[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for atum0:AAK86566.1

[Show Plain Result]


## Summary of Sequence Search
    1::272
    1::272     e-131  84%  272 aa  FABI1_RHIME RecName: Full=Enoyl-[acyl-carrier-protein] reductase
    2::261     5e-96  65%  268 aa  FABI2_RHIME RecName: Full=Enoyl-[acyl-carrier-protein] reductase
    3::260     1e-83  56%  262 aa  FABI_RICBR RecName: Full=Enoyl-[acyl-carrier-protein] reductase
    5::256     5e-83  57%  261 aa  FABI_RICTY RecName: Full=Enoyl-[acyl-carrier-protein] reductase
    2::262     1e-82  54%  275 aa  FABI_HELPJ RecName: Full=Enoyl-[acyl-carrier-protein] reductase
    3::256     9e-82  56%  261 aa  FABI_RICPR RecName: Full=Enoyl-[acyl-carrier-protein] reductase
    3::256     1e-80  56%  260 aa  FABI_RICFE RecName: Full=Enoyl-[acyl-carrier-protein] reductase
    3::256     3e-79  55%  260 aa  FABI_RICCN RecName: Full=Enoyl-[acyl-carrier-protein] reductase
    2::262     6e-79  52%  275 aa  FABI_HELPY RecName: Full=Enoyl-[acyl-carrier-protein] reductase
    5::254     5e-72  55%  258 aa  FABI_BACSU RecName: Full=Enoyl-[acyl-carrier-protein] reductase
    4::258     2e-69  50%  258 aa  FABI_SYNY3 RecName: Full=Enoyl-[acyl-carrier-protein] reductase
    2::256     2e-69  50%  270 aa  FABI_AQUAE RecName: Full=Enoyl-[acyl-carrier-protein] reductase
    2::260     7e-69  50%  262 aa  FABI_SHIFL RecName: Full=Enoyl-[acyl-carrier-protein] reductase
    2::260     7e-69  50%  262 aa  FABI_ECOLI RecName: Full=Enoyl-[acyl-carrier-protein] reductase
    2::260     7e-69  50%  262 aa  FABI_ECO57 RecName: Full=Enoyl-[acyl-carrier-protein] reductase
    2::260     1e-68  50%  262 aa  FABI_SALTY RecName: Full=Enoyl-[acyl-carrier-protein] reductase
    2::256     8e-68  50%  262 aa  FABI_HAEIN RecName: Full=Enoyl-[acyl-carrier-protein] reductase
    2::252     1e-67  53%  261 aa  FABI_NEIMB RecName: Full=Enoyl-[acyl-carrier-protein] reductase
    4::258     1e-67  49%  258 aa  FABI_ANASP RecName: Full=Enoyl-[acyl-carrier-protein] reductase
    2::263     8e-67  52%  265 aa  FABI_PSEAE RecName: Full=Enoyl-[acyl-carrier-protein] reductase
    2::256     3e-54  41%  260 aa  FABI_BUCBP RecName: Full=Enoyl-[acyl-carrier-protein] reductase
    2::259     3e-54  40%  260 aa  FABI_BUCAI RecName: Full=Enoyl-[acyl-carrier-protein] reductase
   16::259     3e-42  37%  260 aa  FABI_BUCAP RecName: Full=Enoyl-[acyl-carrier-protein] reductase
   89::378     2e-34  38%  385 aa  FABI_BRANA RecName: Full=Enoyl-[acyl-carrier-protein] reductase
    2::266     2e-29  39%  269 aa  INHA_MYCS2 RecName: Full=Enoyl-[acyl-carrier-protein] reductase
    2::266     4e-29  39%  269 aa  INHA_MYCTU RecName: Full=Enoyl-[acyl-carrier-protein] reductase
    2::266     4e-29  39%  269 aa  INHA_MYCBO RecName: Full=Enoyl-[acyl-carrier-protein] reductase
    2::265     1e-26  36%  268 aa  INHA_MYCAV RecName: Full=Enoyl-[acyl-carrier-protein] reductase
    2::252     2e-19  31%  263 aa  UCPA_SALTY RecName: Full=Oxidoreductase ucpA;         EC=1.-.-.-;
    2::252     2e-19  31%  263 aa  UCPA_SALTI RecName: Full=Oxidoreductase ucpA;         EC=1.-.-.-;
   69::245     6e-19  32%  250 aa  FABL_BACSU RecName: Full=Enoyl-[acyl-carrier-protein] reductase
    2::252     4e-17  30%  263 aa  UCPA_ECO57 RecName: Full=Oxidoreductase ucpA;         EC=1.-.-.-;
    2::252     6e-17  30%  263 aa  UCPA_ECOLI RecName: Full=Oxidoreductase ucpA;         EC=1.-.-.-;
   32::249     6e-17  29%  255 aa  HDHA_ECOLI RecName: Full=7-alpha-hydroxysteroid dehydrogenase;     
   32::249     6e-17  29%  255 aa  HDHA_ECO57 RecName: Full=7-alpha-hydroxysteroid dehydrogenase;     
   33::278     1e-16  31%  281 aa  SOU1_CANAL RecName: Full=Sorbose reductase SOU1;       
    2::244     9e-16  31%  248 aa  YKVO_BACSU RecName: Full=Uncharacterized oxidoreductase ykvO;      
   38::284     1e-15  30%  289 aa  YHDF_BACSU RecName: Full=Uncharacterized oxidoreductase yhdF;      
    2::246     2e-15  28%  248 aa  FABG_CHLTR RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    2::246     2e-15  30%  248 aa  FABG_CHLMU RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   66::272     6e-15  30%  292 aa  SPS19_YEAST RecName: Full=Peroxisomal 2,4-dienoyl-CoA reductase
  147::292     1e-14  33%  294 aa  YGHA_ECOLI RecName: Full=Uncharacterized oxidoreductase yghA;      
  147::292     1e-14  33%  294 aa  YGHA_ECO57 RecName: Full=Uncharacterized oxidoreductase yghA;      
   12::252     2e-14  28%  256 aa  MTDH_UROFA RecName: Full=Probable NADP-dependent mannitol
    5::241     5e-14  27%  244 aa  DCXR_BOVIN RecName: Full=L-xylulose reductase;         Short=XR;   
    6::241     5e-14  26%  244 aa  CBR2_PIG RecName: Full=Carbonyl reductase [NADPH] 2;       
   31::259     6e-14  31%  262 aa  VER1_ASPPA RecName: Full=Versicolorin reductase;       
   23::213     8e-14  30%  272 aa  THR1_GLOLA RecName: Full=Trihydroxynaphthalene reductase;       
    5::244     1e-13  31%  244 aa  FABG_SHIFL RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    5::244     1e-13  31%  244 aa  FABG_ECOLI RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   35::261     2e-13  28%  264 aa  STCU_EMENI RecName: Full=Versicolorin reductase;       
   39::280     3e-13  32%  285 aa  YHXC_BACSU RecName: Full=Uncharacterized oxidoreductase yhxC;      
    3::244     3e-13  27%  244 aa  FABG_VIBHA RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    2::235     9e-13  29%  237 aa  YJGI_ECOLI RecName: Full=Uncharacterized oxidoreductase yjgI;      
   41::252     1e-12  28%  273 aa  YXBG_BACSU RecName: Full=Uncharacterized oxidoreductase yxbG;      
   19::258     1e-12  29%  261 aa  YQC8_SCHPO RecName: Full=Uncharacterized oxidoreductase C1739.08c; 
   47::245     1e-12  34%  255 aa  HSD_STREX RecName: Full=3-alpha-(or 20-beta)-hydroxysteroid
    6::241     1e-12  27%  244 aa  CBR2_MOUSE RecName: Full=Carbonyl reductase [NADPH] 2;       
    6::258     2e-12  25%  263 aa  YVRD_BACSU RecName: Full=Uncharacterized oxidoreductase yvrD;      
    9::251     2e-12  28%  256 aa  GNO_GLUOX RecName: Full=Gluconate 5-dehydrogenase;       
   64::270     3e-12  32%  292 aa  DECR2_RAT RecName: Full=Peroxisomal 2,4-dienoyl-CoA reductase;     
   86::270     3e-12  33%  292 aa  DECR2_HUMAN RecName: Full=Peroxisomal 2,4-dienoyl-CoA reductase;   
   58::250     3e-12  27%  253 aa  BACC2_BACSU RecName: Full=Bacilysin biosynthesis oxidoreductase
   49::250     5e-12  27%  548 aa  Y4VI_RHISN RecName: Full=Uncharacterized short-chain type
   18::242     5e-12  26%  247 aa  FABG_MYCTU RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   26::250     5e-12  28%  255 aa  FABG_MYCS2 RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   18::242     5e-12  26%  247 aa  FABG_MYCBO RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   57::244     5e-12  32%  244 aa  FABG_BUCAI RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   60::243     6e-12  27%  245 aa  FABG_BUCBP RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   86::270     6e-12  33%  292 aa  DECR2_PONAB RecName: Full=Peroxisomal 2,4-dienoyl-CoA reductase;   
   20::275     6e-12  29%  278 aa  ARDH_PICST RecName: Full=D-arabinitol 2-dehydrogenase
   23::278     6e-12  28%  281 aa  ARDH_CANAL RecName: Full=D-arabinitol 2-dehydrogenase
   33::280     8e-12  27%  280 aa  SOU2_CANAL RecName: Full=Sorbose reductase homolog SOU2;       
  134::277     8e-12  32%  278 aa  FIXR_BRAJA RecName: Full=Protein fixR;
  149::298     1e-11  33%  299 aa  YHXD_BACSU RecName: Full=Uncharacterized oxidoreductase yhxD;      
   29::244     1e-11  27%  247 aa  Y1385_MYCBO RecName: Full=Uncharacterized oxidoreductase Mb1385;   
   29::244     1e-11  27%  247 aa  Y1350_MYCTU RecName: Full=Uncharacterized oxidoreductase
   11::232     1e-11  29%  237 aa  CBR4_DANRE RecName: Full=Carbonyl reductase family member 4;       
   21::255     1e-11  25%  260 aa  DHRS4_RABIT RecName: Full=Dehydrogenase/reductase SDR family member
    5::241     1e-11  24%  244 aa  DCXR_HUMAN RecName: Full=L-xylulose reductase;         Short=XR;   
   40::281     2e-11  28%  286 aa  GS39_BACSU RecName: Full=General stress protein 39;       
    5::244     2e-11  28%  244 aa  FABG_SALTY RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    5::244     2e-11  28%  244 aa  FABG_SALTI RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   10::251     2e-11  29%  254 aa  KDUD_BACSU RecName: Full=2-dehydro-3-deoxy-D-gluconate
   30::283     2e-11  29%  288 aa  GRDH1_ARATH RecName: Full=Glucose and ribitol dehydrogenase homolog
    5::246     2e-11  29%  248 aa  FABG_AQUAE RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   13::243     3e-11  29%  253 aa  YOHF_ECOLI RecName: Full=Uncharacterized oxidoreductase yohF;      
   39::242     3e-11  27%  246 aa  NODG_AZOBR RecName: Full=Nodulation protein G;
   60::241     3e-11  28%  244 aa  DCXR_RAT RecName: Full=L-xylulose reductase;         Short=XR;     
   80::246     4e-11  31%  248 aa  Y182_METEA RecName: Full=Uncharacterized oxidoreductase
   26::250     4e-11  27%  255 aa  FABG_MYCAV RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    1::240     4e-11  29%  242 aa  FABG_HAEIN RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    5::245     4e-11  31%  248 aa  FABG_CHLPN RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   24::279     5e-11  28%  282 aa  ARDH_CANTR RecName: Full=D-arabinitol 2-dehydrogenase
   18::192     1e-10  27%  230 aa  Y2049_STAEQ RecName: Full=Uncharacterized oxidoreductase SERP2049; 
   18::192     1e-10  27%  230 aa  Y2036_STAES RecName: Full=Uncharacterized oxidoreductase SE_2036;  
   17::263     1e-10  28%  266 aa  MTDH_ALTAL RecName: Full=Probable NADP-dependent mannitol
    5::241     1e-10  23%  244 aa  DCXR_MESAU RecName: Full=L-xylulose reductase;         Short=XR;   
    3::244     1e-10  26%  244 aa  FABG_VIBCH RecName: Full=3-oxoacyl-[acyl-carrier-protein]
  136::248     1e-10  34%  251 aa  DCXR_CAEEL RecName: Full=Probable L-xylulose reductase;       
   18::266     2e-10  28%  267 aa  MTDH_CLAHE RecName: Full=Probable NADP-dependent mannitol
   34::284     2e-10  28%  289 aa  GRDH2_ARATH RecName: Full=Glucose and ribitol dehydrogenase homolog
    3::226     2e-10  23%  231 aa  Y2567_STAAR RecName: Full=Uncharacterized oxidoreductase SAR2567;  
   57::242     2e-10  28%  244 aa  FABG_BUCAP RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    5::252     2e-10  27%  256 aa  DHSO_RHOSH RecName: Full=Sorbitol dehydrogenase;       
    9::243     3e-10  25%  246 aa  DER_CHICK RecName: Full=D-erythrulose reductase;       
  102::270     3e-10  32%  292 aa  DECR2_MOUSE RecName: Full=Peroxisomal 2,4-dienoyl-CoA reductase;   
    5::241     3e-10  25%  244 aa  DCXR_MOUSE RecName: Full=L-xylulose reductase;         Short=XR;   
   54::231     3e-10  28%  236 aa  CBR4_XENTR RecName: Full=Carbonyl reductase family member 4;       
    3::226     4e-10  23%  231 aa  Y2478_STAAM RecName: Full=Uncharacterized oxidoreductase SAV2478;  
    3::226     4e-10  23%  231 aa  Y2266_STAAN RecName: Full=Uncharacterized oxidoreductase SA2266;   
   24::280     4e-10  26%  283 aa  T4HR_MAGGR RecName: Full=Tetrahydroxynaphthalene reductase;        
   70::277     4e-10  29%  300 aa  DECR2_DANRE RecName: Full=Peroxisomal 2,4-dienoyl-CoA reductase;   
   11::231     4e-10  29%  236 aa  CBR4_XENLA RecName: Full=Carbonyl reductase family member 4;       
   17::265     6e-10  28%  266 aa  DCXR_TRIRE RecName: Full=L-xylulose reductase;         Short=XR;   
    3::243     7e-10  26%  244 aa  FABG_STAES RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    3::243     7e-10  26%  244 aa  FABG_STAEQ RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    4::187     9e-10  27%  259 aa  YQJQ_BACSU RecName: Full=Uncharacterized oxidoreductase yqjQ;      
   10::246     9e-10  25%  247 aa  YGFF_ECOLI RecName: Full=Uncharacterized oxidoreductase ygfF;      
    5::247     9e-10  29%  251 aa  Y325_THEMA RecName: Full=Uncharacterized oxidoreductase TM_0325;   
    3::226     9e-10  22%  231 aa  Y2778_STAA8 RecName: Full=Uncharacterized oxidoreductase
    3::226     9e-10  22%  231 aa  Y2488_STAAC RecName: Full=Uncharacterized oxidoreductase SACOL2488;
    3::226     9e-10  22%  231 aa  Y2422_STAA3 RecName: Full=Uncharacterized oxidoreductase
    3::226     9e-10  22%  231 aa  Y2403_STAAW RecName: Full=Uncharacterized oxidoreductase MW2403;   
    3::226     9e-10  22%  231 aa  Y2370_STAAS RecName: Full=Uncharacterized oxidoreductase SAS2370;  
  123::286     9e-10  27%  291 aa  GRDH_DAUCA RecName: Full=Glucose and ribitol dehydrogenase;        
   94::302     9e-10  28%  335 aa  DECR_MOUSE RecName: Full=2,4-dienoyl-CoA reductase, mitochondrial; 
   94::302     9e-10  28%  335 aa  DECR_HUMAN RecName: Full=2,4-dienoyl-CoA reductase, mitochondrial; 
    3::245     2e-09  30%  247 aa  FABG_PSEAE RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   94::302     2e-09  28%  335 aa  DECR_RAT RecName: Full=2,4-dienoyl-CoA reductase, mitochondrial;   
  125::295     3e-09  32%  300 aa  GRDH_ORYSJ RecName: Full=Glucose and ribitol dehydrogenase homolog;
   11::231     3e-09  29%  236 aa  CBR4_MOUSE RecName: Full=Carbonyl reductase family member 4;       
   55::232     3e-09  28%  237 aa  CBR4_BOVIN RecName: Full=Carbonyl reductase family member 4;       
    7::248     4e-09  25%  251 aa  YJDA_BACSU RecName: Full=Uncharacterized oxidoreductase yjdA;      
    2::249     4e-09  30%  253 aa  Y4MP_RHISN RecName: Full=Uncharacterized short-chain type
   15::255     4e-09  25%  295 aa  ACR1_ACIBI RecName: Full=Fatty acyl-CoA reductase;       
    3::255     5e-09  25%  258 aa  BDHA_RHIME RecName: Full=D-beta-hydroxybutyrate dehydrogenase;     
   60::250     5e-09  25%  253 aa  BACC_BACSU RecName: Full=Bacilysin biosynthesis oxidoreductase
