILAESMARE-GAQVTGLDMGYEPLQV
UBIG_RHOS5      ------NPCRLDYITEQIAAERDLSAPLPFQ-GLRLLDIGCG-GGLLSEPMARLGADVVGADAAPRNIPV
UBIG_RALSO      --------------------------------GKRVVDVGCGGGILSESMAR-AGANVKGIDLSRKALRV
UBIG_NITOC      --------------------------------GKRILDVGCG-GGILTEELTRLGAKVTGIDLGKAPLSV
UBIE_SINMW      ----------------RVWKDAMIAA--LNPPGREVLDVAGGTGDIAFRIVERSGAQATVLDINGSMLSV
UBIE_SERP5      --------------------------------GQRVLDLAGGTGDLAAKFSRMVGGQVVLADINDSMLKM
PIMT3_GEOUR     ---AYADTP-LPIGEGQTISQPYVVA-LMTEPGDRVLEIGTGSGYQAAVLAEMV-KDVYSIEIRKDLAET
PIMT2_POLSJ     ---AYQNRP-LPIGHGQTISQPYIVA-LMTEPGHKVLEVGTGSGYQAAVMAHLARAVYT-IEIIEPLGLQ
Y1399_STACT     -----------------------------------VLEIGAGTGNLTLMLKDK-GREVSAIDPSDDMRAI
UBIG_VIBSL      --------------------------------GKKVLDVGCGGGILAESMAVE-GAVVTGLDMGKEPLEV
UBIG_THICR      ---------------------------------KTILDVGCGGGILSESLAK-AGGNVTGIDLAEDVLTI
UBIG_RHOSK      ------NPCRLDYITQQIAAERDLSAPLPFE-GLRLLDIGCG-GGLLSEPMARLGAEVIGADAAPRNIPV
UBIG_PSEU2      --------------------------------GKKVLDVGCG-GGILSEAMALRGATVTGIDMGEAPLAV
UBIG_PSE14      --------------------------------GKKVLDVGCG-GGILSEAMALRGATVTGIDMGEAPLAV
UBIG_HAES2      ---------------------------------KKVLDVGCGGGILSEAMAKQ-GAIVTGIDMTVAPLEV
UBIE_SHESR      --------------------KRYTIEVSGARPGMKVLDLAGGTGDLTAKFSHLVGGEVVLADINDSMLKV
UBIE_SHESM      --------------------KRYTIEVSGARPGMKVLDLAGGTGDLTAKFSHLVGGEVVLADINDSMLKV
UBIE_SHESA      --------------------KRYTIEVSGARPGMKVLDLAGGTGDLTAKFSHLVGGEVVLADINDSMLKV
Y1145_PYRAB     --------------------------------GSKVLDLYSGVGTFSLYLAKK-GFEVTGVEVNEESVRV
UBIG_SHESW      --------------------------------GKKVLDVGCGGGILSESMAR-IGAEVDGLDMGEEPLEV
UBIG_SHEPC      --------------------------------GKKVLDVGCGGGILSESMAR-IGAEVDGLDMGEEPLEV
UBIG_NITEU      ---------------------------------KTVIDVGCG-GGILSESMAARGASVTGIDLSDKALKV
UBIG_HAES1      ---------------------------------KKVLDVGCGGGILSEAMAKQ-GAIVTGIDMTVAPLEV
UBIG_DECAR      --------------------------------GKRVLDVGCG-GGLLSEGMAVRGANVTGIDLSEKPLGV
UBIG_ALHEH      ------------LHDINPLRLDYVAQCLGGLEGRRILDVGCGGGLLAEGMARR-GAEVTGIDMSKAALQV
UBIE_SHEFN      VAAKYDIMNDVMSFGVHRFWKRHTIEVAAARPGMKVLDLAGGTGDLTAKFSHLVGGQVVLADINDSMLKV
UBIE_BURS3      ------------------AWKAFTIAQANVRPGFKVLDLAAGTGDLTKAFAKAAGGEVWHTDINESMLRV
MTL10_HUMAN     ----------------------------------SVLDIGTGNGVFLVELAKFGFSNITGIDYSPSAIQL
CBIT_THEAC      -------------------------------PGMRVMDIGCGSGSMTVEISNIIGGSVTGLDVSGEAADL
UBIG_RALEJ      --------------------------------GKKVVDIGCGGGILSESMAR-LGANVRGIDLSTKALRV
UBIG_BURP8      --------------------------------GKRVLDIGCG-GGILSESMATLGADVKGIDLSNEALGV
UBIG_ACIAC      --------------------------------GRRVLDVGCGGGILADAMARK-GATVTGIDLATKSLKV
UBIE_RHIME      ----------------RVWKDAMIAA--LNPPGREVLDVAGGTGDIAFRIVERSGAHATVLDINGSMLSV
UBIE_AGRVS      ------------------------------DAGYKVLDVAGGTGDIAFRIIEASRAHATVLDINGSMLGV
UBIE_AGRT5      ------------------------------DPSYKILDVAGGTGDVAFRIIEASNAHATVLDINGSMLAV
UBIE_AGRRK      --------------DAMIS-----ALNPRKDPSYKVLDVAGGTGDIAFRIVEASNAHATVLDINGSMLGV
UBIG_METCA      --------------------------------GRKAVDVGCG-GGILTEALAKAGADALGIDLSEDLLGT
UBIE_SHESW      --------------------KRHTIEVSGARPGMKVLDLAGGTGDLTAKFSHLVGGEVVLADINDSMLKV
UBIE_SHEPC      --------------------KRHTIEVSGARPGMKVLDLAGGTGDLTAKFSHLVGGEVVLADINDSMLKV
PIMT_PYRHO      ------------------------------KPGMNVLEVGTGSGWNAALIAEIVKGDVYSIERIPELVEF
PIMT_DESVV      ---------------------------LEAKPGMRVLEIGTGSGYQAAVLAE-MGLDVYTVERIREIYQT
PIMT_DESVH      ---------------------------LEAKPGMRVLEIGTGSGYQAAVLAE-MGLDVYTVERIREIYQT


                         .         .         .         +         .         .         .:280
query           SRDRAAKRGLAGNVRFELQDYRYLPASKKYDRIVSVGMFEHVGPTHYRDYFDKVAEVLDDKGVMVLHSIG
YLP3_PSEPU      GRQRVKAEGLTDKVDLQILDYRDLPQDGRFDKVVSVGMFEHVGHANLALYCQKLFGAVREGGLVMNHGIG
CFA_ECOLI       AQERC--EGL--DVTILLQDYRDL--NDQFDRIVSVGMFEHVGPKNYDTYFAVVDRNLKPEGIFLLHTIG
CFA_ECOL6       AQERC--EGL--DVTILLQDYRDL--NDQFDRIVSVGMFEHVGPKNYDTYFAVVDRNLKPEGIFLLHTIG
MMA1_MYCTU      SKDRLAAIGTQRRAEARLQGWEEF--EENVDRIVSFEAFDAFKKERYLTFFERSYDILPDDGRMLLHSIA
MMA1_MYCTA      SKDRLAAIGTQRRAEARLQGWEEF--EENVDRIVSFEAFDAFKKERYLTFFERSYDILPDDGRMLLHSIA
MMA1_MYCBO      SKDRLAAIGTQRRAEARLQGWEEF--EENVDRIVSFEAFDAFKKERYLTFFERSYDILPDDGRMLLHSIA
CFA2_MYCLE      NKLKFAEIDHTRTDRVRLQGWEQF--DEPVDRIISLGAFEHAGFERYDSFFKMCYDVLPDDGRMLLHTIT
CFA2_MYCTU      AHDKAMFDEVDSPRRKEVRIQGWEEFDEPVDRIVSLGAFEHAGFERYDTFFKKFYNLTPDDGRMLLHTIT
CFA2_MYCBO      AHDKAMFDEVDSPRRKEVRIQGWEEFDEPVDRIVSLGAFEHAGFERYDTFFKKFYNLTPDDGRMLLHTIT
CFA1_MYCTU      VQQLVANSENLRSKRVLLAGWEQF--DEPVDRIVSIGAFEHFGHERYDAFFSLAHRLLPADGVMLLHTIT
CFA1_MYCTA      VQQLVANSENLRSKRVLLAGWEQF--DEPVDRIVSIGAFEHFGHERYDAFFSLAHRLLPADGVMLLHTIT
ERG6_MAGGR      ARRYAEMEGYGAQLKFVQGDFMALPFEKEFDAVYSIEATVHA--PKLEDVYKQIFNVLKPGGIFGLY---
ERG6_SCHPO      CNNYAVKRNLDKKQVFVKGDFMHMP---------------------------------------------
ERG6_NEUCR      ATHYAVRDGLSGQLKFVKGDFMQMSPDNSFDAVYAIEATVH-----------------------------
UBIE_PSEMY      GRDRLLDKGVAGNVQFVQADAEKLPFPDNHFDVVTIA-FGLRNVTHKEDALRSMLRVLKPGGRLLVLEFS
ERG6_PNECA      AKYYSEKKGLSDKLKFIKGDFMQMPPENSFDKIYSI----------------------------------
SMT2_ORYSJ      ARAHNRKAGLDSRCEVVCGNFLSMPFSASFDGAYSIEATCHA--PRLQDVYGEVFRVLKPGGLYV-----
SMT1_DICDI      GKRLNESAGLSHLCSFIKADFMHVP---------------------------------------------
PEAM1_ARATH     ALERAI--GLSCSVEFEVADTKHYP-DNSFDVIYSRDTILHIKPALFRTFF-------------------
UBIE_AZOVD      GRDRLLDRGVAGNVRFVQADAEKLPFPDNHFDVITIA-FGLRNVTRKEDALRSMLRVLKPGGRLLVLEFS
SMT1_ORYSJ      GKELNRVAGVSGTCDFVKADFMKMPFSNTFDAVYAI----------------------------------
PEAM2_ARATH     ALERAI--GLKCSVEFEVAD--------------------------------------------------
UBIG_BORA1      AR----LHGLESGVKVE---YRAVPVEEQYDIVTCMEMLEHV----------------------------
UBIE_PSEU5      GRDKLLDKGVAGNVRFVQADAEKLPFPDNYFDVVTIA-FGLRNVTHKEDAIASMLRVLKPGGRLLVLEFS
UBIE_RHILO      GRDRAQKKGLSGNTDFVEANAEELP---------------------------------------------
UBIE_PSEFS      GRDRLLDKGVAGNIEFVQADAEKLPFPDNHFDCVTIA-FGLRNVTHKEDAIRSMLRVLKPGGRLLVLEFS
PEAMT_SPIOL     ALERSI--GLKCAVEFEVAD--------------------------------------------------
UBIG_PECCP      ARLHALESGVAVNYVQETVEAHAQAHPGLYDVVTCMEMLEHV----------------------------
UBIG_COXBU      AKNHAEQQQL--NINYQCQDIEILTKAQRFDIITCMELLEHV-PDPQR-MIKNCAALIKPGGKLFFSTIN
UBIG_COXBR      AKNHAEQQQL--NINYQCQDIEILTKAQRFDIITCMELLEHV-PDPQR-MIKNCAALIKPGGKLFFSTIN
UBIG_COXBN      AKNHAEQQQL--NINYQCQDIEILTKAQRFDIITCMELLEHV-PDPQR-MIKNCAALIKPGGKLFFSTIN
UBIG_COXB2      AKNHAEQQQL--NINYQCQDIEILTKAQRFDIITCMELLEHV-PDPQR-MIKNCAALIKPGGKLFFSTIN
UBIG_COXB1      AKNHAEQQQL--NINYQCQDIEILTKAQRFDIITCMELLEHV-PDPQR-MIKNCAALIKPGGKLFFSTIN
PEAM3_ARATH     ALEHAI--GLKCSVEFEVAD--------------------------------------------------
ERG6_YARLI      GTHYSEVQGFGDQVTYVKGDFMQMDPDNSFDAVYAIEATVH-----------------------------
UBIG_ENT38      ARLHALESGIQVDYVQETVEEHAAKHAHQYDVVTCMEMLEHV----------------------------
UBIE_PSEPU      GRDRLLDRGVAGNIEFVQADAEKLPFPDNHFDCVTIA-FGLRNVTHKDEAIRSMLRVLKPGGRLLVLEFS
UBIE_PSEE4      GRDRLLDRGVAGNIEFVQADAEKLPFPDNHFDCVTIA-FGLRNVTHKDEAIRSMLRVLKPGGRLLVLEFS
UBIG_ACTP2      ARKHAEENGLSIDYRTTIEDFQTACHAEKFDVITCMEMLEHV----------------------------
UBIE_PSEPF      GRDRLLDVGVSGNVEFVQADAEKLPFPDNHFDCVTIA-FGLRNVTHKEDALRSMLRVLKPGGRLLVLEFS
SMT1_ARATH      GKELNRLAGVDKTCNFVKADFMKMPPENSFDAVYAI----------------------------------
UBIG_ENTS8      ARLHALESGVELNYVQQTVEEHAAQHAGAYDVVTCMEMLEHV----------------------------
UBIG_BORPA      AR----LHGLESGVKV---DYRAVPVEEQYDVVTCMEMLEHV----------------------------
UBIG_BORBR      AR----LHGLESGVKV---DYRAVPVEEQYDVVTCMEMLEHV----------------------------
UBIG_ACTP7      ARKHAEESGLTIDYRTTIEDFQTACHAEKFDVITCMEMLEHV----------------------------
UBIE_STRMK      GRDRLTNRGL------------------------------------------------------------
UBIE_PSEPW      GRDRLLDRGVAGNIEFVQADAEKLPFPDNHFDCVTIA-FGLRNVTHKDEAIRSMLRVLKPGGRLLILEFS
UBIE_PSEPG      GRDRLLDRGVAGNIEFVQADAEKLPFPDNHFDCVTIA-FGLRNVTHKDEAIRSMLRVLKPGGRLLILEFS
GTOMC_ARATH     ANDLAAAQSLAHKASFQVADALDQPEDGKFDLVWSMESGEHM----------------------------
UBIE_XANCP      GRDRLTNRGLVAGFDYVQCNAEALP---------------------------------------------
UBIG_SALPK      AKLRALESGIEVEYVQETVEEHAAKHAQQYDVVTCMEMLEHV----------------------------
UBIG_SALPA      AKLRALESGIEVEYVQETVEEHAAKHAQQYDVVTCMEMLEHV----------------------------
UBIG_ERWCT      ARLHALESGVTVDYVQETVEAHADAHSGLYDVVTCMEMLEHV----------------------------
UBIG_BORPE      AR----LHGLESGVKV---DYRAVPVEEQYDVVTCMEMLEHV----------------------------
UBIE_XANAC      GRDRLTNRGLVSGFDYVQCNAEALP---------------------------------------------
UBIG_PSYA2      ASLHAEQSNLQDTLRYQHIPVEALAATHQFDVVTCMEMLEHVPDP--AAIVDACFKLLAPGGVCVLSTIN
UBIE_RHIEC      GAERAEKKKLSGNLTFVEANAEELP---------------------------------------------
UBIE_OCHA4      GRERAIKKGLADNLEFVEASAEELP---------------------------------------------
UBIE_MARMS      GRDKLANQGIVGNVKFVQANAEALP---------------------------------------------
SMT2_ARATH      ARLHNKKAGL------------------------------------------------------------
UBIG_PSYCK      ASLHAEQSNLQDTLRYQHIPVEALAATHQFDVVTCMEMLEHVPDP--AAIVDACFKLLAPGGVCVLSTIN
UBIE_PSEPK      GRDRLLDRGVAGNIEFVQADAEKLPFPDNHFDCVTIA-FGLRNVTHKDAAIRSMLRVLKPGGRLLILEFS
UBIE_PSEP1      GRDRLLDRGVAGNIEFVQADAEKLPFPDNHFDCVTIA-FGLRNVTHKDAAIRSMLRVLKPGGRLLILEFS
UBIG_SALPC      AKLHALESGIEVEYMQETVEEHAAKHAQQYDVVTCMEMLEHV----------------------------
UBIG_SALG2      AKLHALESGIEVEYMQETVEEHAAKHAQQYDVVTCMEMLEHV----------------------------
UBIG_SALEP      AKLHALESGIEVEYMQETVEEHAAKHAQQYDVVTCMEMLEHV----------------------------
UBIG_SALCH      AKLHALESGIEVEYMQETVEEHAAKHAQQYDVVTCMEMLEHV----------------------------
