[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for atum0:AAK86489.1

[Show Plain Result]


## Summary of Sequence Search
    1::163
   94::123     6e-06  53%  130 aa  YQJF_ECOLI RecName: Full=Inner membrane protein yqjF;
   63::140     9e-05  37%  140 aa  YPHA_SHIFL RecName: Full=Inner membrane protein yphA;
   63::140     9e-05  37%  140 aa  YPHA_ECOLI RecName: Full=Inner membrane protein yphA;
    1::163

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxL
YQJF_ECOLI      ----------------------------------------------------------------------
YPHA_SHIFL      ---------------------------------------------------------------------V
YPHA_ECOLI      ---------------------------------------------------------------------V


                         .         .         *         .         .         .         .:140
query           FELVAGLAILAGFQTKIAAWALAVFCVFTGLVFHSGTVAVPGWPEPALGWINTLNGIMMMKNITLAGAYI
YQJF_ECOLI      -----------------------------------------------------VNSLMFMKNLTISGGFL
YPHA_SHIFL      MEVPAAILIVLGFFTR----PLAVLFIFYTL----GTAVIGHHYWDMTGDAVGPNMINFWKNVSIAGAFL
YPHA_ECOLI      MEVPAAILIVLGFFTR----PLAVLFIFYTL----GTAVIGHHYWDMTGDAVGPNMINFWKNVSIAGAFL


                         +         .         .         .         .         *         .:210
query           LLATFGAGAYSVDAKxxxxxxxx
YQJF_ECOLI      LLAITGPGAYSID----------
YPHA_SHIFL      LLAITGPGAISLDRR--------
YPHA_ECOLI      LLAITGPGAISLDRR--------