   60::250     6e-09  23%  250 aa  HCDR_XANP2 RecName: Full=2-(R)-hydroxypropyl-CoM dehydrogenase;    
   23::221     6e-09  25%  303 aa  ACR1_ACIAD RecName: Full=Fatty acyl-CoA reductase;       
   60::271     8e-09  31%  309 aa  YWC4_CAEEL RecName: Full=Uncharacterized oxidoreductase W01C9.4;   
   10::256     8e-09  27%  258 aa  DHRS2_HUMAN RecName: Full=Dehydrogenase/reductase SDR family member
   53::258     1e-08  27%  262 aa  MTDH_AGABI RecName: Full=NADP-dependent mannitol dehydrogenase;    
   58::249     1e-08  30%  249 aa  HCDS_XANP2 RecName: Full=2-(S)-hydroxypropyl-CoM dehydrogenase;    
    3::243     1e-08  28%  246 aa  FABG_THEMA RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    3::241     1e-08  26%  242 aa  YMFI_BACSU RecName: Full=Uncharacterized oxidoreductase ymfI;      
  120::281     1e-08  30%  286 aa  YAY8_SCHPO RecName: Full=Uncharacterized oxidoreductase C4H3.08;   
   55::244     1e-08  25%  246 aa  PHBB_RALEH RecName: Full=Acetoacetyl-CoA reductase;       
    5::194     1e-08  23%  258 aa  DHG2_BACSU RecName: Full=Glucose 1-dehydrogenase 2;       
   49::268     2e-08  28%  270 aa  DHB14_HUMAN RecName: Full=17-beta-hydroxysteroid dehydrogenase 14; 
   65::247     2e-08  23%  249 aa  BAIA1_EUBSP RecName: Full=Bile acid 7-dehydroxylase 1/3;       
   59::250     2e-08  27%  250 aa  LINC_PSEPA RecName: Full=2,5-dichloro-2,5-cyclohexadiene-1,4-diol
   10::49      2e-08  55%   55 aa  FABI_RHIME RecName: Full=Enoyl-[acyl-carrier-protein] reductase
   62::222     2e-08  31%  236 aa  FABG_SCHPO RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    2::243     2e-08  29%  245 aa  BDH2_MOUSE RecName: Full=3-hydroxybutyrate dehydrogenase type 2;   
    7::258     3e-08  24%  260 aa  TRN2_HYONI RecName: Full=Tropinone reductase 2;       
   59::237     3e-08  30%  241 aa  FABG_RICBR RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   15::266     4e-08  23%  268 aa  TRNH_DATST RecName: Full=Tropinone reductase homolog;       
   21::255     4e-08  25%  260 aa  DHRS4_BOVIN RecName: Full=Dehydrogenase/reductase SDR family member
   65::247     4e-08  26%  249 aa  BAIA2_EUBSP RecName: Full=Bile acid 7-dehydroxylase 2;       
   42::276     5e-08  26%  313 aa  YXEK_CAEEL RecName: Full=Uncharacterized oxidoreductase F53C11.3;  
   60::271     5e-08  26%  309 aa  YVX3_CAEEL RecName: Full=Uncharacterized oxidoreductase T05C12.3;  
   12::291     7e-08  25%  303 aa  PECR_PONAB RecName: Full=Peroxisomal trans-2-enoyl-CoA reductase;  
    4::241     7e-08  27%  245 aa  NODG_RHIS3 RecName: Full=Nodulation protein G;
    5::241     9e-08  22%  244 aa  DCXR_CAVPO RecName: Full=L-xylulose reductase;         Short=XR;   
   60::251     9e-08  25%  254 aa  BACC_BACAM RecName: Full=Bacilysin biosynthesis oxidoreductase
   12::276     1e-07  23%  303 aa  PECR_HUMAN RecName: Full=Peroxisomal trans-2-enoyl-CoA reductase;  
    2::237     1e-07  26%  260 aa  HSD_MYCTU RecName: Full=3-alpha-(or 20-beta)-hydroxysteroid
    2::237     1e-07  26%  260 aa  HSD_MYCBO RecName: Full=3-alpha-(or 20-beta)-hydroxysteroid
   44::243     2e-07  30%  245 aa  BDH2_BOVIN RecName: Full=3-hydroxybutyrate dehydrogenase type 2;   
   79::264     2e-07  24%  303 aa  PECR_RAT RecName: Full=Peroxisomal trans-2-enoyl-CoA reductase;    
   12::255     2e-07  26%  260 aa  DHRS4_RAT RecName: Full=Dehydrogenase/reductase SDR family member
   11::231     2e-07  26%  236 aa  CBR4_RAT RecName: Full=Carbonyl reductase family member 4;       
   74::249     3e-07  25%  278 aa  Y4LA_RHISN RecName: Full=Uncharacterized short-chain type
   55::291     3e-07  24%  303 aa  PECR_MOUSE RecName: Full=Peroxisomal trans-2-enoyl-CoA reductase;  
   64::243     3e-07  26%  247 aa  FABG1_SYNY3 RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   58::243     3e-07  31%  245 aa  BDH2_HUMAN RecName: Full=3-hydroxybutyrate dehydrogenase type 2;   
   46::237     3e-07  28%  258 aa  YLX6_SCHPO RecName: Full=Uncharacterized oxidoreductase C922.06;   
    7::253     3e-07  23%  260 aa  TRN2_DATST RecName: Full=Tropinone reductase 2;       
   63::251     4e-07  26%  267 aa  HDHA_CLOSO RecName: Full=NADP-dependent 7-alpha-hydroxysteroid
    7::254     6e-07  24%  257 aa  YXJF_BACSU RecName: Full=Uncharacterized oxidoreductase yxjF;      
   79::275     6e-07  24%  302 aa  PECR_CAVPO RecName: Full=Peroxisomal trans-2-enoyl-CoA reductase;  
   72::262     6e-07  24%  267 aa  LVR_LEIAQ RecName: Full=Levodione reductase;       
   21::199     6e-07  26%  260 aa  DHRS4_PIG RecName: Full=Dehydrogenase/reductase SDR family member
   22::257     6e-07  25%  261 aa  ACT3_STRCO RecName: Full=Putative ketoacyl reductase;       
   63::211     7e-07  28%  266 aa  PGDH_BOVIN RecName: Full=15-hydroxyprostaglandin dehydrogenase
   62::245     7e-07  24%  246 aa  FABG_STAAW RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   62::245     7e-07  24%  246 aa  FABG_STAAS RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   62::245     7e-07  24%  246 aa  FABG_STAAR RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   62::245     7e-07  24%  246 aa  FABG_STAAN RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   62::245     7e-07  24%  246 aa  FABG_STAAM RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   62::245     7e-07  24%  246 aa  FABG_STAAC RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   86::317     1e-06  26%  320 aa  FABG_CUPLA RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    1::243     1e-06  24%  246 aa  FABG_BACSU RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   55::236     1e-06  27%  237 aa  CBR4_HUMAN RecName: Full=Carbonyl reductase family member 4;       
   61::247     1e-06  32%  250 aa  CPNA_COMTE RecName: Full=Cyclopentanol dehydrogenase;       
   61::247     1e-06  32%  250 aa  CPNA_COMS9 RecName: Full=Cyclopentanol dehydrogenase;       
   74::249     2e-06  27%  281 aa  Y2146_BRAJA RecName: Full=Probable short-chain type
   31::279     2e-06  26%  285 aa  Y048_HAEIN RecName: Full=Uncharacterized oxidoreductase HI0048;    
  165::246     2e-06  36%  254 aa  FADH_BACSU RecName: Full=Probable 2,4-dienoyl-CoA reductase;       
   21::255     2e-06  23%  260 aa  DHRS4_MOUSE RecName: Full=Dehydrogenase/reductase SDR family member
   82::254     2e-06  27%  266 aa  TRNH1_ARATH RecName: Full=Tropinone reductase homolog At1g07440;   
    5::211     2e-06  25%  265 aa  PGDH_CAVPO RecName: Full=15-hydroxyprostaglandin dehydrogenase
   19::269     3e-06  21%  271 aa  SDR1_PICAB RecName: Full=Short-chain type dehydrogenase/reductase; 
   44::273     3e-06  25%  277 aa  LIMC_RHOER RecName: Full=(-)-trans-carveol dehydrogenase;       
   47::226     3e-06  28%  309 aa  DRS7B_XENTR RecName: Full=Dehydrogenase/reductase SDR family member
   12::226     3e-06  24%  260 aa  DHRS4_PONAB RecName: Full=Dehydrogenase/reductase SDR family member
   12::226     3e-06  24%  260 aa  DHRS4_HUMAN RecName: Full=Dehydrogenase/reductase SDR family member
   19::271     4e-06  22%  273 aa  TRN1_DATST RecName: Full=Tropinone reductase 1;       
   80::284     4e-06  30%  289 aa  PTR1_LEITA RecName: Full=Pteridine reductase 1;       
  478::682     6e-06  30%  689 aa  YUXG_BACSU RecName: Full=Uncharacterized oxidoreductase yuxG;      
    5::211     6e-06  26%  269 aa  PGDH_MOUSE RecName: Full=15-hydroxyprostaglandin dehydrogenase
   63::211     6e-06  25%  266 aa  PGDH_MACFA RecName: Full=15-hydroxyprostaglandin dehydrogenase
   63::211     6e-06  25%  266 aa  PGDH_HUMAN RecName: Full=15-hydroxyprostaglandin dehydrogenase
   27::189     6e-06  25%  270 aa  DHB14_BOVIN RecName: Full=17-beta-hydroxysteroid dehydrogenase 14; 
    7::255     8e-06  22%  256 aa  RHLG_PSEAE RecName: Full=Rhamnolipids biosynthesis
   59::283     8e-06  29%  288 aa  PTR1_LEIMA RecName: Full=Pteridine reductase 1;       
   41::241     8e-06  24%  245 aa  NODG_RHIME RecName: Full=Nodulation protein G;AltName:
   12::195     1e-05  27%  249 aa  RIDH_KLEAE RecName: Full=Ribitol 2-dehydrogenase;       
    8::272     2e-05  26%  278 aa  UXUB_BACSU RecName: Full=Uncharacterized oxidoreductase uxuB;      
   23::252     2e-05  30%  255 aa  SOU1_SCHPO RecName: Full=Sorbose reductase sou1;       
   59::263     2e-05  25%  267 aa  SORD_KLEPN RecName: Full=Sorbitol-6-phosphate 2-dehydrogenase;     
   37::219     2e-05  25%  230 aa  DR4L2_HUMAN RecName: Full=Dehydrogenase/reductase SDR family member
  159::249     2e-05  34%  249 aa  DHK2_STRVN RecName: Full=Granaticin polyketide synthase putative
   22::251     3e-05  26%  260 aa  DHR11_HUMAN RecName: Full=Dehydrogenase/reductase SDR family member
   41::192     4e-05  21%  263 aa  YIV6_YEAST RecName: Full=Uncharacterized oxidoreductase YIR036C;   
  138::257     4e-05  27%  262 aa  VIBA_VIBCH RecName: Full=Vibriobactin-specific
  177::274     4e-05  35%  285 aa  ABA2_ARATH RecName: Full=Xanthoxin dehydrogenase;       
    5::258     5e-05  24%  264 aa  YVAG_BACSU RecName: Full=Uncharacterized oxidoreductase yvaG;      
    5::246     5e-05  22%  250 aa  LINX_PSEPA RecName: Full=2,5-dichloro-2,5-cyclohexadiene-1,4-diol
  151::237     5e-05  33%  241 aa  FABG_RICFE RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   59::237     5e-05  26%  241 aa  FABG_RICCN RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   10::240     7e-05  31%  240 aa  FABG2_SYNY3 RecName: Full=3-oxoacyl-[acyl-carrier-protein]
  115::242     7e-05  25%  325 aa  DRS7B_BOVIN RecName: Full=Dehydrogenase/reductase SDR family member
    3::237     9e-05  23%  242 aa  PHAB_PARDE RecName: Full=Acetoacetyl-CoA reductase;       
   99::214     9e-05  25%  334 aa  KDSR_DICDI RecName: Full=3-ketodihydrosphingosine reductase;       
    4::237     9e-05  24%  241 aa  FABG_RICPR RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   65::258     9e-05  24%  259 aa  DHB8_CANFA RecName: Full=Estradiol 17-beta-dehydrogenase 8;        
  103::246     1e-04  24%  248 aa  PHAB_ACISR RecName: Full=Acetoacetyl-CoA reductase;       
   22::251     1e-04  26%  260 aa  DHR11_MOUSE RecName: Full=Dehydrogenase/reductase SDR family member
    7::246     2e-04  21%  269 aa  XYLL_PSEPU RecName:
   62::254     2e-04  26%  256 aa  PTMA_CAMCO RecName: Full=Post-translational flagellin modification
  248::335     2e-04  39%  342 aa  YR419_MIMIV RecName: Full=Uncharacterized short-chain type
   10::246     2e-04  25%  255 aa  Y3106_PSEAE RecName: Full=Uncharacterized oxidoreductase PA3106;   
   99::237     2e-04  27%  241 aa  FABG_RICTY RecName: Full=3-oxoacyl-[acyl-carrier-protein]
  178::257     3e-04  34%  271 aa  DHMA_FLAS1 RecName: Full=N-acylmannosamine 1-dehydrogenase;        
   22::145     3e-04  24%  236 aa  YI78_SCHPO RecName: Full=Uncharacterized oxidoreductase
   17::246     3e-04  27%  255 aa  DHR11_BOVIN RecName: Full=Dehydrogenase/reductase SDR family member
    1::186     5e-04  22%  248 aa  Y432_LISMO RecName: Full=Uncharacterized oxidoreductase Lmo0432;   
   25::237     5e-04  23%  241 aa  PHBB_ZOORA RecName: Full=Acetoacetyl-CoA reductase;       
  123::243     5e-04  27%  248 aa  ENTA_ECOLI RecName: Full=2,3-dihydro-2,3-dihydroxybenzoate
  185::273     6e-04  25%  406 aa  DHI2_RABIT RecName: Full=Corticosteroid 11-beta-dehydrogenase
  130::237     8e-04  30%  317 aa  H17B6_BOVIN RecName: Full=Hydroxysteroid 17-beta dehydrogenase 6;  
   65::249     8e-04  23%  261 aa  DHG2_BACME RecName: Full=Glucose 1-dehydrogenase 2;       
  107::255     8e-04  23%  259 aa  CMTB_PSEPU RecName: Full=2,3-dihydroxy-2,3-dihydro-p-cumate
  107::255     8e-04  23%  259 aa  CMTB_PSEP1 RecName: Full=2,3-dihydroxy-2,3-dihydro-p-cumate
    1::272

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MAQASGLMAGKRGLIMGVANNRSIAWGIAKACADAGAELALTWQGDALKKRVEPLAQELGAFMAGHCDVT
FABI1_RHIME     MAQASGLMNGKRGVIMGVANNRSIXXXXXXXXXXXXXXXXXTWQGDALKKRVEPLAQELGAFMAGHCDVT
FABI2_RHIME     ----NGLMNGKRGLIMGVANSHSIAWGIAKSLAAQGAELAFTYQGEALGKRVKPLAAEVNSDFLLPCDVE
FABI_RICBR      ----TGLLQGKRGIITGIANNMSISWAIAQLARKHGAELCFTYQSEILEKRVKPLAEEVGCNFVSELDVT
FABI_RICTY      ------LLQGKKGLITGIANNMSISWAIAQLAKKHGAELWFTYQSEALEKRVKPLAEEIGCNFISELDVT
FABI_HELPJ      -----GFLKGKKGLIVGVANNKSIAYGIAQSCFNQGATLAFTYLNESLEKRVRPIAQELNSPYVYELDVS
FABI_RICPR      ----TGLLQGKKGLITGIANNMSISWAIAQLAKKHGAELWFTYQSEVLEKRVKPLAEEIGCNFISELDVT
FABI_RICFE      ----TGLLQGKKGLITGIANNMSISWAIAQLAKKHGAELWFTYQSEVLEKRVKPLAEEIGCNFVSELDVT
FABI_RICCN      ----TGLLQGKKGLITGIANNMSISWAIAQLAKKHGAELWFTYQSGVLEKRVKPLAKEIGCNFVSELDVT
FABI_HELPY      -----GFLKGKKGLIVGVANNKSIAYGIAQSCFNQGATLAFTYLNESLEKRVRPIAQELNSPYVYELDVS
FABI_BACSU      -------LEGRNIVVMGVANKRSIAWGIARSLHEAGARLIFTYAGERLEKSVHELAGTLDRSIILPCDVT
FABI_SYNY3      -------LSGKHAFVTGIANNRSIAWGIAQQLHQAGAEIGVSYLPDEFEKKVRELTEPLHPTLVLPGDVQ
FABI_AQUAE      -----GLLEGKRALITGVANERSIAYGIAKSFHREGAQLAFTYATPKLEKRVREIAKGFGSDLVVKCDVS
FABI_SHIFL      -----GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVA
FABI_ECOLI      -----GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVA
FABI_ECO57      -----GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVA
FABI_SALTY      -----GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSSIVLPCDVA
FABI_HAEIN      -----GFLTGKRILVTGLASNRSIAYGIAKSMKEQGAELAFTYLNDKLQPRVEEFAKEFGSDIVLPLDVA
FABI_NEIMB      -----GFLQGKKILITGMISERSIAYGIAKACREQGAELAFTYVVDKLEERVRKMAAELDSELVFRCDVA
FABI_ANASP      -------LTGKNALVTGIANNRSIAWGIAQQLHAAGANLGITYLPDEFEKKVSELVEPLNPSLFLPCNVQ
FABI_PSEAE      -----GFLTGKRALIVGVASKLSIASGIAAAMHREGAELAFTYQNDKLRGRVEEFASGWGSRLCFPCDVA
FABI_BUCBP      -----GFLEEKKILVTGISNKYSIAFGIAKALHKQNATLAFSYHTDRLKNKVYELAKELGVKIVIPCDVS
FABI_BUCAI      -----GFLKGKKFLIIGISSVRSIAFGIAKSLYNQKAELGFVCQNEKIRKKIKKLVEPMKSCIVLCCDVS
FABI_BUCAP      -------------------NEKSIAFGIAKSMYKQEAELIFVCQXXXXXXXXXXXXXXXXXXTIFFCDVS
FABI_BRANA      -------LRGKRAFIAGIADDNGYGWAVAKSLAAAGAEILVTWRGKFDQSRVLPKVYPLDAVFDNPEDVP