UBIG_NITMU      AKLHLLESGNKVNYRKSSVEALAAEQPHHYDVVTCMEMLEHV----------------------------
UBIG_KLEP7      ARLHALESGIQVDYVQETVEEHAAKHPQQYDVVTCMEMLEHV----------------------------
UBIG_ECO5E      AKLHALESGIQVDYVQETVEEHAAKHAGQYDVVTCMEMLEHV----------------------------
UBIG_ECO57      AKLHALESGIQVDYVQETVEEHAAKHAGQYDVVTCMEMLEHV----------------------------
UBIG_CAUCR      AATHAAEQGLDIGYRPATAEQLLAEGAGPFDVVLTMEVIEHVADP--GEFLRTCAKLLKPGGIMFVATLN
UBIG_CAUCN      AATHAAEQGLDIGYRPATAEQLLAEGAGPFDVVLTMEVIEHVADP--GEFLRTCAKLLKPGGIMFVATLN
UBIE_RHIL3      GAERAEKKKLSGNLTFVEANAEELP---------------------------------------------
UBIE_RALME      GRDRLLNKGVVTPV--ALCDAERIPFPDNYFDLVTVA-FGLRNMTHKDAALAEMRRVIKPGGVMVL----
UBIE_PSEOL      GRDRLLDRGVAGNIEFVQADAEKLPFPDNHFDCVTIA-FGLRNVTHKDEAIRSMLRVLKPGG--------
UBIE_CELJU      GRDRLIDRGIAGNIAFTQCDAQYLP---------------------------------------------
PIMT_METBU      ARNNLERAGYSNVTVVHDDGSCGLPEHAPYDRIAVTSVAPEVPP--------PLREQLSKNGIMVI-PVG
UBIG_SHIDS      AKLHALESGIQVDYVQETVEEHAAKHAGQYDVVTCMEMLEHV----------------------------
UBIG_SALAR      ARLHALESGIEVEYVQETVEEHAAKHAQQYDVVTCMEMLEHV----------------------------
UBIG_PHOLL      ARLHALETGIPVTYVQETVESHAEKYPQAYDIVTCMEMLEHV----------------------------
UBIG_MARMM      ASVHADEQGLEIDYRHGVAEQLIEQDEAPFDVVLNLEVMEHVANPH--TFLVDCARLVKPGGLMICATIN
UBIG_ESCF3      AKLHALESGIQVNYVQETVEEHAAKHAGQYDVVTCMEMLEHV----------------------------
UBIG_ECOUT      AKLHALESGIQVDYVQETVEEHAAKHAGQYDVVTCMEMLEHV----------------------------
UBIG_ECOLU      AKLHALESGIQVDYVQETVEEHAAKHAGQYDVVTCMEMLEHV----------------------------
UBIG_ECOLI      AKLHALESGIQVDYVQETVEEHAAKHAGQYDVVTCMEMLEHV----------------------------
UBIG_ECOL6      AKLHALESGIQVDYVQETVEEHAAKHAGQYDVVTCMEMLEHV----------------------------
UBIG_ECOL5      AKLHALESGIQVDYVQETVEEHAAKHAGQYDVVTCMEMLEHV----------------------------
UBIG_ECOHS      AKLHALESGIQVDYVQETVEEHAAKHAGQYDVVTCMEMLEHV----------------------------
UBIG_ECODH      AKLHALESGIQVDYVQETVEEHAAKHAGQYDVVTCMEMLEHV----------------------------
UBIG_ECOBW      AKLHALESGIQVDYVQETVEEHAAKHAGQYDVVTCMEMLEHV----------------------------
UBIG_ECO81      AKLHALESGIQVDYVQETVEEHAAKHAGQYDVVTCMEMLEHV----------------------------
UBIG_ECO45      AKLHALESGIQVDYVQETVEEHAAKHAGQYDVVTCMEMLEHV----------------------------
UBIG_ECO27      AKLHALESGIQVDYVQETVEEHAAKYAGQYDVVTCMEMLEHV----------------------------
UBIG_ECO24      AKLHALESGIQVDYVQETVEEHAAKHAGQYDVVTCMEMLEHV----------------------------
UBIE_XANOM      GRDRLTNRGLVSGFDYVQCNAEALP---------------------------------------------
UBIE_THICR      GRDRLTNEGIIGNVDYTITNAEALTYPDNTFDLVTIS-FGLRNVTNKDKALEEIYRVLKPGGQLMVLEFS
UBIE_STRM5      GRDRLTNRGL------------------------------------------------------------
UBIE_RHILW      GAERAEKKKLSGNLTFVEANAEELP---------------------------------------------
UBIG_SHEAM      ARLHALETGVSLNYRCTAEEHREV-NREAYDVVTCMEMLEHV----------------------------
UBIG_SALTY      AKLHALESGIEVEYVQETVEEHAAKHAQQYDVVTCMEMLEHV----------------------------
UBIG_SALTI      AKLHALESGIEVEYVQETVEEHAAKHAQQYDVVTCMEMLEHV----------------------------
UBIG_SALSV      AKLHALESGIEVEYVQETVEEHAAKHAQQYDVVTCMEMLEHV----------------------------
UBIG_SALNS      AKLHALESGIEVEYVQETVEEHAAKHAQQYDVVTCMEMLEHV----------------------------
UBIG_SALHS      AKLHALESGIEVEYVQETVEEHAAKHAQQYDVVTCMEMLEHV----------------------------
UBIG_SALDC      AKLHALESGIEVEYVQETVEEHAAKHAQQYDVVTCMEMLEHV----------------------------
UBIG_SALA4      AKLHALESGIEVEYVQETVEEHAAKHAQQYDVVTCMEMLEHV----------------------------
UBIE_BRUSI      GRERAIKKGLIDNLEFVEANAEELP---------------------------------------------
UBIE_BRUME      GRERAIKKGLIDNLEFVEANAEELP---------------------------------------------
UBIE_BRUMB      GRERAIKKGLIDNLEFVEANAEELP---------------------------------------------
UBIE_BRUAB      GRERAIKKGLIDNLEFVEANAEELP---------------------------------------------
UBIE_BRUA2      GRERAIKKGLIDNLEFVEANAEELP---------------------------------------------
UBIE_BRUA1      GRERAIKKGLIDNLEFVEANAEELP---------------------------------------------
UBIG_RICAH      ASTYAKENNV--KINYLQSTIEELESDKLYDVVICIEVIEHVG--NVQQFILNLVKHIKPNGMAIISTIN
UBIG_KLEP3      AKLHALESGIQVDYVQETVEEHAAKHPQQYDVVTCMEMLEHV----------------------------
UBIG_HAEDU      AKQHAIENGLTIHYQTTVEDLRLNHTAEKFDVVTCMEMLEHV----------------------------
UBIG_ACIAD      ARLHAEQEQVA-NI-----EYRQIPVEEQYDIVTCMEMMEHV----------------------------
UBIE_TERTT      GRDKLVDKGFLGNVQYAQADAQFLP---------------------------------------------
UBIE_IDILO      GRDKLRDRGIIGNVRYVQADAEELPFDDNTFDVITIA-FGLRNVTDKDKALRSMLRVLKPGGRVLILEFS
SMT3B_ARATH     AKLHNKKAGL------------------------------------------------------------
UBIG_PSEU5      ARLHLLESGLEIDYRQITAEAMAAEAPEQFDVVTCLEMLEHV----------------------------
UBIE_RALEJ      GRDRLLDKGVVTPV--ALCDAEHIPFPDNYFDLVTV----------------------------------
UBIG_RHIME      ARTHAAGSGVSVDYRAVTAE-ALAEAGESFDVVLNMEVVEHVADVEF--FMTTCAHMVRPGGLMFVATIN
UBIG_PROMH      ARLHSLETGIPVTYIQDTVENHAAEYPQRYDVVTCMEMLEHV----------------------------
UBIG_CITK8      AKLHALESGIQVDYVQETVEEHAAKHAHQYDVVTCMEMLEHV----------------------------
UBIG_CAUSK      AATHAAEQGLEIGYRPATAEQLLAEGAGPFDVVLTMEVVEHVADP--GEFLRTCAKLLAPGGLMIVATLN
UBIE_RHIE6      GAERAEKKKLSANLTFVEANAEELP---------------------------------------------
UBIE_PSEU2      GRDRLLDLGVSGNVEFVQADAEKLPFPDNHFDCVTIA-FGLRNVTHKEDALRSMLRVLKPGGRLLVLEFS
UBIE_PSESM      GRDRLLDLGVSGNVEFVQADAEKLPFPDNHFDCVTIA-FGLRNVTHKEDALRSMLRVLKPGGRLLVLEFS
UBIE_PSE14      GRDRLLDLGVSGNVEFVQADAEKLPFPDNHFDCVTIA-FGLRNVTHKEDALRSMLRVLKPGGRLLVLEFS
UBIE_CUPTR      GRDRLLNKGIVTPV--ALCDAEKIPFPDNYFDLVTVA-FGLRNMTHKEAALAEMRRVVKPGGVMVL----
UBIE_BRUSU      GRERAIKKGLIDNLEFVEANAEELP---------------------------------------------
UBIE_BRUC2      GRERAIKKGLIDNLEFVEANAEELP---------------------------------------------
UBIG_SHISS      AKLHALESGIQVDYVQETVEEHAAKHAGQYDVVTCMEMLEHV----------------------------
UBIG_SHIFL      AKLHALESGIQVDYVQETVEEHAAKHAGQYDVVTCMEMLEHV----------------------------
UBIG_SHIF8      AKLHALESGIQVDYVQETVEEHAAKHAGQYDVVTCMEMLEHV----------------------------
UBIG_SHIBS      AKLHALESGIQVDYVQETVEEHAAKHAGQYDVVTCMEMLEHV----------------------------
UBIG_SHIB3      AKLHALESGIQVDYVQETVEEHAAKHAGQYDVVTCMEMLEHV----------------------------
UBIG_PSEAB      ARLHQLESGVA-------VDYRQITAEQQFDVVTCLEMLEHV----------------------------
UBIG_ECOSM      AKLHALESGIQVDYVQETVEEHAAKHAGQYDVVTCMEMLEHV----------------------------
UBIG_ECOSE      AKLHALESGIQVDYVQETVEEHAAKHAGQYDVVTCMEMLEHV----------------------------
UBIG_ECOLC      AKLHALESGIQVDYVQETVEEHAAKHAGQYDVVTCMEMLEHV----------------------------
UBIG_ECO8A      AKLHALESGIQVDYVQETVEEHAAKHAGQYDVVTCMEMLEHV----------------------------
UBIG_ECO55      AKLHALESGIQVDYVQETVEEHAAKHAGQYDVVTCMEMLEHV----------------------------
UBIG_AZOSB      ARLHLYESGLQVDYQLTSAEAHAATHPAQFDVVTCMEMLEHV----------------------------
UBIE_XYLFM      GRDRLIDRGVVARLEYVQCNAEALPFQDKCFDLVTM----------------------------------
UBIE_PSEA7      GRDKLLDKGVSGNVSFVQADAEKLPFPDNHFDCVTIA-FGLRNVTHKDEAIRSMLRVLKPGGRLLVLEFS
UBIE_LEGPA      GRDRLLDEGLFKNIRYVQGNAQCLPFADNSFHCITMG---------------------------------
UBIG_PSEAE      ARLHQLESGVA-------VDYRQITAEQQFDVVTCLEMLEHV----------------------------
UBIG_PSEA8      ARLHQLESGVA-------VDYRQITAEQQFDVVTCLEMLEHV----------------------------
UBIG_PSEA7      ARLHQLESGVA-------VDYRQITAEQQFDVVTCLEMLEHV----------------------------
UBIG_PHOPR      ARLHALETGAKLDYVLRTAEEQAELHPETYDIVTCMEMLEHV----------------------------
UBIG_ECO7I      AKLHALESGIQVEYVQETVEEHAAKHAGQYDVVTCMEMLEHV----------------------------
UBIE_XYLFA      GRDRLIDRGVVAHLDYVQCNAEALPFQDKCFDLVTM----------------------------------
UBIE_RHISN      GAERARKKGLLGNLEFVEANAEDLPAANSFD---------------------------------------
UBIE_LEGPL      GRDRLLDEGLFKNIRYVQGNAQCLPFADNSFHCITMG---------------------------------
UBIE_LEGPC      GRDRLLDEGLFKNIRYVQGNAQCLPFADNSFHCITMG---------------------------------
UBIG_PASMU      ARKHALESGLQITIEEFLQNQTALFAERKFDVITCMEMLEHV----------------------------
UBIG_IDILO      ARLHALESGRQIDYQCTLADQQ--PAS--FDVVTCLEMLEHV----------------------------
UBIG_AZOSE      ARLHLFESG-------QKVDYHHASAEEEFDIVTCMEMLEHV----------------------------
UBIG_AERS4      ARLHALEQGVELQYQQMTAEEHASQTPDQYDVVTCMEMLEHV----------------------------
UBIG_ACIBY      GRLHAQQENVQ-NI-----EYRQIPVEEQYDVVTCMEMMEHV----------------------------
UBIG_ACIBS      GRLHAQQENVQ-NI-----EYRQIPVEEQYDVVTCMEMMEHV----------------------------
UBIG_ACIB5      GRLHAQQENVQ-NI-----EYRQIPVEEQYDVVTCMEMMEHV----------------------------
UBIG_ACIB3      GRLHAQQENVQ-NI-----EYRQIPVEEQYDVVTCMEMMEHV----------------------------
UBIE_XYLFT      GRDRLIDRGVVARLDYVQCNAEALPFQDKCFDLVTM----------------------------------
UBIE_XYLF2      GRDRLIDRGVVARLDYVQCNAEALPFQDKCFDLVTM----------------------------------
UBIE_BORPE      GRDRLTDSGLL--VPTAVCDAERLPFPSQYFDRVSVA-FGLRNMTHKDRALAEMTRVLKPGGKLLVLEFS
UBIE_BORPA      GRDRLTDSGLL--VPTAVCDAERLPFPSQYFDRVSVA-FGLRNMTHKDRALAEMTRVLKPGGKLLVLEFS
UBIE_BORBR      GRDRLTDSGLL--VPTAVCDAERLPFPSQYFDRVSVA-FGLRNMTHKDRALAEMTRVLKPGGKLLVLEFS
UBIE_BACTN      GREKVKKEGLSDKISFAREDCTSLSADNRFDAI-------------------------------------
UBIG_VIBPA      ARLHALETGTLTYIQSTIEDHAAENAG-TYDVVTCMEMLEHV----------------------------
UBIG_VIBFM      ARLHALETGTKLEYVQSTAEQHAEENPETYDVVTCMEMLEHV----------------------------
UBIG_THIDA      ARLHLYESG--KSVDYELEDYAAAHPG-EFDVVTCMEMLEHV----------------------------
UBIG_SHEPA      ARLHALETGVEINYIKNTAEAHRDEHRGQYDVVTCMEMLEHV----------------------------
UBIG_SHEHH      ARLHAIETGVLINYVKNTAEAHRDEHRGQYDVVTCMEMLEHV----------------------------
UBIG_SHEB9      ARLHALETGVSINYVKNTAETHSQDHQAYYDVVTCMEMLEHV----------------------------
UBIG_SHEB8      ARLHALETGVSINYVKNTAETHSQDHQAYYDVVTCMEMLEHV----------------------------
UBIG_SHEB5      ARLHALETGVSINYVKNTAETHSQDHQAYYDVVTCMEMLEHV----------------------------
UBIG_SHEB2      ARLHALETGVSINYVKNTAETHSQDHQAYYDVVTCMEMLEHV----------------------------
UBIG_SERP5      ARLHALESGVNVAYIQETVESHAQANPQRYDVVTCMEMLEHV----------------------------
UBIG_METS4      AKAHAEEAGVPVDYRPQTIE-SVVAAGERFDLVVAMEVVEHV----------------------------
UBIG_ACIBC      GRLHAQQENVQ-NI-----EYRQIPVEEQYDVVTCMEMMEHV----------------------------
UBIE_SACD2      GRDKLIDSGVAGNVVYTQADAQYLP---------------------------------------------
UBIE_PSEAE      GRDKLLDKGVSGNVSFVQADAEKLPFPDNHFDCVTIA-FGLRNVTHKDEAIRSMLRVLKPGGRLLVLEFS
UBIE_PSEAB      GRDKLLDKGVSGNVSFVQADAEKLPFPDNHFDCVTIA-FGLRNVTHKDEAIRSMLRVLKPGGRLLVLEFS
UBIE_PSEA8      GRDKLLDKGVSGNVSFVQADAEKLPFPDNHFDCVTIA-FGLRNVTHKDEAIRSMLRVLKPGGRLLVLEFS
UBIE_LEGPH      GRDRLLDEGLFKNIRYVQGNAQCLPFADNSFHCITMG---------------------------------
UBIE_BURTA      GRDRLLDKGVV--TPSLLCDAEKLPFPDNYFDVVTV----------------------------------
UBIE_BURPS      GRDRLLDKGVV--TPSLLCDAEKLPFPDNYFDVVTV----------------------------------
UBIE_BURP6      GRDRLLDKGVV--TPSLLCDAEKLPFPDNYFDVVTV----------------------------------
UBIE_BURP1      GRDRLLDKGVV--TPSLLCDAEKLPFPDNYFDVVTV----------------------------------
UBIE_BURP0      GRDRLLDKGVV--TPSLLCDAEKLPFPDNYFDVVTV----------------------------------
UBIE_BURMS      GRDRLLDKGVV--TPSLLCDAEKLPFPDNYFDVVTV----------------------------------
UBIE_BURMA      GRDRLLDKGVV--TPSLLCDAEKLPFPDNYFDVVTV----------------------------------
UBIE_BURM9      GRDRLLDKGVV--TPSLLCDAEKLPFPDNYFDVVTV----------------------------------
UBIE_BURM7      GRDRLLDKGVV--TPSLLCDAEKLPFPDNYFDVVTV----------------------------------
UBIE_BURM1      GRDRLLDKGIV--TPSLLCDAEKIPFPDNYFDVVTV----------------------------------
YJHP_ECOLI      AKRRAEELGVSERVHFIHNDAAGYVANEKCDVAACVG---------------------------------
UBIG_VIBVY      ARLHALETGTLTYIQSTIEDHA-AENAQMYDVVTCMEMLEHV----------------------------
UBIG_VIBVU      ARLHALETGTLTYIQSTIEDHA-AENAQMYDVVTCMEMLEHV----------------------------
UBIG_VIBF1      ARLHALETGTKLEYVQSTAEQHAEENPETYDVVTCMEMLEHV----------------------------
UBIG_RHOFD      AQLHALE-AQTPNLQYQEISVEALAAQQSFDVVTCMEMLEHV----------------------------
UBIG_HAEPS      ARQHAESNHL--NICYQVEDFHCITDTEKFDIITCMEVLEHVPNPH--SIIQSCKNLLKEDGLLFISTIN
UBIG_COLP3      AKLHALETGVSINYQKITAEEKALENPGTFDVVTCMEMLEHV----------------------------
UBIE_BURVG      GRDRLLDKGVV--TPSLLCDAEKLPFPNNYFDVVTV----------------------------------
UBIG_VIBHB      ARLHALEAGTLTYIQSTIEDHAAENAG-TYDVVTCMEMLEHV----------------------------
UBIG_ROSDO      ARVHAEQSGLT-------IDYRHTTAGEQFDVVLNMEVVEHVASP--IDYLIACRQLLKPGGLQVCSTLN
UBIE_ACICJ      GRGRAEEQARIEGIGFAVADAEALP---------------------------------------------
UBIG_YERPY      ARLHALETGVKLEYVQETVENHAQQHPQHYDVVTCMEMLEHV----------------------------
UBIG_YERPS      ARLHALETGVKLEYVQETVENHAQQHPQHYDVVTCMEMLEHV----------------------------
UBIG_YERPP      ARLHALETGVKLEYVQETVENHAQQHPQHYDVVTCMEMLEHV----------------------------
UBIG_YERPN      ARLHALETGVKLEYVQETVENHAQQHPQHYDVVTCMEMLEHV----------------------------
UBIG_YERPG      ARLHALETGVKLEYVQETVENHAQQHPQHYDVVTCMEMLEHV----------------------------
UBIG_YERPE      ARLHALETGVKLEYVQETVENHAQQHPQHYDVVTCMEMLEHV----------------------------
UBIG_YERPB      ARLHALETGVKLEYVQETVENHAQQHPQHYDVVTCMEMLEHV----------------------------
UBIG_YERPA      ARLHALETGVKLEYVQETVENHAQQHPQHYDVVTCMEMLEHV----------------------------
UBIG_YERP3      ARLHALETGVKLEYVQETVENHAQQHPQHYDVVTCMEMLEHV----------------------------
UBIG_RHISN      ARTHAAGSGV--NVDYRAVTAEALEAGESFDIVLNMEVVEHVADVDF--FMTTCAHMVRPGGLMFVATIN
UBIG_ERWT9      ARLHALESGVNIDYVQQTVEEHADRFAGQYDVVTCMEMLEHV----------------------------
UBIE_RALEH      GRDRLLNKGI------------------------------------------------------------
UBIE_BURXL      GRDRLLDKGVITPAL--LCDAEKIPFPDNYFDVVTV----------------------------------
UBIE_BURPP      GRDRLLDKGVITPAL--LCDAEKIPFPDNYFDVVTV----------------------------------
UBIE_BURCM      GRDRLLDKGIV--TPSLLCDAEKIPFPDNYFDVVTV----------------------------------
UBIE_BURCH      GRDRLLDKGIV--TPSLLCDAEKIPFPDNYFDVVTV----------------------------------
UBIE_BURCA      GRDRLLDKGIV--TPSLLCDAEKIPFPDNYFDVVTV----------------------------------
UBIE_BURA4      GRDRLLDKGIV--TPSLLCDAEKIPFPDNYFDVVTV----------------------------------
UBIG_VIBCM      ARLHALETGTKLTYIQSTVEAHAEANPHTYDVVTCMEMLEHV----------------------------
UBIG_VIBCH      ARLHALETGTKLTYIQSTVEAHAEANPHTYDVVTCMEMLEHV----------------------------
UBIG_VIBC3      ARLHALETGTKLTYIQSTVEAHAEANPHTYDVVTCMEMLEHV----------------------------
UBIG_SODGM      ARLHALESGVMLAYHQQTVEEHAEAHPGAYDVVTCMEMLEHV----------------------------
UBIG_HAHCH      ARLHGLESGVSVDYRRTTIXXXXXXXXXSFDVVTCMEMLEHV----------------------------
UBIG_CHRVO      AQLHSLESGVPIDYRCVAVEDLAAEMPGAFDAVTCMEMLEHV----------------------------
UBIE_THET2      ARRKAEARGL--EVRFLEADALALP---------------------------------------------
UBIE_GEOSF      GKQKVAASSYAGRINMQVAPCEDIPADDSFDSI-------------------------------------
UBIE_BURP8      GRDRLIDKGVITPTL--LCDAEKIPFPDNYFDVVTV----------------------------------
UBIE_BURCJ      GRDRLLDKGVV--TPSLLCDAEKIPFPDNYFDVVTV----------------------------------
UBIE_BURCC      GRDRLLDKGVV--TPSLLCDAEKIPFPDNYFDVVTV----------------------------------
PIMT_METTH      LYERARKK--------------------------------------------------------------
UBIG_YERE8      ARLHALETGTKLDYVQETVESHAQKHPQYYDVVTCMEMLEHV----------------------------
UBIG_RHOS5      ARLHAEQSGLTIDYRNTTAE-DLAAAGERFDVVLNMEVVEHVADP--LAYLTACRELLKPGGLMVCSTLN
UBIG_RALSO      ADLHSLEAGVAVDYXXXXXXXXXXXXPGSFDVVTCMEMLEHV----------------------------
UBIG_NITOC      ARLHALEEGL--EIDYQQISVERLAETKSFDVITNLEMLEHV----------------------------
UBIE_SINMW      GAERARKKGIEANLEFVEANAEDLPAANSFD---------------------------------------
UBIE_SERP5      GREKLRDRGIIGNVNYVQANAEALPFPDNYFDCITISF-------GLRNVTDK------DKALRSMFRVL
PIMT3_GEOUR     ADKRLKELGYK-NVAVKYGDYLGWPEYAPFDAVIITASVNHIPP--------------------------
PIMT2_POLSJ     ARQRLQKLGY-DNVQVRLGDYHGWEEHAPYDAILVTAAASHIPP--------------------------
Y1399_STACT     ANETK-------NLDVQYGHFFDIPFDQPFDYIVTSFAFHHVKPEEKSDAIKTMMHSLTDDGKLLI----
UBIG_VIBSL      ARLHALETGTLDYIQSTIEDHAE-QNPQAYDVVTCMEMLEHV----------------------------
UBIG_THICR      ARLHSLDTETKVNYHLISAEDHAQTHEEEYDIVTCMEMLEHV----------------------------
UBIG_RHOSK      AKLHAEQSGLAIDYRNTTAE-ALAAAGERFDVVLNMEVVEHVADP--LAYLTACRELLKPGGLMICSTLN
UBIG_PSEU2      AQLHQLESGVSVEYRQITAEDMAEEMPEQYDVVTCLEMLEHV----------------------------
UBIG_PSE14      AQLHQLESGVSVEYRQITAEDMAEEMPEQYDVVTCLEMLEHV----------------------------
UBIG_HAES2      ARLHAKEQGLVIDVEEFLQKQTALYA-EKFDVITCMEMLEHVPDP--LSIIQSCRALLKPNGVLFFSTIN
UBIE_SHESR      GRTKLRDRGIVGNVSYVQANAEALPFPDNHFDIITI----------------------------------
UBIE_SHESM      GRTKLRDRGIVGNVSYVQANAEALPFPDNHFDIITI----------------------------------
UBIE_SHESA      GRTKLRDRGIVGNVSYVQANAEALPFPDNHFDIITI----------------------------------
Y1145_PYRAB     AKKSAEVNSL------------------------------------------------------------
UBIG_SHESW      ARLHALETGVNITYVKNTAEAHSQDHQGYYDVVTCMEMLEHV----------------------------
UBIG_SHEPC      ARLHALETGVNITYVKNTAEAHSQDHQGYYDVVTCMEMLEHV----------------------------
UBIG_NITEU      AKLHLLESGNQVDYRKITVEALATERPRYYDVVTCMEMLEHV----------------------------
UBIG_HAES1      ARLHAKEQGLVIDVEEFLQKQTALYA-EKFDVITCMEMLEHVPDP--LSIIQSCRALLKPNGVLFFSTIN
UBIG_DECAR      AKLHLLETG-------QKVDYRKISVEEEFDAVTCLEMLEHV----------------------------
UBIG_ALHEH      ARLHALEMEVEVAYRQITVEELADSDEPRFDAVTCLEMLEHV----------------------------
UBIE_SHEFN      GRTKLRDKGIVNNVSYVQANAEALPFPDNHFDIITI----------------------------------
UBIE_BURS3      GRDRLLDKGVV--TPSLLCDAEKIPFPDNYFDLVTV----------------------------------
MTL10_HUMAN     SGSIIEKEGLS-NIKLKVEDFLNLSTQSGFHICIDKGTFDAISLNKRKQYVKSLSRVLKVKGFFLITS--
CBIT_THEAC      TMRNCRNLCRFSNYRIVISDVYKYDSDEEFDAVFVGG-----GTARIHDLFERIERMVHHASRVVVNAI-
UBIG_RALEJ      ADLHSLESGVAVNYXXXXXXXXXXXXPGSVDVVTCMEMLEHV----------------------------
UBIG_BURP8      ADLHSLESGVTVNYEEIAAETLAAREPASFDVATCMEMLEHV----------------------------
UBIG_ACIAC      AQLHALEAG-TPDIQYREVSVEALPAS--FDTVTCMEMLEHV----------------------------
UBIE_RHIME      GAERARKKGIEANLDFVEANAEDLPAANSFD---------------------------------------
UBIE_AGRVS      GQERAQKKGLSDNLTFVEANAEALP---------------------------------------------
UBIE_AGRT5      GEERAAKKKLSDNLTFVEANAEELP---------------------------------------------
UBIE_AGRRK      GAERAAKKKLTDNLTFVEANAEELP---------------------------------------------
UBIG_METCA      AEEHCRESGLTVAYRQISAEALADSQPGEFDVVTCMEMLEHV----------------------------
UBIE_SHESW      GRTKLRDKGIVNNVSYVQANAEALPFPDNHFDIITI----------------------------------
UBIE_SHEPC      GRTKLRDKGIVNNVSYVQANAEALPFPDNHFDIITI----------------------------------
PIMT_PYRHO      AKRNLERAGVK-NVHVILGDSKGFPPKSPYDAII------------------------------------
PIMT_DESVV      TRDRALR---YTRIRCRLDDGTLWPESAPFDRIVTAGGPEIPVP---------LVEQLADPGVMVL----
PIMT_DESVH      TRDRALR---YTRIRCRLDDGTLWPESAPFDRIVTAGGPEIPVP---------LVEQLADPGVMVL----


                         .         *         .         .         .         .         +:350
query           QPYPALATNPFIEKYIFPGGYIPSLAEVLPAIQKSGLLVKDIEILPMHYAHTLRHWRERFVARKAEAVAL
YLP3_PSEPU      RPV-GRGAGEFIDRYVFPHGELPHLSMISASICEAGLEVVDVESLRLHYAKTLHHWSENLENQLHKAAAL
CFA_ECOLI       SKKTDLNVDPWINKYIFPNGCLPSVRQIAQS-SEPHFVMEDWHNFGADYDTTLMAWYERFLAAWPEIADN
CFA_ECOL6       SKKTDLNVDPWINKYIFPNGCLPSVRQIAQS-SEPHFVMEDWHNFGADYDTTLMAWYERFLAAWPEIADN
MMA1_MYCTU      LTMSDLRFLKFLRESIFPGGELPSEPDIVDNAQAAGFTIEHVQLLQQHYARTLDAWAANLQAARERAIAV
MMA1_MYCTA      LTMSDLRFLKFLRESIFPGGELPSEPDIVDNAQAAGFTIEHVQLLQQHYARTLDAWAANLQAARERAIAV