INHA_MYCS2      ----TGLLEGKRILVTGIITDSSIAFHIAKVAQEAGAELVLTGF-DRLKKRIADRLPKPAPLL--ELDVQ
INHA_MYCTU      ----TGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLT--GFDRLRLIQRITDRLPAKAPLELDVQ
INHA_MYCBO      ----TGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLT--GFDRLRLIQRITDRLPAKAPLELDVQ
INHA_MYCAV      ----AGLLDGKRILVTGIITDSSIAFHIAKVAQEAGAQLVLTFDRLRLIQRIVDRLPEKAPLI--ELDVQ
UCPA_SALTY      -----GKLTGKTALITGAS--QGIGEGIARVFARHGANLILLDISDEIEKLADELGGRGHRCTAVKADVR
UCPA_SALTI      -----GKLTGKTALITGAS--QGIGEGIARVFARHGANLILLDISDEIEKLADELGGRGHRCTAVKADVR
FABL_BACSU      ----------------------------------------------------------------------
UCPA_ECO57      -----GKLTGKTALITGAL--QGIGEGIARTFARHGANLILLDISPEIEKLADELCGRGHRCTAVVADVR
UCPA_ECOLI      -----GKLTGKTALITGAL--QGIGEGIARTFARHGANLILLDISPEIEKLADELCGRGHRCTAVVADVR
HDHA_ECOLI      --------------------------------ATAGASVVVSINADAANHVVDEIQQLGGQAFACRCDIT
HDHA_ECO57      --------------------------------ATAGASVVVSINADAANHVVDEIQQLGGQAFACRCDIT
SOU1_CANAL      -------LKGKVASVTG--SSGGIGWAVAEAFAQAGADVAIWYNSKPADAKAEYLTEKYGVAKAYKCNVT
YKVO_BACSU      -----GKFEGKIALVTGGTSGIGLA--TAQKFVNEGAYVYITGRR---QNELDKAVNQIGKNVTGQGDIS
YHDF_BACSU      --RGSGKLKGKVAIITG--GDSGIGRAAAIAFAKEGADISILYDAEETRKRIEKIPGDVGD--ENHCEQA
FABG_CHLTR      ----SGLLVNKTAIVTG--GSRGIGFSIAKLFAEQGANVQI-WNGEAGQAAAQTLSEQTGRQVSALVDVS
FABG_CHLMU      ----NSLLVNKAAIVTG--GSRGIGFGIAKLFAEHGANVQI-WNEEAGKSAAQDLSDKTGSKVS--FALV
SPS19_YEAST     -------------------------------------------------KGISQLAKDKDAVLAANVDVR
YGHA_ECOLI      ----------------------------------------------------------------------
YGHA_ECO57      ----------------------------------------------------------------------
MTDH_UROFA      --------------IIVTGGNRGIGLAMSQACADAGAAVGIIYNSDA-EDRASEISKKYGVCKAYQCDVG
DCXR_BOVIN      -------LAGRRALVTGAG--KGIGRSIVKALHAAGARVVAVSRTQA---DLDSLVRECPGVETVCVDLA
CBR2_PIG        --------SGLRALVTGAG--KGIGRDTVKALHVSGARVVAVTRGDLVS-----LSQECPGIEPVCVDLG
VER1_ASPPA      ---------------------------------ERGAKVVVNYSREAAEKVVEQIKANGTDAIAIQADVG
THR1_GLOLA      ---ASASLMGKVALVTGAG--RGIGREMAMELGRRGAKVIVNYANSATAEEVVQAIKKSGSDAASKANVS
FABG_SHIFL      ---------GKIALVTGAS--RGIGRAIAETLAARGAKVIGTATSE---NGAQAISDYLGANGKGMLNVT
FABG_ECOLI      ---------GKIALVTGAS--RGIGRAIAETLAARGAKVIGTATSE---NGAQAISDYLGANGKGMLNVT
STCU_EMENI      -----------------------------------GAKVVVNYANEAAEKVVDEIKSNGSDAISIQADVG
YHXC_BACSU      -------LEGKTAIITG--GDSGIGRAVSVLFAKEGANVVIVYDAEETKQYVEKEGVKC-LLIAG--DVG
FABG_VIBHA      -------LEGKIALVTGAS--RGIGRAIAELLVERGATVIGTATSEGGAAAISEYLGENGKGLA--LNVT
YJGI_ECOLI      -----GAFTGKTVLILG--GSRGIGAAIVRRFVTDGANVRFTYAGS--KDAAKRLAQETGATAV----FT
YXBG_BACSU      ---------------------------------------------DQMEETVDAIRKNGGQAESFHLDVS
YQC8_SCHPO      -------LKGKNCVVFGAA--KGIGFSIATAFAQAGGNVIITYLTTDPTEKAKKLAEETGVQV--HTLKI
HSD_STREX       -------------------------------------------------------ARELGAARYQHLDVT
CBR2_MOUSE      --------SGLRALVTGAG--KGIGRDTVKALHASGAKVVAVTRTNS---DLVSLAKECPGIEPVCVDLG
YVRD_BACSU      ----------KEKLVLITGSTSGIGKAAAKSFLQEGAAVIVNGRK---QETVDRTIEELSGYGTVHGAAA
GNO_GLUOX       -------LSGARALVTGAS--RGIGLTLAKGLARYGAEVVLNGRNDSAQSGFE--AEGLKASTAVF-DVT
DECR2_RAT       --------------------------------------------------RVSEAAKKLVAATGKRCLPL
DECR2_HUMAN     ----------------------------------------------------------------------
BACC2_BACSU     -----------------------------------------------------------------HTDIT
Y4VI_RHISN      ------------------------------------------------------LGQNLGEPHLGEVDVS
FABG_MYCTU      --------------VLVTGGNRGIGLAIAQRLAADGHKVAVTHRGSGAPK----------GLFGVECDVT
FABG_MYCS2      --------------VLVTGGNRGIGLAIARRLAADGHKVAVTHRGSGAPDDL----------FGVQCDVT
FABG_MYCBO      --------------VLVTGGNRGIGLAIAQRLAADGHKVAVTHRGSGAPK----------GLFGVECDVT
FABG_BUCAI      --------------------------------------------------------------------VL
FABG_BUCBP      -------------------------------------------------------------------DIT
DECR2_PONAB     ----------------------------------------------------------------------
ARDH_PICST      ------IITGGSGGLAAVISRALLAQGADVALIDSAAKEVLGWGEETLKGEH---ASAIGQVSAWSCNIG
ARDH_CANAL      ------ILTGGSGGLAAVVSRALLAKGADVALVDMNLERTLQWGEEQMKGKYE---SPIGQVSAWSCNIG
SOU2_CANAL      -------LKGKVASVTG--SSGGIGWAVAEGYAQAGADVAIWYNSHPADDKAEYLTKTYGVKSKAYCNVT
FIXR_BRAJA      ----------------------------------------------------------------------
YHXD_BACSU      ----------------------------------------------------------------------
Y1385_MYCBO     ------------------------------------AEGARVVLGDVNLEATEVAAKRLGGALAVRCDVT
Y1350_MYCTU     ------------------------------------AEGARVVLGDVNLEATEVAAKRLGGALAVRCDVT
CBR4_DANRE      --------------------SRGIGRAASKLLAQRGHRIVLLSRN---KEAAQSTAQSLPGHLGLSCDVS
DHRS4_RABIT     ------------------ASTDGIGLAIARRLAQDGAHVVISSRKQQNVDRAVAALQAEGLSVTGTCHVG
DCXR_HUMAN      -------LAGRRVLVTGAG--KGIGRGTVQALHATGARVVAVSRTQA---DLDSLVRECPGIEPVCVDLG
GS39_BACSU      -------LKGKVALITG--GDSGIGRAVSVAYAKEGADIAIVYKAEETKKRVEQEGVKC-LLIAG--DVG
FABG_SALTY      ---------GKIALVTGAS--RGIGRAIAETLVARGAKVIGTATSENGAKNI---SDYLGANGKGMLNVT
FABG_SALTI      ---------GKIALVTGAS--RGIGRAIAETLVARGAKVIGTATSENGAKNI---SDYLGANGKGMLNVT
KDUD_BACSU      -------LKGKTALVTGPGTG--IGQGIAKALAGAGADIIGTSHTSSLSETQQLVEQEGRIFTSFTLDMS
GRDH1_ARATH     --QPSNKLRGKVALITG--GDSGIGRAVGYCFASEGATVAFTYVKGQEEKDAQETLQMLKEVKTSDSKET
FABG_AQUAE      -------LQGKVSLVTG--STRGIGRAIAEKLASAGSTVIITGSGERAKAVAEEIANKYGVKAHGEMNLL
YOHF_ECOLI      --------------------------GIGKECAQQGFDIGITWHSD------EEGAKDTAREVVSHLDLG
NODG_AZOBR      ----------------------------------------------------EPAAAWLGQFYVAEGDVS
DCXR_RAT        -------------------------------------------------------------------DLA
Y182_METEA      ----------------------------------------------------------------------
FABG_MYCAV      --------------VLVTGGNRGIGLAIAQRLAAEAHKVAVTHRGSGAPD----------GLFGVECDVT
FABG_HAEIN      -------MQGKIALVTG--STRGIGRAIAEELSSKGAFVIGTATSE---KGAEAISAYLGDKGKGLVNVT
FABG_CHLPN      -------LVGKKVIVTG--GSRGIGLGIVKLFLENGADVEI-WRGQAV---IESLTGLGGEVSFARVDVS
ARDH_CANTR      ------IITGGSGGLSAVVSRALLAKGADIALIDMNLERTLQWGEEQMKGKHE---SPIGQVSAWSCNIG
Y2049_STAEQ     -----------------------IGEAIAKKLSQQGASIVLVGRNE---QRLNEIAQQLNTAKVVSADVT
Y2036_STAES     -----------------------IGEAIAKKLSQQGASIVLVGRNE---QRLNEIAQQLNTAKVVSADVT
MTDH_ALTAL      -------LKGKVVIVTGASGPTGIGTEAARGCAEYGADLAITYRAEGAEKNAKEMSEKYGVKVKAYCQVN
DCXR_MESAU      -------LAGRRALVTGAGKGIGRSTVLALQAAGAHVVAVSRTQAD-----LDSLVSECPGVETVCVDLA
FABG_VIBCH      -------LEGKVALVTGAS--RGIGKAIAELLAERGAKVIGTATSESGAQAISDYLGDNGKGMA--LNVT
DCXR_CAEEL      ----------------------------------------------------------------------
MTDH_CLAHE      -------LKGKVVVVTGASGPKGMGIEAARGCAEMGAAVAITYASRAAEENVKELEKTYGIKAKAYCQVD
GRDH2_ARATH     ----SNKLHGKVALVTG--GDSGIGKAVCHCYALEGASVAFTYVKGREDKDAEETLRLLHEVKTREAKAT
Y2567_STAAR     ------VLTDKIAVVTGAGSG--IGEAIATLLHEEGAKVVLAGRNDKLQNVANQLAQD--SVKVVPTDVT
FABG_BUCAP      --------------------------------------------------------------------IL
DHSO_RHOSH      ---------GKTALITGSA--RGIGRAFAEAYVREGARVAIA--DINLEAARXXXXXXXXXXXXXXLDVT
DER_CHICK       ---------GRRALVTGAG--KGIGRAVAVALCKAGARVTALSRTAA---DLESLVRECPGIEPLCLDLA
DECR2_MOUSE     ----------------------------------------------------------------------
DCXR_MOUSE      -------LAGRRALVTGAG--KGIGRSTVLALKAAGAQVVAV---SRTREDLDDLVRECPGVEPVCVDLA
CBR4_XENTR      ------------------------------------------------------------------CDVS
Y2478_STAAM     ------VLTDKIAVVTGAGSG--IGEAIATLLHEEGAKVVLAGRNDKLQNVANQLAQD--SVKVVPTDVT
Y2266_STAAN     ------VLTDKIAVVTGAGSG--IGEAIATLLHEEGAKVVLAGRNDKLQNVANQLAQD--SVKVVPTDVT
T4HR_MAGGR      ----SASLEGKVALVTGAG--RGIGREMAMELGRRGCKVIVNYANESAEEVVAAIKKNGSDAACVKANVG
DECR2_DANRE     -------------------------------------------------EKISQAAKKLTSTTGRRCDVR
CBR4_XENLA      --------------------SRGIGKAVAKLLAQKDYKVAVISRNLEV---AQAAVTEIGAHLALSCDVS
DCXR_TRIRE      -------LKGKVVVVTGASGPRGMGIEAARGCAEMGADLAITY--SSRKEGAEKNAEELXXXXXXXXNQS
FABG_STAES      ----------KSALVTGAS--RGIGRSIALQLAEEGYNVAVNYAGS--KDKAEAVVEEIKASFAIQANVA
FABG_STAEQ      ----------KSALVTGAS--RGIGRSIALQLAEEGYNVAVNYAGS--KDKAEAVVEEIKASFAIQANVA
YQJQ_BACSU      -------IAGKRIWITGASGG--LGERIAYLCAAEGAHVLLSARRE---DRLIEIKRKITEEWSGQCEIF
YGFF_ECOLI      --------------------SRGIGRATALLLAQEGYTVAVNYQQNAAQEVMNLITQAGGKAFVLQADIS
Y325_THEMA      ---------GKVVLITGAGSG--IGKKAAVMFAERGAKVAINDISEEKGKETVELIKSMGAFIFG--DVA
Y2778_STAA8     ------VLTDKVAVVTGAGSG--IGEAIATLLHEEGAKVVLAGRN---KEKLQNVANQLSSVKVVPTDVT
Y2488_STAAC     ------VLTDKVAVVTGAGSG--IGEAIATLLHEEGAKVVLAGRN---KEKLQNVANQLSSVKVVPTDVT
Y2422_STAA3     ------VLTDKVAVVTGAGSG--IGEAIATLLHEEGAKVVLAGRN---KEKLQNVANQLSSVKVVPTDVT
Y2403_STAAW     ------VLTDKIAVVTGAGSG--IGEAIATLLHEEGAKVVLAGRN---KEKLQNVANQLSSVKVVPTDVT
Y2370_STAAS     ------VLTDKIAVVTGAGSG--IGEAIATLLHEEGAKVVLAGRN---KEKLQNVANQLSSVKVVPTDVT
GRDH_DAUCA      ----------------------------------------------------------------------
DECR_MOUSE      ---------------------------------------------DVLKATAEEISSKTGNKVAIRCDVR
DECR_HUMAN      ---------------------------------------------DVLKATAEQISSQTGNKVAIQCDVR
FABG_PSEAE      -------LQGKVALVTGAS--RGIGQAIALELGRLGAVVIGTATSASGAEKIAETLKANGVEGAGLVDVS
DECR_RAT        ---------------------------------------------DVLKATAEEITSKTGKVYAIRCDVR
GRDH_ORYSJ      ----------------------------------------------------------------------
CBR4_MOUSE      --------------------SRGIGRAVAQLMAQKGYRLAIVSRNLEVAKVT---AGELGGHLAFRCDVA
CBR4_BOVIN      ------------------------------------------------------------------CDVA
YJDA_BACSU      ----------KIALITGASSQGDIGTAICRKLASQGIHIFFTWNSDTAW--IEEFQQEI-LRMGVRCDLS
Y4MP_RHISN      ------LLKGKTAVISGAASKRGIGRATAELFASHGARVALDINADEAKAAAGDLPPEHGAHIGLRCDVA
ACR1_ACIBI      ---------GKVALITGASSG--IGLTIAKRIAAAGAHVLLVARTQETLEEVKAIEQQGGQASIFPCDLT
BDHA_RHIME      ----------KTAVITGSTSGIGLA--IARTLAKAGANIVLNGFGDEIRTVTDEVAGLSSGTVLHHADMT
BACC_BACSU      -------------------------------------------------------------------DIT
HCDR_XANP2      -------------------------------------------------------------------DVA
ACR1_ACIAD      ---------GKVALITGASSG--IGLTIAKRIAAAGAHVLLVARTQETLEEVKAIEQQGGQASIFPCDLT
YWC4_CAEEL      -------------------------------------------------EKLEQTARDITKITGGTCDIK
DHRS2_HUMAN     -----GVLANRVAVVTG--STSGIGFAIARRLARDGAHVVISSRKQQNVDRAMAKLQGEGLSVAGICHVG
MTDH_AGABI      ----------------------------------------------------EKVGKEFGVTKAYQCDVS
HCDS_XANP2      -------------------------------------------------------------------DVT
FABG_THEMA      -------LEGKVCLITGAAS------GIGKATTLLFAEGATVIAGDISKENLDSLVKEAEG-LPGKVDVT
YMFI_BACSU      ----------KTALITGASGG--IGKSISETLAARGYNLLLHYNTNAAAELAEKLSQMFGVNAEIQADLS
YAY8_SCHPO      ----------------------------------------------------------------------
PHBB_RALEH      -------------------------------------------------------------FIASEGNVA
DHG2_BACSU      -------LTGKTAIVTG--SSKGIGKAIAERFGKEKMNVVVNYHSDGADETLEIIKQNGGKAVSVEADVS
DHB14_HUMAN     ------------------------------------------------------LEQELPGAVFILCDVT
BAIA1_EUBSP     -------------------------------------------------------------------DLT
LINC_PSEPA      ------------------------------------------------------------------CDIA
FABI_RHIME      ------LLQGRKGLIVGIANDRSIAWGRARAFRALGAEIAVTYLND------------------------
FABG_SCHPO      ---------------------------------------------------------------------S
BDH2_MOUSE      -----GRLDGK--VIVLTAAAQGIGRASALAFAREGAKVIAT---DINESKLQELESYRG-IQTRVLDVT
TRN2_HYONI      -------LEGCTALVTG--GSRGIGYGIVEELANLGASVYTCSRNQ--KELDECLTQWRSKGFASVCDLS
FABG_RICBR      ------------------------------------------------------------------CNLT
TRNH_DATST      -------LRGMTALVTG--GTRGIGYAIVEELANFGAEVTCSRSQNDLDECLEKWRRKGFKVSGPVCDVS
DHRS4_BOVIN     ------------------ASTDGIGFAIARRLAQDGAHVVVSSRKQQNVDRAVATLKGEGLSVTGTCHVG
BAIA2_EUBSP     -------------------------------------------------------------------DLT
YXEK_CAEEL      ---------------------------IATTFAHLGASVAIAARRDVLEKTADEIRSSTGGVCEPQMDVK
YVX3_CAEEL      -------------------------------------------------EKLEQTAEEIMKTTGGICDIK
PECR_PONAB      ---APGLLQGQVAIVTGGATG--IGKAIVKELLELGSNVVIA------SRKLERLKSAAGELQANQCNIR
NODG_RHIS3      -------LTGRKALVTGASGG--IGEAIARVLHAQGAIVGL--HGTRVEK-LETLAAELGRVKLFPANLS
DCXR_CAVPO      -------LAGRRALVTGAG--KGIGRSTVLALKAAGAQVVAV---SRTREDLDDLVRECPGVEPVCVDLA
BACC_BACAM      -------------------------------------------------------------------DIT
PECR_HUMAN      ---APGLLQGQVAIVTGGATG--IGKAIVKELLELGSNVVIASRADELQANLPPTKQ--ARVIPIQCNIR
HSD_MYCTU       ----SGRLIGKVALVSGGA--RGMGASHVRAMVAEGAKVVF---GDILDEEGKAVAAELAAARYVHLDVT
HSD_MYCBO       ----SGRLIGKVALVSGGA--RGMGASHVRAMVAEGAKVVF---GDILDEEGKAVAAELAAARYVHLDVT
BDH2_BOVIN      --------------------------------------------------------QELDKYPGIHTDVT
PECR_RAT        ------------------------------------------------------------------CNIR
DHRS4_RAT       -------LANKVALV--TASTDGIGLAIARRLAEDGAHVVISSRKQQNVDRAVATLQGEGLSVTGVCHVG
CBR4_RAT        --------------------SRGIGKAVAQLMAQKGYRLAIVARNLEVAKAT---ASELGGILAFRCNIA
Y4LA_RHISN      ----------------------------------------------------------------------
PECR_MOUSE      ----------------------------------------LTAAVDELRASLPPSSS--AEVSAIQCNIR
FABG1_SYNY3     -------------------------------------------------------------------NVA
BDH2_HUMAN      -------------------------------------------------------------------DVT
YLX6_SCHPO      ------------------------------------------------------------AALALQADVS
TRN2_DATST      -------LEGCTALVTG--GSRGIGYGIVEELASLGASVYTCSRNQKLNDCLTQWRSKGFKVEASVCDLS
HDHA_CLOSO      -------------------------------------------------------------------DAY
YXJF_BACSU      -------------LVTGAAGG--IGFEIAREFAREGASVIVSLRPEACEKAASKLAEEGFDAAAIPYDVT
PECR_CAVPO      ------------------------------------------------------------------CNIR
LVR_LEIAQ       -------------------------------------------------------------------DVS
DHRS4_PIG       ------------------ASTDGIGLAIARRLAQDGAHVVVSSRKQENVDRTVATLQGEGLSVTGTCHVG
ACT3_STRCO      ---------------------------IARRLGKEGLRVFVCARGEEGLRTTLKELREAGVEADGRCDVR
PGDH_BOVIN      ------------------------------------------------------------------CDVA
FABG_STAAW      -------------------------------------------------------------------NVA
FABG_STAAS      -------------------------------------------------------------------NVA
FABG_STAAR      -------------------------------------------------------------------NVA
FABG_STAAN      -------------------------------------------------------------------NVA
FABG_STAAM      -------------------------------------------------------------------NVA
FABG_STAAC      -------------------------------------------------------------------NVA
FABG_CUPLA      --------------------SRGIGKAIALSLGKAGCKVLVNYARSS--KEAEEVSKEIEAFLTFGGDVS
FABG_BACSU      ------MLNDKTAIVTGAS--RGIGRSIALDLAKSGANVVVNYSGNEAKANVDEIKSMGRKAIAVKADVS
CBR4_HUMAN      ------------------------------------------------------------------CDVA
CPNA_COMTE      -----------------------------------------------------------------HLDVT
CPNA_COMS9      -----------------------------------------------------------------HLDVT
Y2146_BRAJA     ----------------------------------------------------------------------
Y048_HAEIN      ---------------------------LAKQLAYTKANIALLLNFEAADKVAKEINQSGGKAKAYKTNVL
FADH_BACSU      ----------------------------------------------------------------------
DHRS4_MOUSE     ------------------ASTDGIGFAIARRLAEDGAHVVVSSRKQQNVDRAVATLQGEGLSVTGICHVG
TRNH1_ARATH     ----------------------------------------------------------------------
PGDH_CAVPO      ---------GKVALVTGAA--QGIGRAFAEGLLHKGAKVALVWNLEAGVKCKAALDEEFEPTLFIQCDVA
SDR1_PICAB      -------LGGRVAIVTGAS--RGIGREIALNMAEKGAKVVIHYSSNSIINNKSPSSGDGVRAIVCKADVA
LIMC_RHOER      ---------------------------------DIGYPLGTADELDQTAKDVENLGRKA---IVIHADVR
DRS7B_XENTR     --------------------------GLGRECAKAGTRLVLCGRSEGLKNLVQELSQMRIKSAQLHFDLS
DHRS4_PONAB     -------LANKVALV--TASTDGIGFAIARRLAQDGAHVVVSSRKQQNVDQAVATLQGEGLSVTGTCHVG
DHRS4_HUMAN     -------LANKVALV--TASTDGIGFAIARRLAQDGAHVVVSSRKQQNVDQAVATLQGEGLSVTGTCHVG
TRN1_DATST      -------LKGTTALVTG--GSKGIGYAIVEELAGLGARVYTCSRNEKELDECLEIWREKGLNVEGSCDLL
PTR1_LEITA      ----------------------------------------------------------------GSVPVT
YUXG_BACSU      -----------------------------------------------------------GRAMAVKMDVT
PGDH_MOUSE      ---------GKVALVTGAAQ------GIGKAFAEAGAKVALVWNLEAGVKCKAALDEQFEPTLFVQCDVA
PGDH_MACFA      ------------------------------------------------------------------CDVA
PGDH_HUMAN      ------------------------------------------------------------------CDVA
DHB14_BOVIN     -----------------------------RAFVESGAQVVICDKDEARGRAVE---RELPGTVFLLCDVT
RHLG_PSEAE      -------LAGRIALVTG--GSRGIGQMIAQGLLEAGARVFICARDAEACADTATRLSAYGDCQAIPADLS
PTR1_LEIMA      ---------------------------------------AITVQADLSNVATAPVS---GA--DGSAPVT
NODG_RHIME      -------------------------------------------------EKLETLATELGRVKLFPANLA
RIDH_KLEAE      -------LSGKVAAITGAASG--IGLECARTLLGAGAKVVLIREGEKLNKLVAELGENAFALQV---DLM
UXUB_BACSU      -------LAGKTAVITG--GSGVLCSAMARELARHGMKVAIAEKGQAVVKEIXXXXXXXXXXXX---DVL
SOU1_SCHPO      -------------------------FSIAKAFAAAGSNVGLLYGRNALEYAAELRDKHGVQAKAYSCPIE
SORD_KLEPN      -------------------------------------------------------------------DIS
DR4L2_HUMAN     ------------------ASTDGIGFAIARRLAQDRAHVVVSSRKQQNVDQAVATLQGEGLSVTGTCHVG
DHK2_STRVN      ----------------------------------------------------------------------
DHR11_HUMAN     --------------------------GIGAAVARALVQQGLKVVGCARTVNIEELAAECGTLIPYRCDLS
YIV6_YEAST      ---------------------------------------------------LQSLQREYGAFVYRVLDIT
VIBA_VIBCH      ----------------------------------------------------------------------
ABA2_ARATH      ----------------------------------------------------------------------
YVAG_BACSU      -------LQGKTALVTG--STSGIGKAIASSLAEEGAAVIING------RREEKVNQTIDELKTQHAEAV
LINX_PSEPA      -------LAGKVALITGGASGLGAAQ--AKRFAEEGAKVVI---GDLNEEMAKGVVAEIGDALFIRLDVT
FABG_RICFE      ----------------------------------------------------------------------
FABG_RICCN      ------------------------------------------------------------------CNLA
FABG2_SYNY3     -------------VIVVTGGNRGIGAAIVKLLQEMGAKVAFT-----------DLATDGGEALGVVANVT
DRS7B_BOVIN     -------------------------------------------------------------------DLA
PHAB_PARDE      ----------KVALVTG--GSRGIGAAISKALKEAGYTVAANYAGNDDAARA--FTEETG-IKTYKWSVA
KDSR_DICDI      ------------------------------------------------------------------CDIT
FABG_RICPR      -------LTGKTSLITGASSG--IGSAIARLLHKLGSKVIISGSNEEKLKSLGNALKD--NYTIEVCNLA
DHB8_CANFA      -----------------------------------------------------------GAHTAFQADVS
PHAB_ACISR      ----------------------------------------------------------------------
DHR11_MOUSE     --------------------------GIGAAVARALVQQGLKVVGCARTVNIEELAAECGTLIPYRCDLS
XYLL_PSEPU      ---------GKVAVITGAA--QGIGRRVAERMAAEGGRLLLVDRSELIHELADELVG-VAEVLTLTADLE
PTMA_CAMCO      -------------------------------------------------------------------DIT
YR419_MIMIV     ----------------------------------------------------------------------
Y3106_PSEAE     ---------GKVALVTGAA--RGIGLGISAWLIAEGWQVVLADNDRERGARVAEALGEHAWFVA--MDVA
FABG_RICTY      ----------------------------------------------------------------------
DHMA_FLAS1      ----------------------------------------------------------------------
YI78_SCHPO      ----------------------------------------------------------------------
DHR11_BOVIN     --------------------------GIGAAVARALVQQGLKVVGCARTVNIEELAAECGTLIPYRCDLS
Y432_LISMO      -------MTIKNKVIIITGASSGIGKATALLLAEKGAKLVLAARREKLEKIVQTIKANSGEAIFAKTDVT
PHBB_ZOORA      ----------------------------------AGYKVAASYAGN--DDAAKPFKAETGIAVY-KWDVS
ENTA_ECOLI      ----------------------------------------------------------------------
DHI2_RABIT      ----------------------------------------------------------------------
H17B6_BOVIN     ----------------------------------------------------------------------
DHG2_BACME      -------------------------------------------------------------------DVT
CMTB_PSEPU      ----------------------------------------------------------------------
CMTB_PSEP1      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DLETIDSVFASLEQHWGKIDFVVHAIAFSDKDELTGRYLDTSRDNFNRTMDISVFSLAAVAKRAEPIMND
FABI1_RHIME     DLATIDAVFSALEEKWGKIDFVVHAIAFSDKDELTGRYLDTSRDNFARTMDISVYSFTAVAARADRVMND
FABI2_RHIME     DIGSVDAVVDAIKERWGKLDFVVHAIGFSDKNELKGLYADTTRDNFSRTMVISCFSFTEIAKRAAELMSE
FABI_RICBR      NPESITNLFAEVKEKWGTFDFLLHGMAFSDRNELKGRYIDTSLGNFNNSLHISCYSLVELAREAEKLMND
FABI_RICTY      DQKSISNLFNDIKEKWNSFDFLLHGMAFANKNELKGRYVDTSLENFYNSLHISCYSLLELSRSAETLMHD
FABI_HELPJ      KEEHFKSLYNNIKQDLGSLDFIVHSVAFAPKEALEGSLLETSKSAFNTAMEISVYSLIELTNTLKPLLNN
FABI_RICPR      NQKSISNLFNDIKEKWNSFDFLLHGMAFANKNELKGRYVETSLENFHNSLHISCYSLLELSRSAETLMHN
FABI_RICFE      NPKSISNLFDDIKEKWGSFDFLLHGMAFADKNELKGRYVDTSLENFHNSLHISCYXXXXXXXXXXXXMHD
FABI_RICCN      KPKSISNLFDDIKEKWGSFDFLLHGMAFADKNELKGRYVDTSLENFHNSLHISCYXXXXXXXXXXXXMHN
FABI_HELPY      KEEHFKSLYNSVKKDLGSLDFIVHSVAFAPKEALEGSLLETSKSAFNTAMEISVYSLIELTNTLKPLLNN
FABI_BACSU      NDAEIETCFASIKEQVGVIHGIAHCIAFANKEELVGEYLNTNRDGFLLAHNISSYSLTAVVKAARPMMTE
FABI_SYNY3      DDAQVDALFHSVKEKWGKLDILIHCLAFADKSGLTGNYTDIPKEAFSQAMEISTYSLGRLARGAKPLMTN
FABI_AQUAE      LDEDIKNLKKFLEENWGSLDIIVHSIAYAPKEEFKGGVIDTSREGFKIAMDISVYSLIALTRELLPLMEG
FABI_SHIFL      EDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNATREGFKIAHDISSYSFVAMAKACRSMLNP
FABI_ECOLI      EDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNATREGFKIAHDISSYSFVAMAKACRSMLNP
FABI_ECO57      EDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNATREGFKIAHDISSYSFVAMAKACRSMLNP
FABI_SALTY      EDASIDAMFAELGNVWPKFDGFVHSIGFAPGDQLDGDYVNATREGFKVAHDISSYSFVAMAKACRTMLNP
FABI_HAEIN      TDESIQNCFAELSKRWDKFDGFIHAIAFAPGDQLDGDYVNAAREGYRIAHDISAYSFVAMAQAARPYLNP
FABI_NEIMB      SDDEINQVFADLGKHWDGLDGLVHSIGFAPKEALSGDFLDSSREAFNTAHEISAYSLPALAKAARPMMRG
FABI_ANASP      NDEQIQSTFDTIRDKWGRLDILIHCLAFANRDDLTGDFSQTSRAGFATALDISTFSLVQLSGAAKPLMTE
FABI_PSEAE      DDSQIEAVFAALGKHWDGLDIIVHSVGFAPGDQLDGDFTATTREGFRIAHDISAYSFIALAKAGREMMKG
FABI_BUCBP      DDNSIKRLFFNISKKWITFDGFIHSIAFAPKNQLSGDYVSSTRLDFSNVLDVSSYSFVGMAKACRSILKK
FABI_BUCAI      NDKNIKKLFIDLGQVWKKFDGLVHAIAYCPKQYFNGDFIDNTREGFNISHEISSYSFIGLVKACRTMLNN
FABI_BUCAP      HDENIKELFFNIKKVWNNFDGLVHSIAYCPKKQMHEDFVESSRKSFNICHEISSYSFLSMARECKNMLNK
FABI_BRANA      DVKTVQEAAECVRQDFGSIDILVHSLA--NGPEVSKPLLETSRKGYLXXXXXXXXXXXXXXXXXXPIMNP
INHA_MYCS2      NEEHLSTLADRITAEIGKIDGVVHSIGFMPQSGMINPFFDAPYEDVSKGIHISAYSYASLAKAVLPIMNP
INHA_MYCTU      NEEHLASLAGRVTEAIGKLDGVVHSIGFMPQTGMINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNP
INHA_MYCBO      NEEHLASLAGRVTEAIGKLDGVVHSIGFMPQTGMINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNP
INHA_MYCAV      NEEHLNTLAQRVTGEIGKLDGVVHSIASSETGMADQPFFDAPYEDVSKGIHIXXXXXXXXXXXXXPIMNP
UCPA_SALTY      DFASVQAAVARAKETEGRIDILVNNAGVCR----LGNFLDMSEEDRDFHIDINIKGVWNVTKAVLPEMKD
UCPA_SALTI      DFASVQAAVARAKETEGRIDILVNNAGVCR----LGNFLDMSEEDRDFHIDINIKGVWNVTKAVLPEMKD
FABL_BACSU      ----IKEMFQQIDETFGRLDVFVNNAASG----VLRPVMELEETHWDWTMNINAKALLFCAQEAAKLMNG
UCPA_ECO57      DPASVAAAIKRAKEKEGRIDILVNNAGVCR----LGSFLDMSDDDRDFHIDINIKGVWNVTKAVLPEMKD
UCPA_ECOLI      DPASVAAAIKRAKEKEGRIDILVNNAGVCR----LGSFLDMSDDDRDFHIDINIKGVWNVTKAVLPEMKD
HDHA_ECOLI      SEQELSALADFAISKLGKVDILVNNAGGGGP-----KPFDMPMADFRRAYELNVFSFFHLSQLVAPEMNG
HDHA_ECO57      SEQELSALADFAISKLGKVDILVNNAGGGGP-----KPFDMPMADFRRAYELNVFSFFHLSQLVAPEMNG
SOU1_CANAL      DPNDVSKVINEIEKDFGTIDFVANAVAWTDGPEIDVQ----GYDQWKKIVDCDLNGVYYCAHTVGQIFKS
YKVO_BACSU      KLEDLDKLYDIIKQEKGKLD-----ILFANAG--IGNFLEITEEQVDRTFDINVKGTIFTVQKALSLFPD
YHDF_BACSU      VQQTVD--------HFGKLDILVNNAAEQHPQD---SILNISTEQLEKTFRTNIFSMFHMTKKALPHLQE
FABG_CHLTR      KNDMVSAQVQNFLAEYNTIDVIVNNAGIT-RDALLMRMSEEEWSSVINTNLGSIYNVCSAVIRPM-IKAR
FABG_CHLMU      DVSKNDMVSAQVQKEYGTIDVVVNNAGIT-RDSLLMRM---SEEEWSSVIDTNLGSIYNVCSAVPMIKAR
SPS19_YEAST     NFEQVENAVKKTVEKFGKIDFVIAGAA----GNFVCDFANLSPNAFKSVVDIDLLGSFNTAKACKELKKS
YGHA_ECOLI      ---------------------------------------DLTSEQFQKTFAINVFALFWLTQEAIPLLPK
YGHA_ECO57      ---------------------------------------DLTSEQFQKTFAINVFALFWLTQEAIPLLPK
MTDH_UROFA      QQHKVKEVFKKINEELGPVTGLIANAGVSVVKEA----LQYNKDDFNKIFDVNVFGVFNCAQAMAQIWTD
DCXR_BOVIN      DWEATEQALGGV----GPVDLLVNAVAFLQP------FLEVTKEAYDMSFSVNVIQVSQIVARGLIARGA
CBR2_PIG        DWEATERALGGV----GPVDLLVNNAAVA----LMQPFLDTTKEVFDRSFNVSVFQVSQIVARSMIERGV
VER1_ASPPA      DPEATAKLMAETVRHFGYLDIVSSNAGIVS----FGHLKDVTPEEFDRVFRVNTRGQFFVAREAYRHMRE
THR1_GLOLA      DVDQIVKMFGEAKQIWGRLDIVCSVVSF-------GHVKDVTPEEFDRVFAINTRGQFFVAREAYKHLEV
FABG_SHIFL      DPASIESVLEKIRAEFGEVDILVNNAGIT-RDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRH
FABG_ECOLI      DPASIESVLEKIRAEFGEVDILVNNAGIT-RDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRH
STCU_EMENI      DPDAVTKLMDQAVEHFGYLDIVSSNAGIVS----FGHVKDVTPDEFDRVFRVNTRGQFFVAREAYRHLRE
YHXC_BACSU      DEAFCNDVVGQASQVFPSIDILVNNAA---EQHVQPSIEKITSHQLIRTFQTNIFSMFYLTKAVLPHLKK
FABG_VIBHA      DVESIEATLKTINDECGAIDILVNNAGIT-RDNLLMRMKDDEWNDIINTNLTPIYRMSKAVKRAGRIINV
YJGI_ECOLI      DSADRDAVIDVVRKS-GALDILVVNAGIG----VFGEALELNADDIDRLFKINIHAPYHASVEAARQMPE
YXBG_BACSU      DENSVKAFADQIKDACGTIDILFNNAGV---DQEGGKVHEYPVDLFDRIIAVDLRGTFLCSKYLIPLMEN
YQC8_SCHPO      DISRSDTVEAGVEEIQ-KIFKEIHVVVANAGMPFRRSVLDSPPHEFEKVMNINTNSVYRVAYYMGKIFKK
HSD_STREX       IEEDWQRVVAYAREEFGSVDGLVNNAGIS-----TGMFLETSVERFRKVVDINLTGVFIGMKTVIPAMKD
CBR2_MOUSE      DWDATEKALGGI----GPVDLLVNNAALV----IMQPFLEVTKEAFDRSFSVNLRSVFQVSQMARDMINR
YVRD_BACSU      DLSKTDEAAAFIEKEIGDIDILVNNLGFFEVKD----FADVTDEEWNQYFEVNVMSAVRTSRHFLPKMKN
GNO_GLUOX       DQDAVIDGVAAIERDMGPIDILINNAGIQRRAPLE----EFSRKDWDDLMSTNVFVGQAVARHMIP--RG
DECR2_RAT       DVRVPPAVMAAVDQEFGKIDILINCAA--------GNFLALSFNAFKTVVDIDTLGTFNVSRVLEKFFRD
DECR2_HUMAN     DVRAPPAVMAAVDQEFGRIDILINCAA--------GNFLALSFNAFKTVMDIDTSGTFNVSRVLEKFFRD
BACC2_BACSU     DEPACQNAIRSAVDKFGGLDVLINNAGI----EIVAPIHEMELSNWNKVLNVNLTGMFLMSKHALKYMSG
Y4VI_RHISN      REDDVVALRALLEKRFSRIEVLVNNAGIGPTMAATA---DTALEDFQRALAINLVGAYSVACETAKLMKP
FABG_MYCTU      DSDAVDRAFTAVEEHQGPVEVLVSNAGLSADAFL----MRMTEEKFEKVINANLTGAFRVAQRASRSMNK
FABG_MYCS2      DSAAVDRAFKEVEEHQGPVEVLV-ANAGISKDAFLMR---MTEERFEEVINTNLTGAFRCAQRASRTMQR
FABG_MYCBO      DSDAVDRAFTAVEEHQGPVEVLVSNAGLSADAFL----MRMTEEKFEKVINANLTGAFRVAQRASRSMNK
FABG_BUCAI      NLKNIDSITEKIQEIYKKIDILINNAGIKE-DNLLVNMKSTEWDDVIKTNLSSVFHLVKSVIRSM-IKKR
FABG_BUCBP      NPNEITKTMDFVYKNFGRVDILINNAGII-RDKLL---INMKTQDWNSVLNVNLNSIFYMSKSVNMIKNK
DECR2_PONAB     DVRAPPAIVAAVDQEFGRIDILINCAA--------GNFLALSFNAFKTVMDIDTSGTFNVSRVLEKFFRD
ARDH_PICST      DAEAVDATFSSINEHHGKIDLLINTAGYCENFP-AETYPATNAESIMKVNGLGSFYVSQSFARPLIQNNL
ARDH_CANAL      DAEAVDLTFKAINEHHGKISSVLVNTAGYAENFPAEEYPAKNAENLMKVNGLGSFYVSQAFARPLIQNNM
SOU2_CANAL      DFQDVEKVVKQIESDFGTIDFVANAVAWTEGPEIDVKGV----DKWNKVVDVDLNSVYYCAHVVGPIFRK
FIXR_BRAJA      --------------------------------------LTTSTDTWMRVFHLNLVAPILLAQGLDELRAA
YHXD_BACSU      ---------------------------------------DLPTEQIYKTFEVNVFSLYWVVKAALPYLPE
Y1385_MYCBO     QADDVDILIRTAVERFGGLDVMVNNAGITR--DATMRTM--TEEQFDQVIAVHLKGTWNGTRLAAAIMRE
Y1350_MYCTU     QADDVDILIRTAVERFGGLDVMVNNAGITR--DATMRTM--TEEQFDQVIAVHLKGTWNGTRLAAAIMRE
CBR4_DANRE      KEEEVQKAFETINKTCGTVGFLVNA-AGINRDALLLR--SKSEDMLSVLHTNLLGSMLTCKAAVRNMLSH
DHRS4_RABIT     KAEDRERLVATALNLHGGIDILVSNAAVNP---FFGKLMDVTEEVWDKILDINVKAMALMTKAVVPEMEK
DCXR_HUMAN      DWEATERALGSV----GPVDXXXXXXXXXXXQP----FLEVTKEAFDRSFEVNVIQVSQIVARGLIARGV
GS39_BACSU      EEEFCNEAVEKTVKELGGLDILVNNAGEQHPKE---SIKDITSEQLHRTFKTNFYSQFYLTKKAIDYLKP
FABG_SALTY      DPASIESVLENIRAEFGEVDILVNNAGIT-RDNLLMRMKDDEWNDIIETNLSSVFRLSKAVMRAM-MKKR
FABG_SALTI      DPASIESVLENIRAEFGEVDILVNNAGIT-RDNLLMRMKDDEWNDIIETNLSSVFRLSKAVMRAM-MKKR
KDUD_BACSU      KPEAIKDSAAELFEN-RQIDILVNNAGIIHREKAE----DFPEENWQHVLNVNLNSLFILTQLAGRHMLK