MMA1_MYCBO      LTMSDLRFLKFLRESIFPGGELPSEPDIVDNAQAAGFTIEHVQLLQQHYARTLDAWAANLQAARERAIAV
CFA2_MYCLE      TPMSLLRFIKFILTEIFPGGRLPKISQVDHYSSNAGFTVERYHRIGSHYVPTLNAWAAALEAHKDEAIAL
CFA2_MYCTU      IPDKEEATSPFILTEIFPGGRLPRISQVDYYSSNAGWKVERYHRIGANYVPTLNAWADALQAHKDEAIAL
CFA2_MYCBO      IPDKEEATSPFILTEIFPGGRLPRISQVDYYSSNAGWKVERYHRIGANYVPTLNAWADALQAHKDEAIAL
CFA1_MYCTU      GLHPKEIHEKFIVTEIFPGGRLPSIPMVQECASANGFTVTRVQSLQPHYAKTLDLWSAALQANKGQAIAL
CFA1_MYCTA      GLHPKEIHEKFIVTEIFPGGRLPSIPMVQECASANGFTVTRVQSLQPHYAKTLDLWSAALQANKGQAIAL
ERG6_MAGGR      ----------------------------------------------------------------------
ERG6_SCHPO      ----------------------------------------------------------------------
ERG6_NEUCR      ----------------------------------------------------------------------
UBIE_PSEMY      KP-----GNPLLAK--------------------------------------------------------
ERG6_PNECA      ----------------------------------------------------------------------
SMT2_ORYSJ      ----------------------------------------------------------------------
SMT1_DICDI      ----------------------------------------------------------------------
PEAM1_ARATH     ----------------------------------------------------------------------
UBIE_AZOVD      KPSNAL----------------------------------------------------------------
SMT1_ORYSJ      ----------------------------------------------------------------------
PEAM2_ARATH     ----------------------------------------------------------------------
UBIG_BORA1      ----------------------------------------------------------------------
UBIE_PSEU5      KP--------------------------------------------------------------------
UBIE_RHILO      ----------------------------------------------------------------------
UBIE_PSEFS      KPTNALMSKVY-DTYSF--AFMPLMGKLI-----------------------------------------
PEAMT_SPIOL     ----------------------------------------------------------------------
UBIG_PECCP      ----------------------------------------------------------------------
UBIG_COXBU      RNFKAYLYTIVGAEYVF-----------------------------------------------------
UBIG_COXBR      RNFKAYLYTIVGAEYVF-----------------------------------------------------
UBIG_COXBN      RNFKAYLYTIVGAEYVF-----------------------------------------------------
UBIG_COXB2      RNFKAYLYTIVGAEYVF-----------------------------------------------------
UBIG_COXB1      RNFKAYLYTIVGAEYVF-----------------------------------------------------
PEAM3_ARATH     ----------------------------------------------------------------------
ERG6_YARLI      ----------------------------------------------------------------------
UBIG_ENT38      ----------------------------------------------------------------------
UBIE_PSEPU      KPTNKLMSKAY-----------------------------------------------------------
UBIE_PSEE4      KPTNKLMSKAY-----------------------------------------------------------
UBIG_ACTP2      ----------------------------------------------------------------------
UBIE_PSEPF      KPTNALMSKAY-DAYSF--AFMPLMGKLI-----------------------------------------
SMT1_ARATH      ----------------------------------------------------------------------
UBIG_ENTS8      ----------------------------------------------------------------------
UBIG_BORPA      ----------------------------------------------------------------------
UBIG_BORBR      ----------------------------------------------------------------------
UBIG_ACTP7      ----------------------------------------------------------------------
UBIE_STRMK      ----------------------------------------------------------------------
UBIE_PSEPW      KPTNKLMSKAY-----------------------------------------------------------
UBIE_PSEPG      KPTNKLMSRAY-----------------------------------------------------------
GTOMC_ARATH     ----------------------------------------------------------------------
UBIE_XANCP      ----------------------------------------------------------------------
UBIG_SALPK      ----------------------------------------------------------------------
UBIG_SALPA      ----------------------------------------------------------------------
UBIG_ERWCT      ----------------------------------------------------------------------
UBIG_BORPE      ----------------------------------------------------------------------
UBIE_XANAC      ----------------------------------------------------------------------
UBIG_PSYA2      R---------------------------------------------------------------------
UBIE_RHIEC      ----------------------------------------------------------------------
UBIE_OCHA4      ----------------------------------------------------------------------
UBIE_MARMS      ----------------------------------------------------------------------
SMT2_ARATH      ----------------------------------------------------------------------
UBIG_PSYCK      R---------------------------------------------------------------------
UBIE_PSEPK      KPTNKLMSKAY-----------------------------------------------------------
UBIE_PSEP1      KPTNKLMSKAY-----------------------------------------------------------
UBIG_SALPC      ----------------------------------------------------------------------
UBIG_SALG2      ----------------------------------------------------------------------
UBIG_SALEP      ----------------------------------------------------------------------
UBIG_SALCH      ----------------------------------------------------------------------
UBIG_NITMU      ----------------------------------------------------------------------
UBIG_KLEP7      ----------------------------------------------------------------------
UBIG_ECO5E      ----------------------------------------------------------------------
UBIG_ECO57      ----------------------------------------------------------------------
UBIG_CAUCR      RTLKALALAKIGAEYV------------------------------------------------------
UBIG_CAUCN      RTLKALALAKIGAEYV------------------------------------------------------
UBIE_RHIL3      ----------------------------------------------------------------------
UBIE_RALME      ----------------------------------------------------------------------
UBIE_PSEOL      ----------------------------------------------------------------------
UBIE_CELJU      ----------------------------------------------------------------------
PIMT_METBU      TQYQTL----------------------------------------------------------------
UBIG_SHIDS      ----------------------------------------------------------------------
UBIG_SALAR      ----------------------------------------------------------------------
UBIG_PHOLL      ----------------------------------------------------------------------
UBIG_MARMM      RTSKAFA---------------------------------------------------------------
UBIG_ESCF3      ----------------------------------------------------------------------
UBIG_ECOUT      ----------------------------------------------------------------------
UBIG_ECOLU      ----------------------------------------------------------------------
UBIG_ECOLI      ----------------------------------------------------------------------
UBIG_ECOL6      ----------------------------------------------------------------------
UBIG_ECOL5      ----------------------------------------------------------------------
UBIG_ECOHS      ----------------------------------------------------------------------
UBIG_ECODH      ----------------------------------------------------------------------
UBIG_ECOBW      ----------------------------------------------------------------------
UBIG_ECO81      ----------------------------------------------------------------------
UBIG_ECO45      ----------------------------------------------------------------------
UBIG_ECO27      ----------------------------------------------------------------------
UBIG_ECO24      ----------------------------------------------------------------------
UBIE_XANOM      ----------------------------------------------------------------------
UBIE_THICR      K-----VTQPLLAK-----AYDFYSFNILP---KMGKLIADDEASYQYLAESIRMHPDQETLKKMMLEAG
UBIE_STRM5      ----------------------------------------------------------------------
UBIE_RHILW      ----------------------------------------------------------------------
UBIG_SHEAM      ----------------------------------------------------------------------
UBIG_SALTY      ----------------------------------------------------------------------
UBIG_SALTI      ----------------------------------------------------------------------
UBIG_SALSV      ----------------------------------------------------------------------
UBIG_SALNS      ----------------------------------------------------------------------
UBIG_SALHS      ----------------------------------------------------------------------
UBIG_SALDC      ----------------------------------------------------------------------
UBIG_SALA4      ----------------------------------------------------------------------
UBIE_BRUSI      ----------------------------------------------------------------------
UBIE_BRUME      ----------------------------------------------------------------------
UBIE_BRUMB      ----------------------------------------------------------------------
UBIE_BRUAB      ----------------------------------------------------------------------
UBIE_BRUA2      ----------------------------------------------------------------------
UBIE_BRUA1      ----------------------------------------------------------------------
UBIG_RICAH      RTKKAYALGIIVAEYIL--GWVP-----------------------------------------------
UBIG_KLEP3      ----------------------------------------------------------------------
UBIG_HAEDU      ----------------------------------------------------------------------
UBIG_ACIAD      ----------------------------------------------------------------------
UBIE_TERTT      ----------------------------------------------------------------------
UBIE_IDILO      KPVSA-TLNQVYDFYSF--NILPKMGQVV-----------------------------------------
SMT3B_ARATH     ----------------------------------------------------------------------
UBIG_PSEU5      ----------------------------------------------------------------------
UBIE_RALEJ      ----------------------------------------------------------------------
UBIG_RHIME      R---------------------------------------------------------------------
UBIG_PROMH      ----------------------------------------------------------------------
UBIG_CITK8      ----------------------------------------------------------------------
UBIG_CAUSK      RTLKALALAKIGAEYV------------------------------------------------------
UBIE_RHIE6      ----------------------------------------------------------------------
UBIE_PSEU2      KPTNKLMSKAY-DAYSF--AFMPLMGKLV-----------------------------------------
UBIE_PSESM      KPTNKLMSKAY-DAYSF--AFMPLMGKLV-----------------------------------------
UBIE_PSE14      KPTNKLMSKAY-DAYSF--AFMPLMGKLV-----------------------------------------
UBIE_CUPTR      ----------------------------------------------------------------------
UBIE_BRUSU      ----------------------------------------------------------------------
UBIE_BRUC2      ----------------------------------------------------------------------
UBIG_SHISS      ----------------------------------------------------------------------
UBIG_SHIFL      ----------------------------------------------------------------------
UBIG_SHIF8      ----------------------------------------------------------------------
UBIG_SHIBS      ----------------------------------------------------------------------
UBIG_SHIB3      ----------------------------------------------------------------------
UBIG_PSEAB      ----------------------------------------------------------------------
UBIG_ECOSM      ----------------------------------------------------------------------
UBIG_ECOSE      ----------------------------------------------------------------------
UBIG_ECOLC      ----------------------------------------------------------------------
UBIG_ECO8A      ----------------------------------------------------------------------
UBIG_ECO55      ----------------------------------------------------------------------
UBIG_AZOSB      ----------------------------------------------------------------------
UBIE_XYLFM      ----------------------------------------------------------------------
UBIE_PSEA7      KPSSSLLSKAY-----------------------------------------------------------
UBIE_LEGPA      ----------------------------------------------------------------------
UBIG_PSEAE      ----------------------------------------------------------------------
UBIG_PSEA8      ----------------------------------------------------------------------
UBIG_PSEA7      ----------------------------------------------------------------------
UBIG_PHOPR      ----------------------------------------------------------------------
UBIG_ECO7I      ----------------------------------------------------------------------
UBIE_XYLFA      ----------------------------------------------------------------------
UBIE_RHISN      ----------------------------------------------------------------------
UBIE_LEGPL      ----------------------------------------------------------------------
UBIE_LEGPC      ----------------------------------------------------------------------
UBIG_PASMU      ----------------------------------------------------------------------
UBIG_IDILO      ----------------------------------------------------------------------
UBIG_AZOSE      ----------------------------------------------------------------------
UBIG_AERS4      ----------------------------------------------------------------------
UBIG_ACIBY      ----------------------------------------------------------------------
UBIG_ACIBS      ----------------------------------------------------------------------
UBIG_ACIB5      ----------------------------------------------------------------------
UBIG_ACIB3      ----------------------------------------------------------------------
UBIE_XYLFT      ----------------------------------------------------------------------
UBIE_XYLF2      ----------------------------------------------------------------------
UBIE_BORPE      RVAKPLA--PAYDWYSF-----------------------------------------------------
UBIE_BORPA      RVAKPLA--PAYDWYSF-----------------------------------------------------
UBIE_BORBR      RVAKPLA--PAYDWYSF-----------------------------------------------------
UBIE_BACTN      ----------------------------------------------------------------------
UBIG_VIBPA      ----------------------------------------------------------------------
UBIG_VIBFM      ----------------------------------------------------------------------
UBIG_THIDA      ----------------------------------------------------------------------
UBIG_SHEPA      ----------------------------------------------------------------------
UBIG_SHEHH      ----------------------------------------------------------------------
UBIG_SHEB9      ----------------------------------------------------------------------
UBIG_SHEB8      ----------------------------------------------------------------------
UBIG_SHEB5      ----------------------------------------------------------------------
UBIG_SHEB2      ----------------------------------------------------------------------
UBIG_SERP5      ----------------------------------------------------------------------
UBIG_METS4      ----------------------------------------------------------------------
UBIG_ACIBC      ----------------------------------------------------------------------
UBIE_SACD2      ----------------------------------------------------------------------
UBIE_PSEAE      KPSSNLLSKAY-----------------------------------------------------------
UBIE_PSEAB      KPSSNLLSKAY-----------------------------------------------------------
UBIE_PSEA8      KPSSNLLSKAY-----------------------------------------------------------
UBIE_LEGPH      ----------------------------------------------------------------------
UBIE_BURTA      ----------------------------------------------------------------------
UBIE_BURPS      ----------------------------------------------------------------------
UBIE_BURP6      ----------------------------------------------------------------------
UBIE_BURP1      ----------------------------------------------------------------------
UBIE_BURP0      ----------------------------------------------------------------------
UBIE_BURMS      ----------------------------------------------------------------------
UBIE_BURMA      ----------------------------------------------------------------------
UBIE_BURM9      ----------------------------------------------------------------------
UBIE_BURM7      ----------------------------------------------------------------------
UBIE_BURM1      ----------------------------------------------------------------------
YJHP_ECOLI      ----------------------------------------------------------------------
UBIG_VIBVY      ----------------------------------------------------------------------
UBIG_VIBVU      ----------------------------------------------------------------------
UBIG_VIBF1      ----------------------------------------------------------------------
UBIG_RHOFD      ----------------------------------------------------------------------
UBIG_HAEPS      R---------------------------------------------------------------------
UBIG_COLP3      ----------------------------------------------------------------------
UBIE_BURVG      ----------------------------------------------------------------------
UBIG_VIBHB      ----------------------------------------------------------------------
UBIG_ROSDO      R---------------------------------------------------------------------
UBIE_ACICJ      ----------------------------------------------------------------------
UBIG_YERPY      ----------------------------------------------------------------------
UBIG_YERPS      ----------------------------------------------------------------------
UBIG_YERPP      ----------------------------------------------------------------------
UBIG_YERPN      ----------------------------------------------------------------------
UBIG_YERPG      ----------------------------------------------------------------------
UBIG_YERPE      ----------------------------------------------------------------------
UBIG_YERPB      ----------------------------------------------------------------------
UBIG_YERPA      ----------------------------------------------------------------------
UBIG_YERP3      ----------------------------------------------------------------------
UBIG_RHISN      R---------------------------------------------------------------------
UBIG_ERWT9      ----------------------------------------------------------------------
UBIE_RALEH      ----------------------------------------------------------------------
UBIE_BURXL      ----------------------------------------------------------------------
UBIE_BURPP      ----------------------------------------------------------------------
UBIE_BURCM      ----------------------------------------------------------------------
UBIE_BURCH      ----------------------------------------------------------------------