GRDH1_ARATH     DLENCKRVVDEVVNAFGRIDVLINNAA-EQYESSTIEEIDEPR--LERVFRTNIFSYFFLTRHALKHMKE
FABG_AQUAE      SEESINKAFEEIYNLVDGIDILVNNAGITDKLFLRMSLLDWEKVNLTGTFLVTQNSLRKMIKQRWGRIVN
YOHF_ECOLI      NLPEGALALEKLIQRLGRIDVLVNNAGAMTK----APFLDMAFDEWRKIFTVDVFLCSQIAARQMVKQGQ
NODG_AZOBR      DFESCKAMVAKIEADLGPVDILVNNAGIT-RDKF---FAKMDKAQWDAVIATNLSSLFNVTQQVSPKMAE
DCXR_RAT        DWEATEQALSNV----GPVDLLVNNAAVATLQEVTKEACDTSFNNFRAVVQVSQIVARGMIARGVP----
Y182_METEA      -------------QQFGRLDVLVNVYEFAAIEEVT-------EEHYRRIFDVNVLGVLLATQAASKHLGE
FABG_MYCAV      DNDAVDRAFTEVEEHQGPVEVLVSNAGIS-KDAFLIR---MTEERFTEVINANLTGAFRVTQRAARSMQK
FABG_HAEIN      DKESIETLLEQIKNDFGDIDILVNNAGIT-RDNLLMRMKDEEWFDIMQTNLTSVYHLSKAMLRSM-MKKR
FABG_CHLPN      HNGGVDCVQKFLDKH-NKIDILVNNAGIT-RDNLLMRM---SEDDWQSVISTNLTSLYYTCSSVHMIKAR
ARDH_CANTR      DAEAVELTFKAINEHHGKVASVLINTAGYAENFPAEEYPAKNAENIMKVNGLGSFYVSQAFARPLIQNNM
Y2049_STAEQ     VKSNIDDMLKAVIDHFGHIDIVVNSAGQS----LSSKITDYNVEQWDTMIDVNIKGTLHVLQATLPYLQS
Y2036_STAES     VKSNIDDMLKAVIDHFGHIDIVVNSAGQS----LSSKITDYNVEQWDTMIDVNIKGTLHVLQATLPYLQS
MTDH_ALTAL      EYAQCEKLVQDVIKDFGKVDFIANAGKTADNG-----ILDATVEQWNEVIQTDLFNCARAVGLHFRERKT
DCXR_MESAU      DWEATEQALSSV----GPVDXXXXXXXXXXXQP----FLEVTKEAFDMSFNVNVIQVSQIVARGMIARGA
FABG_VIBCH      NPESIEAVLKAITDEFGGVDILVNNAGIT-RDNLLMRMKEEEWSDIMETNLTSIFRLSKAVKRQGRIINV
DCXR_CAEEL      ----------------------------------------------------------------------
MTDH_CLAHE      SYESCEKLVKDVVADFGQIDFIANAGATADSG-----ILDGSVEAWNHVVQVDLNGTFHCAKAVGHHFKE
GRDH2_ARATH     DLENCKRVVEEVVNSFGRIDVLVNCAA--EQHEVSIEDIDEAR--LERVFRTNIFSQFFLVKYALKHMKE
Y2567_STAAR     KKEEVDELIKMAQQTFGGLDIVINSAG----QMLSSKITDYQVDEWDSMIDVNIKGTLYTAKAALPTMQS
FABG_BUCAP      DLKDTDSILEKMKEICQKIDILINNAGITS-DNLLVYMSNKEWENVIKINLTSVFYMSKSVIRSM-IKKR
DHSO_RHOSH      DQASIDRCVAELLDRWGSIDILVNNAALFDLAPI----VEITRESYDRLFAINVFMMQAVA-RAMIAGGR
DER_CHICK       DWDATEAAVGAA----GPFELLVNNAAVA----MLQPFLQVTREAVERSFDVNVLHVSQIVARQMIAQGL
DECR2_MOUSE     -------------QEFGKINILINCAA--------GNFLALSFNAFKTVVDIDTFNVSSVLYK-KFFRDH
DCXR_MOUSE      DWEATEQALSNV----GPVDXXXXXXXXXXXQEVTKEACDTSFNNLRAVIQVSQIVAKGMIARGVP----
CBR4_XENTR      KENEIQDTFKEITNNLGNVDYLVNSAGIR-RDAL---LLRTRSEDIRSLLSVNLVGTIQTCKLASMIQQQ
Y2478_STAAM     NKEEVDELMKIAQQTFGGLDIVINSAG----QMLSSKITDYQVDEWDSMIDVNIKGTLYTAQAALPTMQS
Y2266_STAAN     NKEEVDELMKIAQQTFGGLDIVINSAG----QMLSSKITDYQVDEWDSMIDVNIKGTLYTAQAALPTMQS
T4HR_MAGGR      VVEDIVRMFEEAVKIFGKLDIVCSVVSF-------GHVKDVTPEEFDRVFTINTRGQFFVAREAYKHLEI
DECR2_DANRE     QPETILAAVDETLKTFGRVDILINNAA--------GNFLSLSFNAFKTVMEIDTMGTFNTSKVIYDFKDH
CBR4_XENLA      KENEIQCTFKEIKNNLGNIDYLVNSAGIS-RDAL---LLRTRSEDIMSLLSINLVGTIQTCKVALKGMXX
DCXR_TRIRE      DYNDVERFVNQVVSDFGKIDFIANAGATANSG-----VVDGSASDWDHVIQVDLSGTAYCAKAVGKKQGH
FABG_STAES      KGDEVKEMIKEVVSQFGSVDVLVNNAGIT-KDNLLMRMKEQEWDD---VIDTNLKGVFNCIQKVTPQMQR
FABG_STAEQ      KGDEVKEMIKEVVSQFGSVDVLVNNAGIT-KDNLLMRMKEQEWDD---VIDTNLKGVFNCIQKVTPQMQR
YQJQ_BACSU      PLDVLEDI-ARVRDQIGSIDVLINNAGFGIFETV----LDSTLDDMKAMFDVNVFGLIACTKAVLPQMQK
YGFF_ECOLI      DENQVVAMFTAIDQHDEPLAALVNGILFT---QCTVENLTAERINRVLSTNVTGYFLCAVKRMALKNGGS
Y325_THEMA      --KDAEQIVKKTVETFGRLDILVNNAGIVPY----GNIEETSEEDFDKTMAVNVKGPFLLSKYAEQMKKQ
Y2778_STAA8     NKEEVDELIKIAQQTFGGLDIVINSAG----QMLSSKITDYQVDEWDSMIDVNIKGTLYTAQAALPTMQS
Y2488_STAAC     NKEEVDELIKIAQQTFGGLDIVINSAG----QMLSSKITDYQVDEWDSMIDVNIKGTLYTAQAALPTMQS
Y2422_STAA3     NKEEVDELIKIAQQTFGGLDIVINSAG----QMLSSKITDYQVDEWDSMIDVNIKGTLYTAQAALPTMQS
Y2403_STAAW     NKEEVDELIKIAQQTFGGLDIVINSAG----QMLSSKITDYQVDEWDSMIDVNIKGTLYTVQAALPTMQS
Y2370_STAAS     NKEEVDELIKIAQQTFGGLDIVINSAG----QMLSSKITDYQVDEWDSMIDVNIKGTLYTVQAALPTMQS
GRDH_DAUCA      ---------------FGSIDVLVNNAAEQYKASTVE---DIDEERLERVFRTNIFAYFFMARHALKHMRE
DECR_MOUSE      DPDMVHNTVLELIKVAGHPDVVINNAAISPSERLTPNGWKTITDI---VLNGTAYVTLEIGKQLIKAQKG
DECR_HUMAN      DPDMVQNTVSELIKVAGHPNIVINNAAISPTERLSPNAWKTITDI---VLNGTAFVTLEIGKQLIKAQKG
FABG_PSEAE      SDESVAATLEHIQQHLGQPLIVVNNAGIT-RDNLLVRWFDVVNTNLNSLYRLSKAVLRGMTKRWGRIINI
DECR_RAT        DPDMVHNTVLELIKVAGHPDVVINNAAISPSERLSPNGWKTITDI---VLNGTAYVTIEIGKQLIKAQKG
GRDH_ORYSJ      ----------------GAIDILVNNAAEQERPSIT----DITEDDLERVFRTNIFSYFFMSKHAVKRMRD
CBR4_MOUSE      KEQDVQSTFQEMEKHLGPVNFLVNA-AGINRDSLLVR---TKTEDMISQLHTNLLGSMLTCKAAKTMIQQ
CBR4_BOVIN      KEHDVQNTFEEIEKNLGRVNFLVNAAGINRDNLLVRTNTEDMLSQLHTNLLGSMLTCRAALKTM--IKQQ
YJDA_BACSU      DAHAAFTIHEKISDKLGYPSILINNAAHSASDNYVSLDAKSLDEHYAVNMRSNFLLCVEFARRFKKSNLI
Y4MP_RHISN      DRASCTSASDEVLSAFGVANILINNAGITQPVKT----LDISDADWQRIVAVNMTGVLNLSQVFIPNMNG
ACR1_ACIBI      DMNAIDQLSQQIMASVDHVDFLINNAGRSIRRAVHESF-DRFHD-FERTMQLNYFGAVRLVLNLLPIKRK
BDHA_RHIME      KPSEIADMMAMVADRFGGADILVNGVQFVEKIE------DFPVEQWDRIIAVNLSSSFHTIRGAIPPMKK
BACC_BACSU      DEAACQHAVESAVHTFGGLDVLINNAGI----EIVAPIHEMELSDWNKVLQVNLTGMFLMSKHAHMLAAG
HCDR_XANP2      DEGDVNAAIAATMEQFGAIDVLVNNAGITGNSE-AGVLHTTPVEQFDKVMAVNVRGIFLGCRAVLPLLQG
ACR1_ACIAD      DMNAIDQLSQQIMASVDHVDFLINNAGRSIRRAVHESF-DRFHD-FERTMQLNYFGAVRLVLNLLPIKRK
YWC4_CAEEL      DPGMVSDAFDKIDMKFGKVEILVNNAAFIMATELLGTIIDVLKGTFNVTTELG--------KRC--IQNK
DHRS2_HUMAN     KAEDREQLVAKALEHCGGVDFLV---CSAGVNPLVGSTLGTSEQIWDKILSVNVKSPALLLSQLLPYMNR
MTDH_AGABI      NTDIVTKTIQQIDADLGAISGLIANAGVSVVKPAT----ELTHEDFKFVYDVNVFGVRAVAKLWLQKQQK
HCDS_XANP2      DEAAITAAMAGAQRALGPLTGLVNNAGIAG----FGSVHATEVETWSRIMAVNVTGLASKAALFGMLERG
FABG_THEMA      DRDQIXXXXXXXXQKYGRIDVLVNNAGIT-RDALLVRMKE---EDWDAVINVNLKGVFNVTQMVVPYMQR
YMFI_BACSU      AQDGADKLTSSIVQP-------IDAIVLNSGRSHFGLITDVDNATVQEMVQLHVASPYMLTRNLLPIRNK
YAY8_SCHPO      ----------------GWIDVLVNNIAYQ---QVAQSIEDIDDEQWDLTFKTNIFSFFWVTKAAISHMKS
PHBB_RALEH      DWDSTKTAFDKVKSEVGEVDVLINNAGIT-RDVV---FRKMTRADWDAVIDTNLTSLFNVTKQVIDGMAD
DHG2_BACSU      KEEGIQALLDTALEHFGTLDVMVNNSGFNGVEAMPH---EMSLEDWQRVIDVNVTGTFLGAKAALNHMNI
DHB14_HUMAN     QEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQ---RPEETSAQGFRQXXXXXXXXXXXXXKLALPYLRK
BAIA1_EUBSP     SRDAVMAAVGTVAQKYGRLDVMINNAGIT----MNSVFSRVSEEDFKNIMDINVNGVFNGAWSAYQCMKD
LINC_PSEPA      QEEDVKALVAQTLAAFGGLDGSFNNAAIPQ----AGLPLEVSLERFRQSMDINVYQILAMIERGTK----
FABI_RHIME      ----------------------------------------------------------------------
FABG_SCHPO      DMKNLKSIFESVE-----IDTVVHAAGVL-QSSLCVRTSEKEIDSIICTNLVSAIKLSKMAERDRLILNI
BDH2_MOUSE      KKRQIDQFASEIE----RIDVLFNVAGFVHH----GTILDCEEKDWDFSMNLNVRSMFLMIKAFLPKMQK
TRN2_HYONI      SRSEREEFMKTVSNHFGKLNILVNNAGIVIYKEAK----DYTMEDYSHIMSINFEAAYHLSVLAHPFLSE
FABG_RICBR      NTEECSNLVAQIE----KLDILVCNAGIT-KDTLAIRM---KNEDFDQVIDINLKANFILNREAKMMTNR
TRNH_DATST      SISQRQTLMESVTSSFGKLNILINNAGTTIPKEAT----NFTAEDYSIIMGTNFEASYNLCQLAHPLLKA
DHRS4_BOVIN     KAEDRERLVATAVKLHGGVDILISNAAVSP---FFGSLMDVPEEVWDKILDVNVKATALLTKAVVPEMRX
BAIA2_EUBSP     SRDAVMAAVGQVAQKYGRLDVMINNAGITSNNVFSR----VSEEEFKHIMDINVTGVFNGAWCAYQCMKD
YXEK_CAEEL      DPAKVAKAFDAVEKKLGHTPDILINNAAGNFIMATERL---SPNAYGTIIDIVLKGTLHVTTRRCIQQKR
YVX3_CAEEL      DPGMVSDTFDKIDKKFGKHPDILVNNAAGNFIMATERLSPNAHGTIIDIVLKGTMNVTTELGKRCIQSKT
PECR_PONAB      NEEEVNNLVKSTLDIFGKINFLVN----NGGGQFLSLAEHISSKGWHAVLETNLTGTFYMCKAVYSMKEH
NODG_RHIS3      NRDEVKALGQKAEADLEGVDILVNNAGIT-KDGLFVRMSDADWDTVLEVNLTAVFRLTR--ELTHPMMRR
DCXR_CAVPO      DWEATEQALSNVGPXXXXXXXXXXXXXQPFLEVTKEACVTSFNVNLRAVIQVSQIVAKGMIARGVP----
BACC_BACAM      NEPACQNAILSAVDKFGGLDVLINNAGI----EIVAPIHEMELSDWNKVLNVNLTGMFLMSKHALKYMSG
PECR_HUMAN      NEEEVNNLVKSTLDTFGKINFLVN----NGGGQFLSPAEHISSKGWHAVLETNLTGTFYMCKAVYSMKEH
HSD_MYCTU       QPAQWTAAVDTAVTAFGGLHVLVNNAGILN----IGTIEDYALTEWQRILDVNLTGVLGIRAVVKPMKEA
HSD_MYCBO       QPAQWTAAVDTAVTAFGGLHVLVNNAGILN----IGTIEDYALTEWQRILDVNLTGVLGIRAVVKPMKEA
BDH2_BOVIN      KKKQIDQFANDIE----RLDVLFNVAGFVHH----GTILDCEETDWDFSMNLNVRSMYLMIKAFLPKMQK
PECR_RAT        KEEEVNNLVKSTLAKYGKINFLVNNAG--------GQFMAPAEDITAKGWQAVITNLTGTFYMCKAVYNS
DHRS4_RAT       KAEDREKVNMALKLHQG-IDILVSNAAVNP---FFGNLMDVTEEVWNKVLSINVTASAMMIKAVVPAMEK
CBR4_RAT        KEGDVHSTFEEMEKHLGPVNFLVNA-AGINRDSLLVR---TKTEDMLSQLHTNLLGTMLTCRAARTMIQQ
Y4LA_RHISN      --------FETAERHFGGVDLLVNNASAMHLTPRDRAILDLDLAVWDQTMATNLRGTLLCCRQAIPIARG
PECR_MOUSE      KEEEVSNLVKSTLAKYGKINFLVN----NGGGQFMAPVEDITAKGWHAVIETNLTGTFYMCKEVYNMREH
FABG1_SYNY3     NADEVDQLIKTTLDKFSRIDVLVNNAGIT-RDTLL---LRMKLEDWQAVIDLNLTGVFLCTKAVSKLMQK
BDH2_HUMAN      KKKQIDQFANEVE----RLDVLFNVAGFVHH----GTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMQK
YLX6_SCHPO      KADQIETAIEKVIQTLGPIDVLINNAGLADDTP----FEQLSHESWDHDVSLVLRGNYLTQRYVIPHMGK
TRN2_DATST      SRSERQELMNTVANHFGKLNILVNNAGIVIYKEAK----DYTVEDYSLIMSINFEAAYHLSVLAHPFLSE
HDHA_CLOSO      NIDIYKEMIDTIIKNEGKIDILVNNFG-TGRPEKDLDLVNGDEDTFFELFNYNVGSVYRLSKLIIPHMIE
YXJF_BACSU      KEAQVADTVNVIQKQYGRLDILVNNAGIQHVAPIE----EFPTDTFEQLIKVMLTAPFIAMKHVFPIMKK
PECR_CAVPO      KEEEVNNLMKSTLALYGKIDFLVN----NGGGQFWSSPEHISSKGWHAVIETNLTGTFYMCKAAYNMKEH
LVR_LEIAQ       DEAQVEAYVTATTERFGRIDGFFNNAGIEGKQNPTESF---TAAEFDKVVSINLRGVFLGLEKVLKIMRE
DHRS4_PIG       KAEDRERLVAMAVNLHGGVDILVSNAAVNP---FFGNIIDATEEVWDKILHVNVKATVLMTKAVVPEMEK
ACT3_STRCO      SVPEIEALVAAVVERYGPVDVLVNGATAELADEL---WLDVVETNLT-----GVFRVTKQVLKAGGMLER
PGDH_BOVIN      DQEQLRDTFRKVVDHFGKLDILVNNAGVNNE------------KNWEKTLQINLVSVISGTYLGLDYMNG
FABG_STAAW      DADEVKAMIKEVVSQFGSLDVLVNNAGIT-RDNLLMRMKEQEWDD---VIDTNLKGVFNCIQKATPQMQR
FABG_STAAS      DADEVKAMIKEVVSQFGSLDVLVNNAGIT-RDNLLMRMKEQEWDD---VIDTNLKGVFNCIQKATPQMQR
FABG_STAAR      DADEVKAMIKEVVSQFGSLDVLVNNAGIT-RDNLLMRMKEQEWDD---VIDTNLKGVFNCIQKATPQMQR
FABG_STAAN      DADEVKAMIKEVVSQFGSLDVLVNNAGIT-RDNLLMRMKEQEWDD---VIDTNLKGVFNCIQKATPQMQR
FABG_STAAM      DADEVKAMIKEVVSQFGSLDVLVNNAGIT-RDNLLMRMKEQEWDD---VIDTNLKGVFNCIQKATPQMQR
FABG_STAAC      DADEVKAMIKEVVSQFGSLDVLVNNAGIT-RDNLLMRMKEQEWDD---VIDTNLKGVFNCIQKATPQMQR
FABG_CUPLA      KEEDVEAMIKTAVDAWGTVDILVNNAGITRD----GLLMRMKKSQWQEVIDLNVFLCTQXXXXXXXXXXX
FABG_BACSU      NPEDVQNMIKETLSVFSTIDILVNNAGIT-RDNLIMRMKEDEWDDVININLKGVFNCTKAVTR-QMMKQR
CBR4_HUMAN      KEHDVQNTFEEMEKHLGRVNFLVNA-AGINRDGLLVR---TKTEDMVSQLHTNLLGSMLTCKAATMIQQQ
CPNA_COMTE      N-----------ENHWGAVDTI---LAESDRDALVNNVQDTSNEEWDRIFEINVRSVFLGTRAVEPMRKH
CPNA_COMS9      N-----------ENHWGAVDTI---LAESDRDALVNNVQDTSNEEWDRIFEINVRSVFLGTRAVEPMRKH
Y2146_BRAJA     --------FETAERHFGGVDLLVNNASAMHLTPRDRAILELELAVWDQTMATNLRGTLLCCRQAIPIARG
Y048_HAEIN      ELENIKEVRNQIETDFGTCDILINGAGGNDLNETTRTFFDLDKSGIEFVFNLNYLSLLPTQVFAKDMLGQ
FADH_BACSU      ----------------------------------------------------------------------
DHRS4_MOUSE     KAEDREKLITTLKRHRG-IDILVSNAAVNP---FFGNLMDVTEEVWDKVLSINVTATAMMIKAVVPEMEK
TRNH1_ARATH     -MQTVSSMFG------GKLDILINNLAIRSKPTL-----DYTAEDFSFHISTNLESAYHLSQLAHPLLKA
PGDH_CAVPO      DQEQLRDTFTKVVDYFGRLDILVNNAGVNNEK------------NWEKTLQINLVSVISGTYLGLDYMSE
SDR1_PICAB      EPSQVAQLFDTAEHAFGPLHIVVNNAGVTDSKYPT--LAQTSDEEWDRIFQVNCKGAFLCSREAAKXXXX
LIMC_RHOER      DLESLTAEVDRAVSTLGRLDIVSANAGIASVPFLSH---DIPDNTWRQMIDINLTGVWHTAKVAVPHIER
DRS7B_XENTR     DVEAVNSAANEILHLTGRVDILINNAGISYR----GTILDTKVSVDRMVMDTNYFGPVALTKALIPIKNR
DHRS4_PONAB     KAEDRERLVATAVKLHGGIDILVSNAAVNP---FFGSLMDVTEEVWDKTLDINVKAPALMTKAVVPEMEK
DHRS4_HUMAN     KAEDRERLVATAVKLHGGIDILVSNAAVNP---FFGSIMDVTEEVWDKTLDINVKAPALMTKAVVPEMEK
TRN1_DATST      SRTERDKLMQTVAHVFGKLNILVNNAGVVIHKEAK----DFTEKDYNIIMGTNFEAAYHLSQIAYPLLSQ
PTR1_LEITA      LFSRCSALVDACYMHWGRCDVLVNGSSVGDKESLEV----AAADLFGSNAIAPYFLIKAFAQRADTRAEQ
YUXG_BACSU      KEEDVQSAFERAALAYGGIDIVVNNAGLATSSPFD----ETSLKEWNLNMNVLGTGYFLVAREAFKQMNR
PGDH_MOUSE      DQKQLRDTFRKVVDHFGRLDILVNNAGVNNE------------KNWEQTLQINLVSVISGTYLGLDYMSE
PGDH_MACFA      DQQQLRDTFRKVVDHFGRLDILVNNAGVNNE------------KNWEKTLQINLVSVISGTYLGLDYMSE
PGDH_HUMAN      DQQQLRDTFRKVVDHFGRLDILVNNAGVNNE------------KNWEKTLQINLVSVISGTYLGLDYMSE
DHB14_BOVIN     REEDVRTLVSETIRRFGRLDCIVNNAGYHPPPQWPE---ETSAQGFRQXXXXXXXXXXXXXKLALPLRKS
RHLG_PSEAE      SEAGARRLAQALGELSARLDILVNNAGTS-----WGAALESYPSGWEKVMQLNVTSVFSCIQQLLPLLRR
PTR1_LEIMA      LFTRCAELVAACYTHWGRCDVLVHEPCVGDREAME----TATADLFGSNAIAPYFLIKAFAHRGTPAKHR
NODG_RHIME      NRDEVKALGQRAEADLEGVDILVNNAGIT-KD---GLFLHMADPDWDIVLEVNLTAMFRLTREIQMIRRR
RIDH_KLEAE      QADQVDNLLQGILQLTGRLD-IFHANAGA---YIGGPVAEGDPDVWDRVLHLNINAAFRCVRSVLPHLKS
UXUB_BACSU      DRMSLERAKEDILGQFGAVDLLINGAGGNHPDAITDTYEEAGEGQSFFDMDLTVFSLASQVFGKELLKAD
SOU1_SCHPO      NRSAIETTNQAVEELGGRLDVMIANLSLEDKNE----------DIWTKVVGINLYYTAQAAGHHFKKQGK
SORD_KLEPN      SATEVQQTIDAIIQRWSRIDGLVNNAGVNDEKAPAGRY-ELNEAAFEKMVNINVFFMSQAVAR-QMVKQR
DR4L2_HUMAN     KAEDRERLVAMAVKLHGGIDILVSNAAVNP---FFGSLMDVTEEVWDKTLDINVKAPALMTKAVVPEMEK
DHK2_STRVN      ----------------------------------------------------------------------
DHR11_HUMAN     NEEDILSMFSAIRSQHSGVDICINNAGLARPDTLLSGSTSGWKDMFN----VNVLALSICTREAYQSMKD
YIV6_YEAST      DRSRMEALVEEIRQKHGKLDIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIVSLVALCLPLLKS
VIBA_VIBCH      ----------------------------------------------------------------------
ABA2_ARATH      ----------------------------------------------------------------------
YVAG_BACSU      DLGTEEGC-NELFQAYPEVDILVNNLGIFEPAE----YFDIPDDEWFRFFEVNIMSGVRLTRRYNMIEKK
LINX_PSEPA      DXXXXXXXXXXXVDGFGGLTTLSNTAGIIHP----GGFEEESIEGWNKMVAVNQTAIFLGIKAAIPELVK
FABG_RICFE      ----------------------------------------------------------------------
FABG_RICCN      DKEECRNLISKAS----KLDILVCNAGITS-DTLAIRMKD---EDFDKVIDINLKANFILNREAKMIQNR
FABG2_SYNY3     DLESMTAAAAEITDKLGPVYGVV-ANAGITKDNFFPKLTPADWDA------VLNVNLKGVAYSIKPFIEE
DRS7B_BOVIN     DPGAIAGAASEILQCFGHVDVLINNAGISYR----GAIVDTSPDVDKRVMETNYFGPVALTKALLPAMRR
PHAB_PARDE      DYDACAAGIKQVEEELGPIAVLVNNAGIT-RDAM---FHKMTPQQWKEVIDTNLTGLFNMTHPVWSGMRD
KDSR_DICDI      NKIKVKETIAQIKNQGGKIDCLINCAGFA----IPGYFIEQDEEIFEKTMQLDYFGSLYATKEVVPLMGQ
FABG_RICPR      NKEECSNLISKTSN----LDILVCNAGITS-DTLAIRMKD---QDFDKVIDINLKANFILNREAKMIQKR
DHB8_CANFA      EAGAVRRLLEQVQACFSRPPSVVVSCAGLTRDEFL---LRMSEDDWDRVIAVNLKGIFLVTQAAQALVSS
PHAB_ACISR      -----------------------------------------SYEQWSQVIDTNLKTLFTVT---QPVFNK
DHR11_MOUSE     NEEDILSMFSAVRSQHSGVDICINNAGMARPDTLLSGSTSGWKDMFN----VNVLALSICTREAYQSMKD
XYLL_PSEPU      QFAECQRVMAAALERFGRLDILINNVGGTIWAKPFEHYQEREIEEVRRSLFPTLWCCHAAL--APMIEQG
PTMA_CAMCO      SKESLNCAIDQAFEKYSKIDGFVNSSYPVGKDWGKIAYYEASYEQICESLNLHLGGFILASQEFVKFFKK