UBIE_BURCA      ----------------------------------------------------------------------
UBIE_BURA4      ----------------------------------------------------------------------
UBIG_VIBCM      ----------------------------------------------------------------------
UBIG_VIBCH      ----------------------------------------------------------------------
UBIG_VIBC3      ----------------------------------------------------------------------
UBIG_SODGM      ----------------------------------------------------------------------
UBIG_HAHCH      ----------------------------------------------------------------------
UBIG_CHRVO      ----------------------------------------------------------------------
UBIE_THET2      ----------------------------------------------------------------------
UBIE_GEOSF      ----------------------------------------------------------------------
UBIE_BURP8      ----------------------------------------------------------------------
UBIE_BURCJ      ----------------------------------------------------------------------
UBIE_BURCC      ----------------------------------------------------------------------
PIMT_METTH      ----------------------------------------------------------------------
UBIG_YERE8      ----------------------------------------------------------------------
UBIG_RHOS5      R---------------------------------------------------------------------
UBIG_RALSO      ----------------------------------------------------------------------
UBIG_NITOC      ----------------------------------------------------------------------
UBIE_SINMW      ----------------------------------------------------------------------
UBIE_SERP5      KPGGRLLVLEFSKPLLAPKAYDAYSFHVLPKIGE--LVVKDPE---------------------------
PIMT3_GEOUR     ----------------------------------------------------------------------
PIMT2_POLSJ     ----------------------------------------------------------------------
Y1399_STACT     ----------------------------------------------------------------------
UBIG_VIBSL      ----------------------------------------------------------------------
UBIG_THICR      ----------------------------------------------------------------------
UBIG_RHOSK      R---------------------------------------------------------------------
UBIG_PSEU2      ----------------------------------------------------------------------
UBIG_PSE14      ----------------------------------------------------------------------
UBIG_HAES2      RTFKAWALVVLGAEYI------------------------------------------------------
UBIE_SHESR      ----------------------------------------------------------------------
UBIE_SHESM      ----------------------------------------------------------------------
UBIE_SHESA      ----------------------------------------------------------------------
Y1145_PYRAB     ----------------------------------------------------------------------
UBIG_SHESW      ----------------------------------------------------------------------
UBIG_SHEPC      ----------------------------------------------------------------------
UBIG_NITEU      ----------------------------------------------------------------------
UBIG_HAES1      HTFKAWALVVLGAEYI------------------------------------------------------
UBIG_DECAR      ----------------------------------------------------------------------
UBIG_ALHEH      ----------------------------------------------------------------------
UBIE_SHEFN      ----------------------------------------------------------------------
UBIE_BURS3      ----------------------------------------------------------------------
MTL10_HUMAN     ----------------------------------------------------------------------
CBIT_THEAC      ----------------------------------------------------------------------
UBIG_RALEJ      ----------------------------------------------------------------------
UBIG_BURP8      ----------------------------------------------------------------------
UBIG_ACIAC      ----------------------------------------------------------------------
UBIE_RHIME      ----------------------------------------------------------------------
UBIE_AGRVS      ----------------------------------------------------------------------
UBIE_AGRT5      ----------------------------------------------------------------------
UBIE_AGRRK      ----------------------------------------------------------------------
UBIG_METCA      ----------------------------------------------------------------------
UBIE_SHESW      ----------------------------------------------------------------------
UBIE_SHEPC      ----------------------------------------------------------------------
PIMT_PYRHO      ----------------------------------------------------------------------
PIMT_DESVV      ----------------------------------------------------------------------
PIMT_DESVH      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           YDERFFRMWEFYLAGSEMAFTHENFHIFQIQLAKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YLP3_PSEPU      VPEKTLRIWRLYLAGCAYAFEKGWINLHQILAVK----------------------------------
CFA_ECOLI       YSERFKRMFTYYLNACAGAFRARDIQLWQVVFSR----------------------------------
CFA_ECOL6       YSERFKRMFTYYLNACAGAFRARDIQLWQVVFSR----------------------------------
MMA1_MYCTU      QSEEVYNNFMHYLTGCAERFRRGLINVAQFTMTK----------------------------------
MMA1_MYCTA      QSEEVYNNFMHYLTGCAERFRRGLINVAQFTMTK----------------------------------
MMA1_MYCBO      QSEEVYNNFMHYLTGCAERFRRGLINVAQFTMTK----------------------------------
CFA2_MYCLE      QGRQIYDTYMHYLTGCSDLFRDRYTDVCQFTLVK----------------------------------
CFA2_MYCTU      KGQETYDIYMHYLRGCSDLFRDKYTDVCQFTLVK----------------------------------
CFA2_MYCBO      KGQETYDIYMHYLRGCSDLFRDKYTDVCQFTLVK----------------------------------
CFA1_MYCTU      QSEEVYERYMKYLTGCAEMF------------------------------------------------
CFA1_MYCTA      QSEEVYERYMKYLTGCAEMF------------------------------------------------
ERG6_MAGGR      --------------------------------------------------------------------
ERG6_SCHPO      --------------------------------------------------------------------
ERG6_NEUCR      --------------------------------------------------------------------
UBIE_PSEMY      --------------------------------------------------------------------
ERG6_PNECA      --------------------------------------------------------------------
SMT2_ORYSJ      --------------------------------------------------------------------
SMT1_DICDI      --------------------------------------------------------------------
PEAM1_ARATH     --------------------------------------------------------------------
UBIE_AZOVD      --------------------------------------------------------------------
SMT1_ORYSJ      --------------------------------------------------------------------
PEAM2_ARATH     --------------------------------------------------------------------
UBIG_BORA1      --------------------------------------------------------------------
UBIE_PSEU5      --------------------------------------------------------------------
UBIE_RHILO      --------------------------------------------------------------------
UBIE_PSEFS      --------------------------------------------------------------------
PEAMT_SPIOL     --------------------------------------------------------------------
UBIG_PECCP      --------------------------------------------------------------------
UBIG_COXBU      --------------------------------------------------------------------
UBIG_COXBR      --------------------------------------------------------------------
UBIG_COXBN      --------------------------------------------------------------------
UBIG_COXB2      --------------------------------------------------------------------
UBIG_COXB1      --------------------------------------------------------------------
PEAM3_ARATH     --------------------------------------------------------------------
ERG6_YARLI      --------------------------------------------------------------------
UBIG_ENT38      --------------------------------------------------------------------
UBIE_PSEPU      --------------------------------------------------------------------
UBIE_PSEE4      --------------------------------------------------------------------
UBIG_ACTP2      --------------------------------------------------------------------
UBIE_PSEPF      --------------------------------------------------------------------
SMT1_ARATH      --------------------------------------------------------------------
UBIG_ENTS8      --------------------------------------------------------------------
UBIG_BORPA      --------------------------------------------------------------------
UBIG_BORBR      --------------------------------------------------------------------
UBIG_ACTP7      --------------------------------------------------------------------
UBIE_STRMK      --------------------------------------------------------------------
UBIE_PSEPW      --------------------------------------------------------------------
UBIE_PSEPG      --------------------------------------------------------------------
GTOMC_ARATH     --------------------------------------------------------------------
UBIE_XANCP      --------------------------------------------------------------------
UBIG_SALPK      --------------------------------------------------------------------
UBIG_SALPA      --------------------------------------------------------------------
UBIG_ERWCT      --------------------------------------------------------------------
UBIG_BORPE      --------------------------------------------------------------------
UBIE_XANAC      --------------------------------------------------------------------