YR419_MIMIV     ----------------------------------------------------------------------
Y3106_PSEAE     QEGQVAMSVAEVLGQFGRLDGLVCNAAIANPRNTPLEAL--SLGEWTRTLAVNLTGPMLLAKYCTPYLRH
FABG_RICTY      --------------------------------------------DFDKVIDINLKANFILNREAKMIQKR
DHMA_FLAS1      ----------------------------------------------------------------------
YI78_SCHPO      DVNNFSSIKKSVEKHFGRIDVLLNNAGYSVYSPLES----TTEEQIHNIFNTNVFGALEVIKAITPIFRS
DHR11_BOVIN     NEEDILSMFSAVRSQHSGVDICINNAGLARPDTL----LSGSTSGWKEMFNVNVLALSICTREACQSMRD
Y432_LISMO      KREDNKKLVELAIERYGKVDAIFLNAGIMPNSPLSA----LKEDEWEQMIDINIKGVLNGIAAVLPIAQK
PHBB_ZOORA      SYEACVEGIAKVEADLGPIDVLVNNAGIT-KDAM---FHKMTPDQWNAVINTNLTGLFNMTHPVWSGMRD
ENTA_ECOLI      ----------------------------------------------------------------------
DHI2_RABIT      ---------------------------------------------FRNCMEVNFFGALELTKGLLPLLHH
H17B6_BOVIN     -------------------------------------YRDTLRVNLIGVIEVTLSMLPLVRKAQGRIVNV
DHG2_BACME      KEEDVVNLVETAVKEFGSLDVMINNAGVENPVPSH----ELSLENWNQVIDTNLTGAFLGSREAIKVEND
CMTB_PSEPU      -------------------------------------FLEHTPETLKATIDRNLWTALWCSRVFLPDMRQ
CMTB_PSEP1      -------------------------------------FLEHTPETLKATIDRNLWTALWCSRVFLPDMRQ


                         +         .         .         .         .         *         .:210
query           GGSIITLTYYGAEKVMPNYNVMGVAKAALEASVRYLAVDLGNRGIRVNAVSAGPIKTLAASGIGDFRYIL
FABI1_RHIME     GGSILTLTYYGAEKVMPHYNVMGVAKAALEASVRYLAVDLGNRGIRVNAISAGPIKTLAASGIGDFRYIL
FABI2_RHIME     GGTMLTLTYGGSMRVMPNYNVMGVAKAALEASVRYLAADYGSRGIRVNAISAGPIRTLAGAGISDARAML
FABI_RICBR      GGSIVTLSYYGAEKVIPNYNVMGVAKAALEASVRYLANDMGENNIRVNAISAGPIKTLSGSVIGDFNSML
FABI_RICTY      GGSILTLTYYGAEKVIPNYNIMGVAKAALEASVKYLANDMGENNIRVNAISAGPIKTLASSAISDFSTML
FABI_HELPJ      GASVLTLSYLGSTKYMAHYNVMGLAKAALESAVRYLAVDLGKHNIRVNALSAGPIRTLASSGIADFRMIL
FABI_RICPR      GGSIVTLTYYGAEKVIPNYNIMGVAKAALEASVKYLANDMGENNIRVNAISAGPIKTLASSAISDFSTML
FABI_RICFE      GGSIVTLTYYGAEKVIPNYNVMGISKAALEASVKYLATDLGENNIRVNAISAGPIKTLASSAIGDFSTML
FABI_RICCN      GGSIVTLTYYGAEKVIPNYNVMGVAKAALEASIKYLANDMGENNIRVNAISAGPIKTLASSAIGDFSTML
FABI_HELPY      GASVLTLSYLGSTKYMAHYNVMGLAKAALESAVRYLAVDLGKHHIRVNALSAGPIRTLASSGIADFRMIL
FABI_BACSU      GGSIVTLTYLGGELVMPNYNVMGVAKASLDASVKYLAADLGKENIRVNSISAGPIRTLSAKGISDFNSIL
FABI_SYNY3      GGSIITLTYFGGVKVIPNYNLMGVAKAGLEMTVRYLAAELGPQNIRVNGISAGPIRTLASSAVGGILDMI
FABI_AQUAE      NGAIVTLSYYGAEKVVPHYNVMGIAKAALESTVRYLAYDIAKHGHRINAISAGPVKTLAAYSITGFHLLM
FABI_SHIFL      GSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKML
FABI_ECOLI      GSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKML
FABI_ECO57      GSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKML
FABI_SALTY      GSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKML
FABI_HAEIN      NAALLTLSYLGAERAIPNYNVMCLAKASLEAATRVMAADLGKEGIRVNAISAGPIRTLAASGIKNFKKML
FABI_NEIMB      RNSIVALSYLGAVRAIPNYNVMGMAKASLEAGIRFTAACLGKEGIRCNGISAGPIKTLAASGIADFGKLL
FABI_ANASP      GGSIITLSYLGGVRAVPNYNVMGVAKAGLEASVRYLASELGSQNIRVNAISAGPIRTLASSAVGGILDMI
FABI_PSEAE      NGSLLTLSYLGAERTMPNYNVMGMAKASLEAGVRYLAGSLGAEGTRVNAVSAGPIRTLAASGIKSFRKML
FABI_BUCBP      GSSLLTLSYIGSKKVVPNYNVMGIAKASLESNVRYMASCMGLNGIRVNAISSSPIKTLSSYHIKNFKKIX
FABI_BUCAI      FSSLLTLSYLGSQRVVPNYNVMGLAKASLEASVRYMASSLGKENIRVNAISSSPIKTISSYKITNFNKIR
FABI_BUCAP      FSSLVTLSYLGSQKIVSNYNMMGLAKSSLEANVRYMANSLGKNNIRVNAISSGPIKTTSSYQIKNFNKIQ
FABI_BRANA      GGASISLTYIASERIIPGYGGMSSAKAALESDTRVLAFEAGRKNIRVNTISAGPLGSRAAKAIGFIDTMI
INHA_MYCS2      GGGIVGMDF-DPTRAMPAYNWMTVAKSALESVNRFVAREAGKVGVRSNLVAAGPIRTLAMSAIGQQMQLL
INHA_MYCTU      GGSIVGMDF-DPSRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAMSAIWDQRAPI
INHA_MYCBO      GGSIVGMDF-DPSRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAMSAIWDQRAPI
INHA_MYCAV      GGSIVGMDF-DPSRAMPAYNWMTVAKSALESVNRFVAREAGPHGVRSNLVAAGPIRTLAMAGIGDIRLLE
UCPA_SALTY      GRIVMMSSVTGDMVADPGETAYALSKAAIVGLTKSLAVEYAQSGIRVNAICPGYVRTPMAESIADPESVL
UCPA_SALTI      GRIVMMSSVTGDMVADPGETAYALSKAAIVGLTKSLAVEYAQSGIRVNAICPGYVRTPMAESIADPESVL
FABL_BACSU      GGHIVSISSLGSIRYLENYTTVGVSKAALEALTRYLAVELSPKQIIVNAVSGGAIDTDALKHFPNREDLL
UCPA_ECO57      GRIVMMSSVTGDMVADPGETAYALTKAAIVGLTKSLAVEYAQSGIRVNAICPGYVRTPMAESIADPESVL
UCPA_ECOLI      GRIVMMSSVTGDMVADPGETAYALTKAAIVGLTKSLAVEYAQSGIRVNAICPGYVRTPMAESIADPESVL
HDHA_ECOLI      GGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSVITPEIEQ
HDHA_ECO57      GGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSVITPEIEQ
SOU1_CANAL      GSLIITSSMSGTIVNIPQLQAYNAAKAACTHLAKSLSVEWASFGARVNSISPGYILTDIAD-FADPEMKK
YKVO_BACSU      KGSIIVTGSTAGSIGNPAFSVYGASKAALRALVRNWILDLKGTEIRVNVVSPGGILTPAYDELGDLEEVL
YHDF_BACSU      GCAIISITAYEGDTALIDYSS---TKGAIVSFTRSMAKSLADKGIRVNAVAPGPIWTLIPATFPEEK--V
FABG_CHLTR      SGAIINISSIVGLRGSPGQTNYAAAKAGIIGFSKALSKEVGSKNIRVNCIAPGFIDTDMTKSLNDN---L
FABG_CHLMU      SGAIVNISSIVGLRGSPGQTNYAAAKAGIIGFSKALSKEVGSKNIRVNCIAPGFIDTDMTKGLSDN---L
SPS19_YEAST     KGSILTFHYYG----VPFQGHVGAAKAGIDALAKNLAVELGPLGIRSNCIAPGAINTEGLKRLAGKKYKE
YGHA_ECOLI      GASIITTSSIQAYQPSPHLLDYAATKAAILNYSRGLAKQVAEKGIRVNIVAPGPIWTALQISGGQTQDKI
YGHA_ECO57      GASIITTSSIQAYQPSPHLLDYAATKAAILNYSRGLAKQVAEKGIRVNIVAPGPIWTALQISGGQTQDKI
MTDH_UROFA      TGFQRGXXXXXXXXXXQICNFYNSSKAAVSNLGKCLAAEWAEKSIRVNMLSPGYVKTDQTSHMD--QKLR
DCXR_BOVIN      PGVIVNVSSQASQRGLTNHSVYCSTKGALDTLTKVMAVELGPHKIRVNAVNPTVVMTPMGQAAWSDPQKA
CBR2_PIG        PGSIVNVSSMVSHVTYPGLAAYSSTKGAMTMLTKSMAMELGPHKIRVNSVNPTVVLTAMGRSVTSDPELA
VER1_ASPPA      GGRIITSSNTACVKGVPKHAVYSGSKGAIDTFVRCMAIDCGDKKITVNAVAPGAIKTLAVSR----EYIP
THR1_GLOLA      GGRLILMSITGQAKGVPKHAVYSGSKGTIETFVRCMAIDFGDKKITVNAVAPGGIKT-------------
FABG_SHIFL      GGSVVGTMGNGGQA---NY---AAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTRALSDDQRIL
FABG_ECOLI      GGSVVGTMGNGGQA---NY---AAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTRALSDDQRIL
STCU_EMENI      GGRIITSSNTASVKGVPRHAVYSGSKGAIDTFVRCLAIDCGDKKITVNAVAPGAIKTDMFLSVSR-EYIP
YHXC_BACSU      GSSIISITAYKGNKTLIDYSA---TKGAIVTFTRSLSQSLVQQGIRVNAVAPGPIWTFAAKDVEVF----
FABG_VIBHA      GSVVGTMGNAG----QTNY---AAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTKALNDDQRAA
YJGI_ECOLI      GGRILIIGSVNGDRMVXXXXXXXXXXXXLQGMARGLARDFGPRGITINVVQPGPIDTDANPANGPMRDML
YXBG_BACSU      GGSIINTSSMSGRAADLDRSGYNAAKGGITNLTKAMAIDYARNGIRVNSISPGTIETPLIDKLAQFREAN
YQC8_SCHPO      QGNLIATASMSATIVNAPQHIAAASKAAVRQLCKALAVEWAEFA-RINSVSPGYF----ATDMPGYEFLK
HSD_STREX       GGSIVNISSAAGLMGLALTSSYGASKWGVRGLSKLAAVELGTDRIRVNSVHPGMTYTTAETGIRQG----
CBR2_MOUSE      GGSIVNVSSMVAHVTFPNLITYSSTKGAMTMLTKAMAMELGPHKIRVNSVNPTVVLTDMGKKVSDPEFAR
YVRD_BACSU      SGRILNIASEAGVKPLPTMIPYSMTKTALISLSRGMAEMTKGTNVTVNSVLPGPTWTEAAQAAGQIKDYF
GNO_GLUOX       RGKIVNICSVQSELARPGIAPYTATKGAVKNLTKGMATDWGRHGLQINGLAPGYFATEMTERLVADEEFT
DECR2_RAT       GGVIVNITATLSMRGQVLQLHAGAAKAAVDAMTRHLAVEWGPQNIRVNSLAPGAISTEGLRRLGGPKASS
DECR2_HUMAN     GGVIVNITATLGNRGQALQVHAGSAKAAVDAMTRHLAVEWGPQNIRVNSLAPGPISTEGLRRLGGPQASL
BACC2_BACSU     KGNIINTCSVGGVVAWPDIPAYNASKGGVLQLTRSMAVDYAKHNIRVNCVCPGIIKSFLENNEGTLEEIK
Y4VI_RHISN      GAAIVNVASLAGLLGNPKRSAYAASKAGLISITKSLACRWASRGIRVTAVAPGHVRTLERAGKLDVSAIR
FABG_MYCTU      FGRMIFIGSVSGSWGIGNQANYAASKAGVIGMARSIARELSKANVTANVVAPGYIDTDMTRALDE--RIQ
FABG_MYCS2      KGRIIFIGSVSGMWGIGNQANYAAAKAGLIGMARSISRELAKAGVTANVVAPGYIDTEMTRAL-DERIQA
FABG_MYCBO      FGRMIFIGSVSGSWGIGNQANYAASKAGVIGMARSIARELSKANVTANVVAPGYIDTDMTRALDE--RIQ
FABG_BUCAI      QGRIITIIAYTGNKGQVNYSA---SKSGLIGFHKSLALEVASKGITVNIVSPGLIKTNFTEKLNSIQY--
FABG_BUCBP      QGKIITIGSVIAHIGNCGQTNYSAAKLGLVGFHKSLALELAPKGITVNMIAPGLIKTGMTNNLSQSKYLS
DECR2_PONAB     GGVIVNITATLGNRGQALQVHAGSAKAAVDAMTRHLAVEWGPQNIRVNSLAPGPISTEGLRRLGGPQASL
ARDH_PICST      RGSIILISMSGTIVNDPQPQCMNMSKAGVIHLVRSLACEWAKYNIRVNTLSPGYILTLTRNVISGHTEMK
ARDH_CANAL      TGSIILISMSGTIVNDPQPQCMNMSKAGVIHLARSLACEWAKYNIRVNTLSPGYILTPLTRNVGHTEMKT
SOU2_CANAL      KGKGSFIFTASMSASIVNVPQLQAAYNAAKAGVKHLSKSLSVEWARVNSVSPGYIAT-HLSEFADPDVKS
FIXR_BRAJA      SGSIVNVTSIAGSRVHPFASAYATSKAALASLTRELAHDYAPHGIRVNAIAPGEIRTDMLSPDAEARVVA
YHXD_BACSU      GASIITTTSVEGYNPSPMLLDYAATKNAIIGFTVGLGKQLASKGIRVNSVAPGPIWTLQISGGQPTENIP
Y1385_MYCBO     RGAIVNMSSVSGKVGMVGQTNYSAAKAGIVGMTKAAAKELAHLGIRVNAIAPGLIRSAMTEAMPQRIWDQ
Y1350_MYCTU     RGAIVNMSSVSGKVGMVGQTNYSAAKAGIVGMTKAAAKELAHLGIRVNAIAPGLIRSAMTEAMPQRIWDQ
CBR4_DANRE      GGAIVNIGSVVGVKGNAGQCVYSASKAGLEGFTRSLAKEVASRNIRVNLVAPGLIHTDMTAGLAEEAAV-
DHRS4_RABIT     GGSVVIVASIAAFNPFSGLGPYNVSKTALVGLTKNLALELAAQNIRVNCLAPGLIKTSFSKALWEDKAQE
DCXR_HUMAN      PGAIVNVSSQCSQRAVTNHSVYCSTKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWSDPHKA
GS39_BACSU      GSAIINTTSINPYVGNPTLIDYTATKGAINAFTRTMAQALVKDGIRVNAVAPGPIWTPLIPATFPEETVA
FABG_SALTY      CGRIITIGSVVGTMXXXXXXXXXXXXXXLIGFSKSLAREVASRGITVNVVAPGFIETDMTRALSDDQRIL
FABG_SALTI      CGRIITIGSVVGTMXXXXXXXXXXXXXXLIGFSKSLAREVASRGITVNVVAPGFIETDMTRALSDDQRIL
KDUD_BACSU      RGNIASLLSFQGGILVPAYT---ASKHAVAGLTKSFANEWAASGIQVNAIAPGYISTANTKPIRDDE---
GRDH1_ARATH     GSSIINTTSVNAYKGNASLLDYTATKGAIVAFTRGLALQLAEKGIRVNGVAPGPIWTPLIPASFNEEKIK
FABG_AQUAE      ISSVVGFT---GNVGQVNYST---TKAGLIGFTKSLAKELAPRNVLVNAVAPGFIETDMTAVLSE--EIK
YOHF_ECOLI      GGRIINITSVHEHTPLPDASAYTAAKHALGGLTKAMALELVRHKILVNAVAPGAIAT-PMNGMDDSD-VK
NODG_AZOBR      RGRIINISSVNGVKGQAGQTNYSAAKAGVIGFTKALAAELATKGVTVNAIAPGYIGTDMVMAIEDIRQAI
DCXR_RAT        -GAIVNVSSQASQRALTNHTVYCSTKGALDMLTKVMALELGPHKIRVNAVNPTVVMTPMGRANWSDPHKA
Y182_METEA      GGSIINISSVVTDVLMPTSAVYSGTKGALNAISGVLANELAPRKIRVNVVSPGYVVTEGTHTAG-----I
FABG_MYCAV      KGRIIYIGSVSGMWGIGNQANYAAAKAGLIGMARSISRELSKAGVTANVVAPGYIDTEMTRAL-DERIQA
FABG_HAEIN      FGRIINIGSVVGSTGNPGQTNYCAAKAGVVGFSKSLAKEVAARGITVNVVAPGFIATDMTEVLTDEQKIL
FABG_CHLPN      SGSIINVASIVAKIGSAGQTNYAAAKAGIIAFTKSLAKEVAARNIRVNCLAPGFIETDMTSVLND-NLKA
ARDH_CANTR      TGSIILISMSGTIVNDPQPQCMNMSKAGVIHLARSLACEWAKYNIRVNTLSPGYILTPLTRNVGHTEMKT
Y2049_STAEQ     SGHIINLASVSGFEPTKTNAVYGATKAAIHAITQSLEKELARTGVKVTSISPGMVDTPMTEG--------
Y2036_STAES     SGHIINLASVSGFEPTKTNAVYGATKAAIHAITQSLEKELARTGVKVTSISPGMVDTPMTEG--------
MTDH_ALTAL      GSLVITSSMSGHIANFPSYNV-------AKAGCIHLAKSLANEWARVNSISPGYIDT----GLSDFQDIQ
DCXR_MESAU      PGAIVNVSSQASQRALANHSVYCSTKGALDMLTKMMALELGPHKIRVNAVNPTVVMTSMGRTNWSDPHKA
FABG_VIBCH      GSVVGTMXXXXXXXXXXXXXVIGFTKS--------MAREVASRGVTVNTVAPGFIETDMTKALNDEQRTA
DCXR_CAEEL      -GSIVNISSQAAIRPLDNHTVYCASKAALDMVTRCLANELGSQNIRVNSVNPTVVMTMGRDNWSDPDKKK
MTDH_CLAHE      RGTVITASMSGHIANFPQEQTSNVAKAGCIHMARSLANEWRDFA-RVNSISPGYIDT----GLSDFETQQ
GRDH2_ARATH     GSSIINTTSVVAYAGNSSLLEYTATKGAIVSFTRGLALQLAPKGIRVNGVAPGPVWTPLIPASFSEEAIK
Y2567_STAAR     SGHLINIASISGFEVTKSSTIYSATKAAVHTITQGLEKELAKTGVKVTSISPGMVDTAITA---------
FABG_BUCAP      YGRIVTIGSYLGNRGQINYSA---SKSGLIGFHKSLALEVAQKGITVNIVSPGFIKTNLTKNLNVFQY--
DHSO_RHOSH      GGKIINMASQAGRRGEALVGVYCATKAAVISLTQSAGLNLIRHGINVNAIAPGVVDGEHWDGVADYENLP
DER_CHICK       PGAIVNVSSQASQRALRDHAVYCSTKSALDMLSKVMAMELGPHKIRVNTVN----PTVVMTDMGR----I
DECR2_MOUSE     GGVIVNITATLSMRGQVLQLHAGAAKAAVDAMTRHLAVEWGPQNIRVNSLAPGAISTEGLRRLRGSNASS
DCXR_MOUSE      -GAIVNVSSQASQRALTNHTVYCSTKGALDMLTKMMALELGPHKIRVNAVNPTVVMTPMGRTNWSDPHKA
CBR4_XENTR      GGAIVNIGSIVGHKGNIGQSIYGASKEGLIGFSKSLAKEVAKRNIRVNVVAPGFIHTDMTLGLEEDSLTK
Y2478_STAAM     SGHLINIASISGFEVTKSSTIYSATKAAVHTITQGLEKELAKTGVKVTSISPGMVDTAITAA--------
Y2266_STAAN     SGHLINIASISGFEVTKSSTIYSATKAAVHTITQGLEKELAKTGVKVTSISPGMVDTAITAA--------
T4HR_MAGGR      GGRLILMSITGQAKAVPKHAVYSGSKGAIETFARCMAIDMADKKITVNVVAPGGIKTDMYHAVGENLSNE
DECR2_DANRE     GGSIVNISATLGYRGQALQVHAGSAKAANDAMTRHLAVEWGPSGVRVNTVAPGPISTEGYRRLGGSHAET
CBR4_XENLA      XXXXXXXXXXXXXXHKGNQSIYGASKEGLIGFSKSLAKEVAKRNIRVNVVAPGFIRT-------DMTSDL
DCXR_TRIRE      GSLVITASMSGH---VANYPQEQTSYNVAKAGCIHLARSLANEWARVNSISPGYIDT----GLSDFKTQE
FABG_STAES      SGAIINLTSIVGAMGNPGQANYVATKAGVIGLTKTAARELASRGITVNAVAPGFIVSDMTNALSDDLKDQ
FABG_STAEQ      SGAIINLTSIVGAMGNPGQANYVATKAGVIGLTKTAARELASRGITVNAVAPGFIVSDMTNALSDDLKDQ
YQJQ_BACSU      KGHIINIASQAGKIATPKSSLYSATKHAVLGYSNALRMELSGTGIYVTTVNPGPIQT-------------
YGFF_ECOLI      GGAIVNVSSVASRLGSPGYVDYAASKGAIDTLTTGLSLEVAAQGIRVNCVRPGFIYTEMHASGGEPGRVD
Y325_THEMA      GGGVIVNVSSEAGLIIPRRCVYSVSKAALLGLTRSLAVDYVDYGIRVNAVCPGTTQSARVKASPNPEELL
Y2778_STAA8     SGHLINIASISGFEVTKSSTIYSATKAAVHTITQGLEKELAKTGVKVTSISPGMVDTAITAA--------
Y2488_STAAC     SGHLINIASISGFEVTKSSTIYSATKAAVHTITQGLEKELAKTGVKVTSISPGMVDTAITAA--------
Y2422_STAA3     SGHLINIASISGFEVTKSSTIYSATKAAVHTITQGLEKELAKTGVKVTSISPGMVDTAITAA--------
Y2403_STAAW     SGHLINIASISGFEVTKSSTIYSATKAAVHTITQGLEKELAKTGVKVTSISPGMVDTAITAA--------
Y2370_STAAS     SGHLINIASISGFEVTKSSTIYSATKAAVHTITQGLEKELAKTGVKVTSISPGMVDTAITAA--------
GRDH_DAUCA      GSTIINTTSINAYKGNAKLLDYTATKGAIVAFTRGLSLQLISKGIRVNGVAPGPVWTPLIPSSFDEEEVK
DECR_MOUSE      AAFLAITTIYGSGFVMPSSS----AKSGVEAMNKSLAAEWGRYGMRFNIIQPGPIKTKGASRLDPTGRFE
DECR_HUMAN      AAFLSITTIYGSGFVVPSAS----AKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKTKGASRLDPTGTFE
FABG_PSEAE      GSVVGAMGNAG----QTNY---AAAKAGLEGFTRALAREVGSRAITVNAVAPGFIDTDMTRELPEAQREA
DECR_RAT        AAFLAITTIYGSGFVMPSSS----AKSGVEAMNKSLAAEWGRYGMRFNIIQPGPIKTKGASRLDPTGKFE
GRDH_ORYSJ      XXSIISINAYKGNKTLLDYTA---TKGAIVAFTRALALQLAEEGIRVNGVAPGPIWTLIPASFAEEK--V
CBR4_MOUSE      XXXXXXXXXXXXLKGNVGQSAYSATKGGLVGFSRSLAKEVARKKIRVNVVAPGFIRT-------DMTRHL
CBR4_BOVIN      RGSIVNVGSVVGLKGNSGQSVYSASKGGLVGFSRALAKEVAKKKIRVNVVAPGFIHTDMTKDLNE--ELL
YJDA_BACSU      SGRIINMTSGQDLGPLPGELAYAATKGAISAFTRSLSQELAPLGITVNAVNPGPTSTWMTDEIRNFL---
Y4MP_RHISN      GGSIACMSSVSAQRGGPHYSXXXXXXXXXXXXXXR---EFGPDSIRVNCVTPGLIQTLSAEMRAD---IV
ACR1_ACIBI      NGQIINISSIGVLANATRFSAYVASKAALDAFSRCLSAEVLKHKISITSIYMPLVRTPMIAPTKIYKYV-
BDHA_RHIME      KGRIINIASAHGLVASPFKSAYVAAKHGIMGLTKTVALEVAESGVTVNSICPGYVLTARTRGITEEQVIN
BACC_BACSU      KGNIINTCSVGGLVAWPDIPAYNASKGGVLQLTKSMAVDYAKHQIRVNCVCPGIIKSFLENNEGTLEEIK
HCDR_XANP2      AGVIVNIASVASLVAFPGRSAYTTSKGAVLQLTKSVAVDYAGSGIRCNAVCPGMIETPMTQWRLDQPELR
ACR1_ACIAD      NGQIINISSIGVLANATRFSAYVASKAALDAFSRCLSAEVLKHKISITSIYMPLVRTPMIAPTKIYKYV-
YWC4_CAEEL      GASITSITAGYARAGAPFIVPSAVSKAGVETMTKSLATEWSKYGLRFNAVSPGPIPTKGAWGSGEMGDIA
DHRS2_HUMAN     RGAVILVSSIAAYNPVVALGVYNVSKXXXXXXXXXXXXXXXPKDIRVNCVVPGIIKT-------DFSKVF
MTDH_AGABI      GSIVVTXXXXXXXXXXXXXXXXNSSKAACSNLVKGLAAEWASAGIRVNALSPGYVNTDQTAHMD--KKIR
HCDS_XANP2      RGAIVNFGSVAGLVGIPTMAAYCAAKGAVVNLTRQMAADYSGRGIRVNVVCPG---TVAGTDMGEARRLA
FABG_THEMA      XXXXXXXXXXXXXXXXPGQTNYAASKAGVIGMTKTWAKELAGRNIRVNAVAPGFIETPMTEKLPEKARET
YMFI_BACSU      SGAIVAVSSIWGETGASCEVLYSMAKGAQHSFVKGLAKELAPSGIRVNAVAPGAVDT---NMMNQFTPAE
YAY8_SCHPO      GSSIVNCSSINAYVGRPDLLDYTSTKGAITAFTRGLSNQYAQHGIRVNAVAPGPIYTPLVSSTFPKEKIE
PHBB_RALEH      RGRIVNISSVNGQKGQFGQTNYSTAKAGLHGFTMALAQEVATKGVTVNTVSPGYIATDMVKAIR--QDVL
DHG2_BACSU      KGNVLNISSVHQQIPRPVNVQYSTSKGGIKMMTETLALNYADKGIRVNAIAPGTIAT-------------
DHB14_HUMAN     SGNVINISSLGQAQAVPYV----ATKGAVTAMTKALALDESPYGVRVNCISPGPLWEELAALMPDPRATI
BAIA1_EUBSP     AKQGVIINTASVTGIYGSLSGIGTSKAGVIGLTHGLGREIIRKNIRVVGVAPGVVDTDMTKGLPP--EIL
LINC_PSEPA      -GSIVNTASAAGVVGVPMHGEYVGAKHAVVGLTRVAAADYGKHGIRVNALVPGAVRTMLQRAMDNDAGLE
FABI_RHIME      ----------------------------------------------------------------------
FABG_SCHPO      SSRLSTYA-------LPGTSVYAASKAGLESFTKVLAAEVASKGIRVNAISPGYVDTPMLSS-----QIR
BDH2_MOUSE      SGNIINMSSVASSKGVENRCVYSATKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSIQARDNPKEAL
TRN2_HYONI      RGNVVFISSISGASALPYEAVYGATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATMVEMTIQDPEQKE
FABG_RICBR      YGRIINITSIVGVSGNPGQANYCASKAGLIGMTKSLAYEVATRGITVNAVAPGFIKSDMTDKLNDTRKIP
TRNH_DATST      SGSIVFNSSAAGVIAVPLSSIYAASKGAINQVTKSLACEWAKDSIRVNAVAPWIINTPAACQVPSQKKNI
DHRS4_BOVIN     XXXXXXXXXXAAYSPFPSLGPYNVSKTALLGLTKNLALELAESNVRVNCLAPGLIRT-------SFSRVL
BAIA2_EUBSP     AKKGVIINTASVTGIFGSLS--GVGYPASKASVIGLTHGLGRKNIRVVGVAPGVVNTDMTNG--NPPEIM
YXEK_CAEEL      GASVLSITTLYAQSGAPFVVPSAVSKAGVENMTKSLASEWAKHGLRFNAIAPGPIPTEGAFGAGELKDSG
YVX3_CAEEL      GASVTSITAAYARSGAPFIVPSAVSKAGVEIMTKSLATEWSKYGLRFNAVSPGPIPTKGAWGMGDVAE--
PECR_PONAB      GGSIVNIIV-SIKTGLPLAVHSGAARAGVYNLTKSLALEWACSGVRINCVAPGVIYSTAVENYGSYQSFF
NODG_RHIS3      RGRIINITSVVGVTGNPGQTNYCASKAGMIGFSKSLAQEIATRNITVNCVAPGFIESAMTDKLND-----
DCXR_CAVPO      -GAIVNVSSQASQRALTNHTVYCSTKGALYMLTKMMALELGPHKIRVNAVNPTVVMTPMGRTNWSDPHKA
BACC_BACAM      KGNIINTCSVGGVVAWPDIPAYNASKGGLQTDAFYRPSIIAKHNIRVNCVCPGIIKSFLENNEGTLEEIK
PECR_HUMAN      GGSIVNIIV-PTKAGFPLAVHSGAARAGVYNLTKSLALEWACSGIRINCVAPGVIYSTAVENYGSWQSFF
HSD_MYCTU       GGSIINISSIEGLAGTVACHGYTATKFAVRGLTKSTALELGPSGIRVNSIHPGLVKTPMTDWVPE-----
HSD_MYCBO       GGSIINISSIEGLAGTVACHGYTATKFAVRGLTKSTALELGPSGIRVNSIHPGLVKTPMTDWVPE-----
BDH2_BOVIN      SGNIINMSSVASSKGVVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQALSDFLKRQ
PECR_RAT        GGSIVNIIVL-LNNGFPTAAHSGAARAGVYNLTKTMALTWASSGVRINCVAPGTIYSQTAGELGQTMFEM
DHRS4_RAT       RXXXXXXXXXXXXXLFPSLGPYNVSKTALLGLTKNFAAELAPKNIRVNCLAPGLIKTHFSS------VLW
CBR4_RAT        XXXXXXXXXXXXLKGNVGQAAYSATKGGLIGFSRSLAKEVARKKIRVNVVAPGFIHTDMTKHLKEEHF--
Y4LA_RHISN      GGAIVNMSSCQGLSGDTAQTSYAVSKAAMNMLSASLATQYGHAQIRCNAVAPGLIMTERLLAKLD-KCMQ
PECR_MOUSE      GGSIVNIIVL-LNNGFPTAAHTGAAREGVYNLTKSMALAWASSGVRINCVAPGTIYSTAVDNYGEMGQTL
FABG1_SYNY3     SGRIINITSVAGMMGNPGQANYSAAKAGVIGFTKTVAKELASRGVTVNAVAPGFIATDMTENL-NAEPIL
BDH2_HUMAN      SGNIINMSSVASSKGVVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQE----RIQA
YLX6_SCHPO      GGSIVNIGSVNGHIYLPAYSA---AKAGLENLTKALAVRYGPLGIRVNVCAPGTIWSPAHPDVGD--RMK
TRN2_DATST      RGNVVFISSVSGALAVPYEAVYGATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATLVEMTIQDPEQKE
HDHA_CLOSO      NKXXXXXXXXXXXXXXPDISRIGVSKSGVNNITKQIAIQYAKYGIRCNAVLPGLIATDAASMPDEFR---
YXJF_BACSU      QGRIINIASVNGLVGFAGKSAYNSAKHGVIGLTKVGALEGAPHGITVNALCPGYVDTLVRNQLSDYDSVL
PECR_CAVPO      GGAIVNIIIL--LNGQPFVAHSGAARGGVYNLTKSLALGWARSGIRINCVAPGTVYSQTADNYGDMGKTL
LVR_LEIAQ       QGSVVNTASVGGIRGIGNQSGYAAAKHGVVGLTRNSAVEYGRYGIRINAIAPGAIWTPMVE--NSMKQLD
DHRS4_PIG       XXXXXXXXXXXAYHPFPNLGPYNVSKTALLGLTKNLAVELAPRNIRVNCLAPGLIKT-------------
ACT3_STRCO      GGRIVNIASTGGKQGVVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVRE-HYSD
PGDH_BOVIN      GEGGININMSSLAGLMPKHGIVGFTRSAA------MAANLMNSGVRLNAICPGFVDTPILKSIEKEENMG
FABG_STAAW      SGAIINLSSVVGAVGNPGQANYVATKAGVIGLTKSAARELASRGITVNAVAPGFIVSDMTDALSD--ELK
FABG_STAAS      SGAIINLSSVVGAVGNPGQANYVATKAGVIGLTKSAARELASRGITVNAVAPGFIVSDMTDALSD--ELK
FABG_STAAR      SGAIINLSSVVGAVGNPGQANYVATKAGVIGLTKSAARELASRGITVNAVAPGFIVSDMTDALSD--ELK
FABG_STAAN      SGAIINLSSVVGAVGNPGQANYVATKAGVIGLTKSAARELASRGITVNAVAPGFIVSDMTDALSD--ELK
FABG_STAAM      SGAIINLSSVVGAVGNPGQANYVATKAGVIGLTKSAARELASRGITVNAVAPGFIVSDMTDALSD--ELK
FABG_STAAC      SGAIINLSSVVGAVGNPGQANYVATKAGVIGLTKSAARELASRGITVNAVAPGFIVSDMTDALSD--ELK
FABG_CUPLA      GRIINIASVVGGNAGQANYSA---AKAGVIGFTKTVAREYASRNINVNAVAPGFISSDMTSKLGD--DIN
FABG_BACSU      SGRIINVSSIVGVSGNPGQANYVAAKAGVIGLTKSSAKELASRNITVNAIAPGFISTKLAKDVQD--EML
CBR4_HUMAN      XXXXXXXXXXXXLKGNSGQSVYSASKGGLVGFSRALAKEVARKKIRVNVVAPGFVHTDMTKDLKE-EHLK
CPNA_COMTE      KGCIVNVSSIYGLVGAPGAAAYEASKGAVRLFTKACAVDLAPFNIRVNSVHPGVIATPMTQQILDAPQSA
CPNA_COMS9      KGCIVNVSSIYGLVGAPGAAAYEASKGAVRLFTKACAVDLAPFNIRVNSVHPGVIATPMTQQILDAPQSA
Y2146_BRAJA     GGAIVNMSSLSGDTALTSY---AASKAAMNMLSSSLATQYGHAQIRCNAVAPGLIMTLLAKLDACMQTHL
Y048_HAEIN      GANIINISSMNAFTPLTKIPAYSGAKAAISNFTQWLAVYFSKVGIRCNAIAPGFLQNLALLFDTEGKPTD
FADH_BACSU      ---------------------------------RTLAVEWGSKGIRTNAIAPGPIRTGGAEKLFESEKAM
DHRS4_MOUSE     RXXXXXXXXXXXAGFFPSLGPYNVSKTALLGLTKNFAAELAPKNIRVNCLAPGLIKTRFSSVLWEEKARE
TRNH1_ARATH     SGNIIFMXXXXXXXXXXXXXXXXXTKGALNQLARNLACEWASDGIRANAVAPAVIATPLAEAVYDDEF-K
PGDH_CAVPO      GGVIINMSSLAGLMPVAQQPVYCASKHGIIGFTRSAAMKLMNSGVRMNAICPGFVNTSILQSIEKEENMG
SDR1_PICAB      XXXXXXXXXXXXLVAMPRYGAYTASKAAVEMMTRILAQELRGTQITANCVAPGPVAT-DMFFAGKSEAAV
LIMC_RHOER      GGSIVLTSSAAGLKGYAQISHYSAAKHGVVGLMRSLALELAPHRVRVNSLHPTQVNTPMIQNEGTYRFEI
DRS7B_XENTR     RGHIVVISSVQGKISIPFRSAYSASKHATQAFFDCLRAEMSPYEIDVTVVNPGYIKT-------------
DHRS4_PONAB     XXXXXXXXXXAAFSPSPGFSPYNVSXXXXXXXXXXXXIELAPRNIRVNCLAPGLIKTSFS------RMLW
DHRS4_HUMAN     XXXXXXXXXXAAFSPSPGFSPYNVSXXXXXXXXXXXXIELAPRNIRVNCLAPGLIKTSFS------RMLW
TRN1_DATST      NGNVIFLSSIAGFSALPSVSLYSASKGAINQMTKSLACEWAKDNIRVNSVAPGVILTLVETAIKKDNFIV
PTR1_LEITA      RGSIVNMVDAMTSQPLLGYTMYTMAKEALEGLTRSAALELASLQIRVNGVSPG------LSVLPDDMPFS
YUXG_BACSU      GGSMVFVGSKNSVYAGKNASAYSSVKALETHLARCIAAEGGEFGIRVNSVL--PDAVLQGSAI----WGS
PGDH_MOUSE      GGIIINMSSLAGLMPVAQQPVYCASKHGIIGFTRAMAANLMKSGVRLNVICPGFVDTPILESIEKEENMG
PGDH_MACFA      GGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRALAANLMNSGVRLNAICPGFVNTAILESIEKEENMG
PGDH_HUMAN      GGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRALAANLMNSGVRLNAICPGFVNTAILESIEKEENMG
DHB14_BOVIN     RGNVINISSLGQSQAVPYV----ATKGAVTAMTKALALDESQYGVRVNCISPGNIWT-------------
RHLG_PSEAE      SASVINISVAGISAMGEQAYAYGPSKAALHQLSRMLAKELVGEHINVNVIAPGRFPSRMTRHIANDPQAL
PTR1_LEIMA      GTSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPG------LSVLVDDMPPA
NODG_RHIME      NGRIINVTSVAGAIGNPGQTNYCASKAGMIGFSKSLAQEIATRNITVNCVAPGFIESAMTDKLNH-----
RIDH_KLEAE      GDIIFTAVIAGVVPVIPVYTA---SKFAVQAFVHTTRRQVAQYGVRVGAVLPGPVVT-------------
UXUB_BACSU      SPAIINLSSMSAYSPMTKVPAYSAAKASINNFTMWMAVHFAETGLRVNAIAPGFFLTLLINQDGTFTSRS
SOU1_SCHPO      GSLIFTASMSGHIANWPQWASYHATKAAVKHLARALAVEWAPFA-RVNSVSPGYIDT-DLTLYADENLRK
SORD_KLEPN      AGVIVNVXXXXXXXXXXXXXCYAATKAALNSFTRSWSKELGKYGIRVVGVAPGILEKTGLR-TPEYEEAL
DR4L2_HUMAN     XXXXXXXXXXAAFSPSPGFSPYNVSKTALLGLNNTLAIELAPRNIRVNCLHL-DLSRLASAG--------
DHK2_STRVN      -----------------------VSNGGHRAQTRLLANTVGP-AVRVNAVAPGLIETPWTQNSDFFAPIA
DHR11_HUMAN     DGHIININSMSGHRVLPFYSATKYAVTALTEGLRQ-ELREAQTHIRATCISPGVVETQFAFKLHDKDPEK
YIV6_YEAST      SGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPSDKVRAVCIAPGVVDT-------------
VIBA_VIBCH      -GSMVIIGSNAANTPRMSIGAYGASKAALHMLVKCIGMELAPYGIRCNLVSPGSTRTAMQQQLWTEQYVI
ABA2_ARATH      -------------------------KHAVLGLTRSVAAELGQHGIRVNCVSPYAVATLALAHLPEFVGFR
YVAG_BACSU      EGRVIFIASEAASQEMAHYSATKTMQLSISRSLAELAT---GTNVTVNTVMPGSTLTEGVETMLNSLYFM
LINX_PSEPA      XXXXXXXXXXXXXXMFPTAGNASATKAAVRIMSKAAALEFVDRGVRVNTIVPGGMNTPITANVPP--DVL
FABG_RICFE      ------------------------SKAGLIGMTKSLSYEVATRGITVNAVAPGFIKSDMTDKLNE-----
FABG_RICCN      YGRXXXXXXXXXXXXXPGQANYCASKAGLIGMTKSLSYEVATRGITVNTVAPGFIKSDMTDKLNE-----
FABG2_SYNY3     RGNV-GQTNYSATKA----GVIGMMKSLAREGARY--------GVRANAVAPGFIDTEMTLAIRE--DIR
DRS7B_BOVIN     QGHVVAISSIQGKISLPFRSAYAASKHATQAFFDCLRAEVEQHDIEVTVISPGYIHT-------------
PHAB_PARDE      RGRIVNISSINGQKGQAGQANYSAAKAGDLGFTKALAQEGARAGITVNAICPGYIGTEMVRAI-DEKVLN
KDSR_DICDI      GGHIVFVSSTCGLVGVPGYSTYCPSKFALRGLAETLRSEL------------------------------
FABG_RICPR      YGRIINISSIVGIAGNPGQANYCASKAGLIGMTKSLSYEVATRGITVNAVAPGFIKSDMTDKLNE-----
DHB8_CANFA      GGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFITTPMTQKVP--QKVL
PHAB_ACISR      SGRIVNISSVNGLKGQFGQANYSASKAGIIGFTKALAQEGARSNICVNVVAPGYTATPMVTAMRED--VI
DHR11_MOUSE     DGHIININSMCGHRVPPQYSATKYAVTALTEGLRQELLE-AQTHIRATCISPGLVETQFAFKLHD----K
XYLL_PSEPU      SGAIVNVSSVATRGI--HRVPYGAAKGGVNALTACLAFETAERGIRVNATAPGGTEARHGGFRNSYQQIV
PTMA_CAMCO      QGNIINLSSIMGNTTMQSSLEYSVIKAGINHLGAWLAKELFNTNIRVN--------TLASGGILDNQANI
YR419_MIMIV     -----------------------------------------NRSIRVNCIAPGPILTLSNLELQQFQEI-
Y3106_PSEAE     NGAIVNIASTRAHQSEPDSEAYAASKXXXXXXXXXXXXXXXP-DIRVNALSPGWIDTREAAE-REAAPLT
FABG_RICTY      YGRIINISSIVGIAGNPGQANYCASKAGLIGMTKSLSYEVATRGITVNAVAPGFIKSDMTDKLNE-----
DHMA_FLAS1      ---------------------------------RAMAVDLARHGILVNMIAPGPVDTGNNTGYSEPRLAE
YI78_SCHPO      NGMIINVSSIGGKMTFPLGCLYYGTKYAIEGISEALTWEMQSIGVKVKIIEPG-----------------
DHR11_BOVIN     DGHIININSMCGHRVPPETHFYSATKYAVTALTEGLRQELARSHIRATCISPGVVETQFAFKLHD-----
Y432_LISMO      SGHIIATSSVAGLKAYPGGAVYGATKWAVRDLMEVLRMESAQEGTNIRTVTIYP----------------
PHBB_ZOORA      RGRIVNISSINGQKGQMGQANYSAAKAGDLGFTKALAQEGAAKGITVNAICPGYIGTEMVRAIPE-KVLN
ENTA_ECOLI      GGAIVTVASDAAHTPRIGMSAYGXXXXXXXXXXXXVGLELAGSGVRCNVVSPGSTRTLWVSDDAEEQRIR
DHI2_RABIT      SGRIVTLGSPAGEMPYPCLAAYGTSKAAMALLMDAFSCELLPWGVKVSVIQPGCFKTESVSNV-------
H17B6_BOVIN     SSILGRIAFFGA--------VYSCSKYGVEAFSDILRRELQHFGVKVSMVEPGYFRT-AMTDWQKFSEIM
DHG2_BACME      KGNVINMSSVHEMIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAIDTINAEKFAD-----
CMTB_PSEPU      YGRIINIGADSVRNGLPDHAAYNAAKGGMHGLTTGLAREFARQGVTVNTVAPCAVNTEVWVRIKNANPEL
CMTB_PSEP1      YGRIINIGADSVRNGLPDHAAYNAAKGGMHGLTTGLAREFARQGVTVNTVAPCAVNTEVWVRIKNANPEL


                         .         .         .         +         .         .         .:280
query           KWNEYNAPLKRTVTIEEVGKSALYLLSDLSTAVTGEIHHVDSGYHTIGMKAVDAPDISVVKD
FABI1_RHIME     KWNEYNAPLKRTVSIEEVGNSALYLLSDLSSGVTGEVHHVDSGYHTVGMKAVDAPDISVLKD
FABI2_RHIME     SWQQKNSPLRRTVTIEDVGSSALYLLSDLSRGVTGEIHYVDSGYNITSMPTLEA--------
FABI_RICBR      RSHAATAPLKRNTLQQDVAGAAVYLFSQLASGVTGEIHYVDCGYNVMGSNKI----------
FABI_RICTY      KFHASTAPLKRNITQEDVGGAAVYLFSELSKGVTGEIHYVDCGYNIIG--------------
FABI_HELPJ      KWNEINAPLRKNVSLEEVGNAGMYLLSSLSNGVSGEVHFVDAGYHVMGMGAVEEKD------
FABI_RICPR      KSHAATAPLKRNITQEDVGGAAVYLFSELSKGVTGEIHYVDCGYNIIG--------------
FABI_RICFE      KSHAATAPLKRNTTQEDVGGAAVYLFSNLSKGVTGEIHYVDCGYNIMG--------------
FABI_RICCN      KSHAATAPLKRNTTQEDVGGAAVYLFSELSKGVTGEIHYVDCGYNIMG--------------
FABI_HELPY      KWNEINAPLRKNVSLEEVGNAGMYXXXXXXXGVSGEVHFVDAGYHVMGMGAVEEKD------
FABI_BACSU      KDIEERAPLRRTTTPEEVGDTAAFLFSDMSRGITGENLHVDSGFH-----------------
FABI_SYNY3      HHVEEVAPLKRTVTQTEVGNTAAFLASDLSSGITGQIIYVDSGYEIMGM-------------
FABI_AQUAE      EHTTKVNPFGKPITIEDVGDTAVFLCSDWARAITGEVVHVDNGYHIMGV-------------
FABI_SHIFL      AHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNELE---------
FABI_ECOLI      AHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNELE---------
FABI_ECO57      AHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNELE---------
FABI_SALTY      AHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNELE---------
FABI_HAEIN      STFEKTAALRRTVTIEDVGNSAAFLCSDLASGITGEIVHVDAGFSITAM-------------
FABI_NEIMB      GHVAAHNPLRRNVTIEEVGNTAAFLLSDLSSGITGEITYVDGGY------------------
FABI_ANASP      HHVEQVAPLRRTVTQLEVGNTAAFLASDLASGITGQVLYVDAGYEIMGM-------------
FABI_PSEAE      AANERQTPLRRNVTIEEVGNAGAFLCSDLASGISGEILYVDGGFNTTAMGPLD---------
FABI_BUCBP      XXXXXXXXXXXXXXVEDVGNTAAFLCSDLSKGITGQIIYVDGGFNITAM-------------
FABI_BUCAI      NCSYASSFLKNSVTSENIGNVASFLLSDLSLGITGSVIYVDNGFNVSSMNNI----------
FABI_BUCAP      KIHKLFSLTKNHVSSEEIGNVAAFLCSDLSIGITGSIINVDHGFNLNGINSI----------
FABI_BRANA      EYSYNNAPIQKTLTADEVGNAAAFLVSPLASAITGATIYVDNGLNSMGV-ALDSP-------
INHA_MYCS2      EWDQ-RAPLGWNMDPTPVAKTVCALLSDWLPATTGTVIYADGGAST----------------
INHA_MYCTU      GWNMKDA--------TPVAKTVCALLSDWLPATTGDIIYADGGAHT----------------
INHA_MYCBO      GWNMKDA--------TPVAKTVCALLSDWLPATTGDIIYADGGAHT----------------
INHA_MYCAV      EGWDQRAPIGWNMDPTPVAKTVCALLSDWLPATTGTIIYADRGAST----------------
UCPA_SALTY      TEMAKAIPLRRLADPLEVGELAAFLASDESSYLTGTQNVIDGG-------------------
UCPA_SALTI      TEMAKAIPLRRLADPLEVGELAAFLASDESSYLTGTQNVIDGG-------------------
FABL_BACSU      EDARQNTPAGRMVEIKDMVDTVEFLVSSKADMIRGQTIIVDGG-------------------
UCPA_ECO57      TEMAKAIPLRRLADPLEVGELAAFLASDESSYLTGTQNVIDGG-------------------
UCPA_ECOLI      TEMAKAIPMRRLADPLEVGELAAFLASDESSYLTGTQNVIDGG-------------------
HDHA_ECOLI      KMLQH-TPIRRLGQPQDIANAALFLCSPAASWVSGQILTVSGG-------------------
HDHA_ECO57      KMLQH-TPIRRLGQPQDIANAALFLCSPAASWVSGQILTVSGG-------------------
SOU1_CANAL      KWWQL-TPLGREGLPQELVGAYLYLASNASTYTTGSNIAVDGGY------------------
YKVO_BACSU      ENSRNTVPAGKVGTPEEVANAVSFLASDESSYLTGVELFVDGG-------------------
YHDF_BACSU      KQHGLDTPMGRPGQPVEHAGAYVLLASDESSYMTGQTIHVNGG-------------------
FABG_CHLTR      K-NEWGVPLGRVGMPEEIAKAALFLASDGSSYITGQVLSVDGG-------------------
FABG_CHLMU      K-NEWGVPLGRVGTPEEIAMAALFLASNQSSYITGQVLSVDGG-------------------
SPS19_YEAST     K-ALAKIPLQRLGSTRDIAESTVYIFSPAASYVTGTVLVVDGGMWHLG--------------
YGHA_ECOLI      PQFGQQTPMKRAGQPAELAPVYVYLASQESSYVTAEVHGVCGGEH-----------------
YGHA_ECO57      PQFGQQTPMKRAGQPAELAPVYVYLASQESSYVTAEVHGVCGGEH-----------------
MTDH_UROFA      DFQADGVPLKRFAEPEEMAGQAILLLSPKASYMTGGEYFVDGG-------------------
DCXR_BOVIN      KAMLDRIPLGRFAEVENVVDTILFLLSDRSSMTTGSTVPVDGGF------------------