UBIG_PSYA2      --------------------------------------------------------------------
UBIE_RHIEC      --------------------------------------------------------------------
UBIE_OCHA4      --------------------------------------------------------------------
UBIE_MARMS      --------------------------------------------------------------------
SMT2_ARATH      --------------------------------------------------------------------
UBIG_PSYCK      --------------------------------------------------------------------
UBIE_PSEPK      --------------------------------------------------------------------
UBIE_PSEP1      --------------------------------------------------------------------
UBIG_SALPC      --------------------------------------------------------------------
UBIG_SALG2      --------------------------------------------------------------------
UBIG_SALEP      --------------------------------------------------------------------
UBIG_SALCH      --------------------------------------------------------------------
UBIG_NITMU      --------------------------------------------------------------------
UBIG_KLEP7      --------------------------------------------------------------------
UBIG_ECO5E      --------------------------------------------------------------------
UBIG_ECO57      --------------------------------------------------------------------
UBIG_CAUCR      --------------------------------------------------------------------
UBIG_CAUCN      --------------------------------------------------------------------
UBIE_RHIL3      --------------------------------------------------------------------
UBIE_RALME      --------------------------------------------------------------------
UBIE_PSEOL      --------------------------------------------------------------------
UBIE_CELJU      --------------------------------------------------------------------
PIMT_METBU      --------------------------------------------------------------------
UBIG_SHIDS      --------------------------------------------------------------------
UBIG_SALAR      --------------------------------------------------------------------
UBIG_PHOLL      --------------------------------------------------------------------
UBIG_MARMM      --------------------------------------------------------------------
UBIG_ESCF3      --------------------------------------------------------------------
UBIG_ECOUT      --------------------------------------------------------------------
UBIG_ECOLU      --------------------------------------------------------------------
UBIG_ECOLI      --------------------------------------------------------------------
UBIG_ECOL6      --------------------------------------------------------------------
UBIG_ECOL5      --------------------------------------------------------------------
UBIG_ECOHS      --------------------------------------------------------------------
UBIG_ECODH      --------------------------------------------------------------------
UBIG_ECOBW      --------------------------------------------------------------------
UBIG_ECO81      --------------------------------------------------------------------
UBIG_ECO45      --------------------------------------------------------------------
UBIG_ECO27      --------------------------------------------------------------------
UBIG_ECO24      --------------------------------------------------------------------
UBIE_XANOM      --------------------------------------------------------------------
UBIE_THICR      FDK-----------------------------------------------------------------
UBIE_STRM5      --------------------------------------------------------------------
UBIE_RHILW      --------------------------------------------------------------------
UBIG_SHEAM      --------------------------------------------------------------------
UBIG_SALTY      --------------------------------------------------------------------
UBIG_SALTI      --------------------------------------------------------------------
UBIG_SALSV      --------------------------------------------------------------------
UBIG_SALNS      --------------------------------------------------------------------
UBIG_SALHS      --------------------------------------------------------------------
UBIG_SALDC      --------------------------------------------------------------------
UBIG_SALA4      --------------------------------------------------------------------
UBIE_BRUSI      --------------------------------------------------------------------
UBIE_BRUME      --------------------------------------------------------------------
UBIE_BRUMB      --------------------------------------------------------------------
UBIE_BRUAB      --------------------------------------------------------------------
UBIE_BRUA2      --------------------------------------------------------------------
UBIE_BRUA1      --------------------------------------------------------------------
UBIG_RICAH      --------------------------------------------------------------------
UBIG_KLEP3      --------------------------------------------------------------------
UBIG_HAEDU      --------------------------------------------------------------------
UBIG_ACIAD      --------------------------------------------------------------------
UBIE_TERTT      --------------------------------------------------------------------
UBIE_IDILO      --------------------------------------------------------------------
SMT3B_ARATH     --------------------------------------------------------------------
UBIG_PSEU5      --------------------------------------------------------------------
UBIE_RALEJ      --------------------------------------------------------------------
UBIG_RHIME      --------------------------------------------------------------------
UBIG_PROMH      --------------------------------------------------------------------
UBIG_CITK8      --------------------------------------------------------------------
UBIG_CAUSK      --------------------------------------------------------------------
UBIE_RHIE6      --------------------------------------------------------------------
UBIE_PSEU2      --------------------------------------------------------------------
UBIE_PSESM      --------------------------------------------------------------------
UBIE_PSE14      --------------------------------------------------------------------
UBIE_CUPTR      --------------------------------------------------------------------
UBIE_BRUSU      --------------------------------------------------------------------
UBIE_BRUC2      --------------------------------------------------------------------
UBIG_SHISS      --------------------------------------------------------------------
UBIG_SHIFL      --------------------------------------------------------------------
UBIG_SHIF8      --------------------------------------------------------------------
UBIG_SHIBS      --------------------------------------------------------------------
UBIG_SHIB3      --------------------------------------------------------------------
UBIG_PSEAB      --------------------------------------------------------------------
UBIG_ECOSM      --------------------------------------------------------------------
UBIG_ECOSE      --------------------------------------------------------------------
UBIG_ECOLC      --------------------------------------------------------------------
UBIG_ECO8A      --------------------------------------------------------------------
UBIG_ECO55      --------------------------------------------------------------------
UBIG_AZOSB      --------------------------------------------------------------------
UBIE_XYLFM      --------------------------------------------------------------------
UBIE_PSEA7      --------------------------------------------------------------------
UBIE_LEGPA      --------------------------------------------------------------------
UBIG_PSEAE      --------------------------------------------------------------------
UBIG_PSEA8      --------------------------------------------------------------------
UBIG_PSEA7      --------------------------------------------------------------------
UBIG_PHOPR      --------------------------------------------------------------------
UBIG_ECO7I      --------------------------------------------------------------------
UBIE_XYLFA      --------------------------------------------------------------------
UBIE_RHISN      --------------------------------------------------------------------
UBIE_LEGPL      --------------------------------------------------------------------
UBIE_LEGPC      --------------------------------------------------------------------
UBIG_PASMU      --------------------------------------------------------------------
UBIG_IDILO      --------------------------------------------------------------------
UBIG_AZOSE      --------------------------------------------------------------------
UBIG_AERS4      --------------------------------------------------------------------
UBIG_ACIBY      --------------------------------------------------------------------
UBIG_ACIBS      --------------------------------------------------------------------
UBIG_ACIB5      --------------------------------------------------------------------
UBIG_ACIB3      --------------------------------------------------------------------
UBIE_XYLFT      --------------------------------------------------------------------
UBIE_XYLF2      --------------------------------------------------------------------
UBIE_BORPE      --------------------------------------------------------------------
UBIE_BORPA      --------------------------------------------------------------------
UBIE_BORBR      --------------------------------------------------------------------
UBIE_BACTN      --------------------------------------------------------------------
UBIG_VIBPA      --------------------------------------------------------------------
UBIG_VIBFM      --------------------------------------------------------------------
UBIG_THIDA      --------------------------------------------------------------------
UBIG_SHEPA      --------------------------------------------------------------------
UBIG_SHEHH      --------------------------------------------------------------------
UBIG_SHEB9      --------------------------------------------------------------------
UBIG_SHEB8      --------------------------------------------------------------------
UBIG_SHEB5      --------------------------------------------------------------------
UBIG_SHEB2      --------------------------------------------------------------------
UBIG_SERP5      --------------------------------------------------------------------
UBIG_METS4      --------------------------------------------------------------------
UBIG_ACIBC      --------------------------------------------------------------------
UBIE_SACD2      --------------------------------------------------------------------
UBIE_PSEAE      --------------------------------------------------------------------
UBIE_PSEAB      --------------------------------------------------------------------
UBIE_PSEA8      --------------------------------------------------------------------
UBIE_LEGPH      --------------------------------------------------------------------
UBIE_BURTA      --------------------------------------------------------------------
UBIE_BURPS      --------------------------------------------------------------------
UBIE_BURP6      --------------------------------------------------------------------
UBIE_BURP1      --------------------------------------------------------------------
UBIE_BURP0      --------------------------------------------------------------------
UBIE_BURMS      --------------------------------------------------------------------
UBIE_BURMA      --------------------------------------------------------------------
UBIE_BURM9      --------------------------------------------------------------------
UBIE_BURM7      --------------------------------------------------------------------
UBIE_BURM1      --------------------------------------------------------------------
YJHP_ECOLI      --------------------------------------------------------------------
UBIG_VIBVY      --------------------------------------------------------------------
UBIG_VIBVU      --------------------------------------------------------------------
UBIG_VIBF1      --------------------------------------------------------------------
UBIG_RHOFD      --------------------------------------------------------------------
UBIG_HAEPS      --------------------------------------------------------------------
UBIG_COLP3      --------------------------------------------------------------------
UBIE_BURVG      --------------------------------------------------------------------
UBIG_VIBHB      --------------------------------------------------------------------
UBIG_ROSDO      --------------------------------------------------------------------
UBIE_ACICJ      --------------------------------------------------------------------
UBIG_YERPY      --------------------------------------------------------------------
UBIG_YERPS      --------------------------------------------------------------------
UBIG_YERPP      --------------------------------------------------------------------
UBIG_YERPN      --------------------------------------------------------------------
UBIG_YERPG      --------------------------------------------------------------------
UBIG_YERPE      --------------------------------------------------------------------
UBIG_YERPB      --------------------------------------------------------------------
UBIG_YERPA      --------------------------------------------------------------------
UBIG_YERP3      --------------------------------------------------------------------
UBIG_RHISN      --------------------------------------------------------------------
UBIG_ERWT9      --------------------------------------------------------------------
UBIE_RALEH      --------------------------------------------------------------------
UBIE_BURXL      --------------------------------------------------------------------
UBIE_BURPP      --------------------------------------------------------------------
UBIE_BURCM      --------------------------------------------------------------------
UBIE_BURCH      --------------------------------------------------------------------
UBIE_BURCA      --------------------------------------------------------------------
UBIE_BURA4      --------------------------------------------------------------------
UBIG_VIBCM      --------------------------------------------------------------------
UBIG_VIBCH      --------------------------------------------------------------------
UBIG_VIBC3      --------------------------------------------------------------------
UBIG_SODGM      --------------------------------------------------------------------
UBIG_HAHCH      --------------------------------------------------------------------
UBIG_CHRVO      --------------------------------------------------------------------
UBIE_THET2      --------------------------------------------------------------------
UBIE_GEOSF      --------------------------------------------------------------------
UBIE_BURP8      --------------------------------------------------------------------
UBIE_BURCJ      --------------------------------------------------------------------
UBIE_BURCC      --------------------------------------------------------------------
PIMT_METTH      --------------------------------------------------------------------
UBIG_YERE8      --------------------------------------------------------------------
UBIG_RHOS5      --------------------------------------------------------------------
UBIG_RALSO      --------------------------------------------------------------------
UBIG_NITOC      --------------------------------------------------------------------
UBIE_SINMW      --------------------------------------------------------------------
UBIE_SERP5      --------------------------------------------------------------------
PIMT3_GEOUR     --------------------------------------------------------------------
PIMT2_POLSJ     --------------------------------------------------------------------
Y1399_STACT     --------------------------------------------------------------------
UBIG_VIBSL      --------------------------------------------------------------------
UBIG_THICR      --------------------------------------------------------------------
UBIG_RHOSK      --------------------------------------------------------------------
UBIG_PSEU2      --------------------------------------------------------------------
UBIG_PSE14      --------------------------------------------------------------------
UBIG_HAES2      --------------------------------------------------------------------
UBIE_SHESR      --------------------------------------------------------------------
UBIE_SHESM      --------------------------------------------------------------------
UBIE_SHESA      --------------------------------------------------------------------
Y1145_PYRAB     --------------------------------------------------------------------
UBIG_SHESW      --------------------------------------------------------------------
UBIG_SHEPC      --------------------------------------------------------------------
UBIG_NITEU      --------------------------------------------------------------------
UBIG_HAES1      --------------------------------------------------------------------
UBIG_DECAR      --------------------------------------------------------------------
UBIG_ALHEH      --------------------------------------------------------------------
UBIE_SHEFN      --------------------------------------------------------------------
UBIE_BURS3      --------------------------------------------------------------------
MTL10_HUMAN     --------------------------------------------------------------------
CBIT_THEAC      --------------------------------------------------------------------
UBIG_RALEJ      --------------------------------------------------------------------
UBIG_BURP8      --------------------------------------------------------------------
UBIG_ACIAC      --------------------------------------------------------------------
UBIE_RHIME      --------------------------------------------------------------------
UBIE_AGRVS      --------------------------------------------------------------------
UBIE_AGRT5      --------------------------------------------------------------------
UBIE_AGRRK      --------------------------------------------------------------------
UBIG_METCA      --------------------------------------------------------------------
UBIE_SHESW      --------------------------------------------------------------------
UBIE_SHEPC      --------------------------------------------------------------------
PIMT_PYRHO      --------------------------------------------------------------------
PIMT_DESVV      --------------------------------------------------------------------
PIMT_DESVH      --------------------------------------------------------------------