CBR2_PIG        RKLKERHPMRKFAEVEDVVNSILFLLSDRSASTSGSSIFVDAGY------------------
VER1_ASPPA      NGETFTSPLNRVGLPVDVARVVSFLASDTAEWVSGKIIGVDGG-------------------
THR1_GLOLA      --------------------------------------------------------------
FABG_SHIFL      A----QVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGGMYMV---------------
FABG_ECOLI      A----QVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGGMYMV---------------
STCU_EMENI      NGETFTSPLNRVGLPVDVARVVSFLASDAAEWISGKIIGVDGG-------------------
YHXC_BACSU      ---GSDVPMERPGQPVEVAPSYLYLASDDSTYVTGQTIHVNGG-------------------
FABG_VIBHA      TLS--NVPAGRLGDPREIASAVVFLASPEAAYITGETLHVNGGMYMV---------------
YJGI_ECOLI      ---HSLMAIKRHGQPEEVAGMVAWLAGPEASFVTGAMHTIDGAF------------------
YXBG_BACSU      KW---ITPLGRLGQPKEMATVALFLASDDSSYVTGEDITADGG-------------------
YQC8_SCHPO      QWEPY-VPFKRLGLTPELRGTYLYLASNASSFVTGLDLIVDGGY------------------
HSD_STREX       EGNYPNTPMGRVGNEPEIAGAVVKLLSDTSSYVTGAELAVDGGWTT----------------
CBR2_MOUSE      KLKERH-PLRKFAEVEDVVNSILFLLSDRSASTSGGGILVDAGY------------------
YVRD_BACSU      KVNEPTSLIQRYATAEEVANTIVFLASDAASAINGTAQRVEGG-------------------
GNO_GLUOX       DWLCKRTPAGRWGQVEELVGAAVFLSSRASSFVNGQVLMVDGG-------------------
DECR2_RAT       KFKYLSSPIPRLGTKTEIAHSVLYLASPLASYVSGIVLVVDGG-------------------
DECR2_HUMAN     STKVTASPLQRLGNKTEIAHSVLYLASPLASYVTGAVLVADGG-------------------
BACC2_BACSU     KEKAKVNPLLRLGKPEEIANVMLFLASDLSSYMTGSAITADGGY------------------
Y4VI_RHISN      R----RVPLGRIARPDEIARAVRFLASAQASYITGSTLVVDGGWMSV---------------
FABG_MYCTU      QGALQFIPAKRVGTPAEVAGVVSFLASEDASYISGAVIPVDGG-------------------
FABG_MYCS2      GALDF-IPAKRVGTAEEVAGAVSFLASEDASYIAGAVIPVDGG-------------------
FABG_MYCBO      QGALQFIPAKRVGTPAEVAGVVSFLASEDASYISGAVIPVDGG-------------------
FABG_BUCAI      --QKYNIPMKRFGQKEEVADAVIFLASKKASYITGHTLHVNGGMYMI---------------
FABG_BUCBP      K-----IPMKRLGTIKEISKITLFLISNDANYITGQVIHVNGGMY-----------------
DECR2_PONAB     STKVTASPLQRLGNKTEIAHSVLYLASPLASYVTGAVLVADGG-------------------
ARDH_PICST      EAWESKIPMKRMAEPKEFVGSILYLASEASSYTTGHNLVVDGGY------------------
ARDH_CANAL      EW-ESKIPMKRMAEPKEFVGSILYLASEASSYTTGHNLVVDGGY------------------
SOU2_CANAL      KWLQL-TPLGREAKPRELVGXXXXXXXXXXXXTTGADLAVDGGYTVV---------------
FIXR_BRAJA      -----SIPLRRVGTPDEVAKVIFFLCSDAASYVTGAEVPINGGQH-----------------
YHXD_BACSU      KFGQGTAPLNRAGQPVELADVYVFLASENSSYVTSQVYGITGGIPT----------------
Y1385_MYCBO     KLAE--VPMGRAGEPSEVASVAVFLASDLSSYMTGTVLDVTGG-------------------
Y1350_MYCTU     KLAE--VPMGRAGEPSEVASVAVFLASDLSSYMTGTVLDVTGG-------------------
CBR4_DANRE      ----RTIPLGRFGEPAEVAQAMLFLLE--SPYITGQILLVDGG-------------------
DHRS4_RABIT     ENIIQKLRIRRLGKPEECAGIVSFLCSEDASYITGETVVVAGG-------------------
DCXR_HUMAN      KTMLNRIPLGKFAEVEHVVNAILFLLSDRSGMTTGSTLPVEGGF------------------
GS39_BACSU      QFGQDTPMGRPGQPVEHVGCYVL-LASDESSYMTGQTLHVNGG-------------------
FABG_SALTY      A----QVPAGRLGGAQEIASAVAFLASDEASYITGETLHVNGGMYMV---------------
FABG_SALTI      A----QVPAGRLGGAQEIASAVAFLASDEASYITGETLHVNGGMYMV---------------
KDUD_BACSU      KRNEKRIPAGRWGQADDIGGTAVFLASRASDYVNGHILAVDGGW------------------
GRDH1_ARATH     NFGS-EVPMKRAGQPIEVAPSYVFLCNHCSSYFTGQVLHPNGG-------------------
FABG_AQUAE      QKYKEQIPLGRFGSPEEVANVVLFLCSELASYITGEVIHVNGG-------------------
YOHF_ECOLI      PDAEPSIPLRRFGATHEIASLVVWLCSEGANYTTGQSLIVDGGF------------------
NODG_AZOBR      ---TDSVPMKRLGRPDEIGGAVSYLASEIAGYVTGSTLNINGG-------------------
DCXR_RAT        KVMLDRIPLGKFAEVENVVDTILFLLSNRSSMTTGSALPVDGGF------------------
Y182_METEA      AGSEMEAPLGRSGQPDDIAGVVAFLASDDARWVTGEVINASGG-------------------
FABG_MYCAV      GALEF-IPAKRVGTAAEVPGAVSFLASEDASYIAGAVIPVDGG-------------------
FABG_HAEIN      S----NVPAGRLGEAKDIAKAVAFLASDDAGYITGTTLHVNGGLY-----------------
FABG_CHLPN      EWLK-SIPLGRAGTPEDVARVALFLASQLSSYMTAQTLVVDGG-------------------
ARDH_CANTR      EW-ESKIPMKRMAEPKEFVGSILYLASDASSYTTGHNLVVDGGY------------------
Y2049_STAEQ     --------------------------------------------------------------
Y2036_STAES     --------------------------------------------------------------
MTDH_ALTAL      KLWHSMIPMGRDAKATELKGAYVYFASDASSYCTGSDLLIDGGY------------------
DCXR_MESAU      KVMLDRIPLGKFAEVENVVDAILFLLSHRSNMTTGSTLPVDGGF------------------
FABG_VIBCH      TLAQ--VPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMYMI---------------
DCXR_CAEEL      KMLD-RMPIKRFAEVDEVVNAVLFLLSDNASMTTGSTLPVDGGF------------------
MTDH_CLAHE      LWHSM-IPMGRDGLAKELKGAYVYFASDASTYTTGADLLIDGGYTT----------------
GRDH2_ARATH     QFGS-ETPMKRAAQPVEVAPSYVFLCNHCSSYYTGQILHPNGG-------------------
Y2567_STAAR     ---TYNPTDRKKLEPQDIAEAVLYALTQPKHVNVNEI-------------------------
FABG_BUCAP      KKHLSKIPMKRIGTAEEIANAVIFLSSEKASYITGQTIHVNGGMY-----------------
DHSO_RHOSH      RGEKKRVPFGRMGRAEDLTGMAIFLATPEADYIVAQTYNVDGG-------------------
DER_CHICK       NWSDNRIPLGKFAEVDDVVNSILFLLSDKSAMTTGSSLMVDGGF------------------
DECR2_MOUSE     KLKHFSNPIPRLGTKTEIAHSVLYLASPLASYVSGIVLVVDGG-------------------
DCXR_MOUSE      KAMLDRIPLGKFAEVENVVDTILFLLSNRSGMTTGSTLPVDGGF------------------
CBR4_XENTR      M-----VPLGRFGDPEEVAQSVLFLLE--SPYITGHVLVVDGG-------------------
Y2478_STAAM     ----YNPSDRKKLDPQDIAEAVLYALTQPKHVNVNEI-------------------------
Y2266_STAAN     ----YNPSDRKKLDPQDIAEAVLYALTQPKHVNVNEI-------------------------
T4HR_MAGGR      EVDEYAAPLHRVGLPIDIARVVCFLASNDGGWVTGKVIGIDGG-------------------
DECR2_DANRE     AGAFHSIPLQRAGNKTEMAHAVLFLASRASSYVTGSVLVADGG-------------------
CBR4_XENLA      KEDSLNIPLGRFGEPEEVAQSVLFLLE--SPYITGHVLVVDGG-------------------
DCXR_TRIRE      LWRSM-IPMGRNGDAKELKGAYVYLVSDASSYTTGADIVIDGGYTT----------------
FABG_STAES      MLEQI--PLKRFGEDTDIANTVAFLASDKAKYITGQTIHVNGGMY-----------------
FABG_STAEQ      MLEQI--PLKRFGEDTDIANTVAFLASDKAKYITGQTIHVNGGMY-----------------
YQJQ_BACSU      --------------------------------------------------------------
YGFF_ECOLI      RVKS-NIPMQRGGQAEEVAQAIVWLLSDKASYVTGSFIDLAGG-------------------
Y325_THEMA      KKMTSRIPMKRLGKXXXXXXXXXXXXCDEAGFMTGSIINIDGG-------------------
Y2778_STAA8     ----YNPTDRKKLEPQDIAEAVLYALTQPKHVNVNEI-------------------------
Y2488_STAAC     ----YNPTDRKKLEPQDIAEAVLYALTQPKHVNVNEI-------------------------
Y2422_STAA3     ----YNPTDRKKLEPQDIAEAVLYALTQPKHVNVNEI-------------------------
Y2403_STAAW     ----YNPSDRKKLDPQDIAEAVLYALTQPSHVNVNEI-------------------------
Y2370_STAAS     ----YNPSDRKKLDPQDIAEAVLYALTQPSHVNVNEI-------------------------
GRDH_DAUCA      QFGS-EVPMKRAGQPYEIATAYVFLASCDSSYYSGQVLHPNGG-------------------
DECR_MOUSE      KEMIDRIPCGRLGTMEELANLATFLCSDYASWINGAVIRFDGG-------------------
DECR_HUMAN      KEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGG-------------------
FABG_PSEAE      LLGQ--IPLGRLGQAEEIAKVVGFLASDGAAYVTGATVPVNGGMY-----------------
DECR_RAT        KDMIERIPCGRLGTVEELANLATFLCSDYASWINGAVIRFDGG-------------------
GRDH_ORYSJ      RQFGSQVPMGRAGQPSEVAPSFVFLASDDASYMSGQMLHVNGG-------------------
CBR4_MOUSE      KEEHFNIPLGRFGETLEVAHAVVFLLE--SPYITGHVLIVDGG-------------------
CBR4_BOVIN      K---KNIPLGRFGDALDVAQAAVFLLE--SPYVTGHVLVVDGG-------------------
YJDA_BACSU      ---SPKFPMGRIGTPDDAARMIAFLASDEAEWITGQIIHSEGGF------------------
Y4MP_RHISN      K----GIPLSRLGDARDVANIYLFLASDLSAYVTGAVIDVNGG-------------------
ACR1_ACIBI      ----------PTLSPEEAADLIVYAIVKRPTRIATHLGRLASITYAI------APDIN----
BDHA_RHIME      EVMLKGQPTKKFITVEQVASLALYLAGDDAAQITGTHVSMDGGW------------------
BACC_BACSU      KEKAKVNPLLRLGKPEEIANVMLFLASDLSSYMTGSAITADGGY------------------
HCDR_XANP2      DQVLARIPQKEIGTAAQVADAVMFLAGEDATYVNGAALVMDGAYTAI---------------
ACR1_ACIAD      --------------------------------------------------------------
YWC4_CAEEL      EKMKFLNPEGRVGSPEEVANLVAFISSDHMSFLNGAIIDLDGG-------------------
DHRS2_HUMAN     HGNEEHHQLQRIGESEDCAGIVSFLCSPDASYVNGENIAV-AGYST----------------
MTDH_AGABI      DHQASNIPLNRFAQPEEMTGQAILLLSDHATYMTGGEYFIDGG-------------------
HCDS_XANP2      KY-----PMGRFGTPEDIAEAAVFLLSTKAAFVTGSVLAVDGGMTAI---------------
FABG_THEMA      ALSRI--PLGRFGKPEEVAQVILFLASDESSYVTGQVIGIDGG-------------------
YMFI_BACSU      KEEADEIPIGRLARPQEIADATAFLLSEKASYITGQILSVNGGWH-----------------
YAY8_SCHPO      LSDQ--VPLGRMGQPVEVASCYLFLACSDGGYMTGQTLHPNGG-------------------
PHBB_RALEH      DKIVATIPVKRLGLPEEIASICAWLSSEESGFSTGADFSLNGGLH-----------------
DHG2_BACSU      --------------------------------------------------------------
DHB14_HUMAN     REGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKAVDAPDI-----
BAIA1_EUBSP     EDYLKTLPMKRMLKPEEIANVYLFLASDLASGITATTISVDGAY------------------
LINC_PSEPA      PYLNSIHPIGRFSEPHEQAQAAVWLLSDAASFVTGSCLAADGGFTAI---------------
FABI_RHIME      --------------------------------------------------------------
FABG_SCHPO      AIAEKKVPIGRLASTDEIVDACTFLLDN----------------------------------
BDH2_MOUSE      KTFLNRQKTGRFASAEEVALLCVYLASDESAYVTGNPVIIDGGW------------------
TRN2_HYONI      NLDKLRCALRRMGEPKELAAVVAFLCFPAASYVTGQIIYVDGGFMANG--------------
FABG_RICBR      K-GTYGMP-------EDIANAVAFLASKQSSYITGQTLHVNGG-------------------
TRNH_DATST      ESLIGRAPMKRAGEPSEVSSLVTYLCLPTASYITGQIICVDGGYTVNG--------------
DHRS4_BOVIN     -WEDRQESIKATFQIKRIGKPVSFLCSEDASYITGETVVVAGG-------------------
BAIA2_EUBSP     EGYLKALPMKRMLEPEEIANVYLFLASDLASGITATTVSVDGAY------------------
YXEK_CAEEL      DAMKASVPVGRLGHPEEIANLAAFMSSDFMSWMNGAIIDFDGGQQHI---------------
YVX3_CAEEL      KMKELN-PEGRSGTPEEVANLVAFISSDHMSFMNGVIIDLDGG-------------------
PECR_PONAB      EESFQKIPAKRIGVPEEVSSVVCFLLSPAASFITGQSVDVDGGLYTHSYEIPDAGDLSVVK-
NODG_RHIS3      KQKEAAIPTRRMGTSVEVASAVAYLASNEAAYVTGQTIHVNGG-------------------
DCXR_CAVPO      KAMLDRIPLGKFAEVENVVDTILFLLSNRSGMTTGSTLPVDGGF------------------
BACC_BACAM      KEKAKVNPLLRLGKPEEIANVMLFLASDLSSYMTGSAITADGGY------------------
PECR_HUMAN      EGSFQKIPAKRIGVPEEVSSVVCFLLSPAASFITGQSVDVDGG-RSLYTHSYEVPD------
HSD_MYCTU       --DIFQTALGRAAEPVEVSNLVVYLASDESSYSTGAEFVVDGG-------------------
HSD_MYCBO       --DIFQTALGRAAEPVEVSNLVVYLASDESSYSTGAEFVVDGG-------------------
BDH2_BOVIN      KTGRF-------ATAEEVALLCVYLASDESAYITGNPVIIDGGW------------------
PECR_RAT        AFE--NIPAKRVGLPEEISPLVCFLLSPAASFITGQLINVDGG-------------------
DHRS4_RAT       KEKAREEMIKETMQIRRLGKPVSFLCSEDASYINGETVVVGGG-------------------
CBR4_RAT        ---KKNIPLGRFGEALEVAHAVVFLLE--SPYITGHVLIVDGG-------------------
Y4LA_RHISN      RHLSRHQLLPRVGHPEDVAALVAFLLSDDASFITGQVVCIDGG-------------------
PECR_MOUSE      FEMAFDSPAKRLGVPEEISPLVCFLLSPAASYITGQLINVDGGQHAFSIPPVGAGDLSIVK-
FABG1_SYNY3     QF----IPLARYGQPEEVAGTIRFLATDPAAAITGQTFNVDGG-------------------
BDH2_HUMAN      RGNPEEARLKRQATAEEIAMLCVYLASDESAYVTGNPVIIDGGW------------------
YLX6_SCHPO      RW----YPVGRLGTPEDVARAVIFLADSKNSFITGTTLYVDGG-------------------
TRN2_DATST      NLNKLRCALRRMGEPKELAAMVAFLCFPAASYVTGQIIYVDGG-------------------
HDHA_CLOSO      KSFLSHVPLNRIGNPEDIANSVLFFVSEDSSYITGSILEVSGGYN-----------------
YXJF_BACSU      EQVIFPVPQKRLLSVKEIADYAVFLASEKAKGVTGQAVVLDGGY------------------
PECR_CAVPO      FADAFQKPAKRLGVPEEVSSLVCFLLSPAASFITGQLVNVDGG-QSLYCQNHDIPD------
LVR_LEIAQ       PENPRKAPSKRYGEAPEIAAVVAFLLSDDASYVNATVVPIDGG-------------------
DHRS4_PIG       --------------------------------------------------------------
ACT3_STRCO      IWETARVPIGRYVQPSEVAEMVAYLIGPGAAAVTAQALNVCGG-------------------
PGDH_BOVIN      KYIEYMGPIK----------------------------------------------------
FABG_STAAW      EQMLTQIPLARFGQDTDIANTVAFLASDKAKYITGQTIHVNGGMY-----------------
FABG_STAAS      EQMLTQIPLARFGQDTDIANTVAFLASDKAKYITGQTIHVNGGMY-----------------
FABG_STAAR      EQMLTQIPLARFGQDTDIANTVAFLASDKAKYITGQTIHVNGGMY-----------------
FABG_STAAN      EQMLTQIPLARFGQDTDIANTVAFLASDKAKYITGQTIHVNGGMY-----------------
FABG_STAAM      EQMLTQIPLARFGQDTDIANTVAFLASDKAKYITGQTIHVNGGMY-----------------
FABG_STAAC      EQMLTQIPLARFGQDTDIANTVAFLASDKAKYITGQTIHVNGGMY-----------------
FABG_CUPLA      KKILETIPLGRYGQPEEVAGLVEFLINPASSYVTGQVFTIDGG-------------------
FABG_BACSU      K----QIPLARFGEPSDVSSVVTFLASEGARYMTGQTLHIDGG-------------------
CBR4_HUMAN      K----NIPLGRFGETIEVAHAVVFLLE--SPYITGHVLVVDGGLQLI---------------
CPNA_COMTE      RALLGPTLLGRAAQPMEVSQAVLFLVSDEASFVHGSELVVDGGY------------------
CPNA_COMS9      RALLGPTLLGRAAQPMEVSQAVLFLVSDEASFVHGSELVVDGGY------------------
Y2146_BRAJA     RRHQL---LPRVGRPEDVAALVAFLLSDDAAFITGQVVCIDGG-------------------
Y048_HAEIN      RANKINTPMGRFGESEELLGALLFLIDEYSAFVNGVVLPVDGGF------------------
FADH_BACSU      ARTMNSVPLGRLGTPEEIAALAAFLLSDEASYINGDCITMDGG-------------------
DHRS4_MOUSE     DFIKEAMQIRRLGKPEDCAGIVSFLCSEDASYINGETVVVGGG-------------------
TRNH1_ARATH     KVVISRKPLGRFGEPEEVSSLVAFLCMPAASYITGQTICVDGG-------------------
PGDH_CAVPO      PYIEYTGHIK----------------------------------------------------
SDR1_PICAB      EAGVKSNPFERLGKVEDVAPLVAFLASDEGEWVNAQVVRVNGG-------------------
LIMC_RHOER      ASTTTNALPIPWVESVDVSNALLFLVSEDARYITGAAIPVDAG-------------------
DRS7B_XENTR     --------------------------------------------------------------
DHRS4_PONAB     MDKEKEESMKETLRIRRLGE------------------------------------------
DHRS4_HUMAN     MDKEKEESMKETLRIRRLGE------------------------------------------
TRN1_DATST      K-----TPMGRAGKPQEVSALIAFLCFPAASYITGQIIWADGGFTANG--------------
PTR1_LEITA      VQEDYKVPLQRNSSAEEVSDVVIFLCSPKAKYITGTCIKVDGGY------------------
YUXG_BACSU      SWREERAAAKRTALLEDIAEAIAFFASSKAEKTTGCMITVDGG-------------------
PGDH_MOUSE      QYIEYKDQIK----------------------------------------------------
PGDH_MACFA      QYIEYKDHIK----------------------------------------------------
PGDH_HUMAN      QYIEYKDHIK----------------------------------------------------
DHB14_BOVIN     --------------------------------------------------------------
RHLG_PSEAE      EADSASIPMGRWGRPEEMAALAISLAGTAGAYMTGNVIPIDGGFH-----------------
PTR1_LEIMA      VWEGHRSKVQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGY------------------
NODG_RHIME      KQKEVAIPIHRMGTGTEVASAVAYLASDHAAYVTGQTIHVNGG-------------------
RIDH_KLEAE      --------------------------------------------------------------
UXUB_BACSU      HKIIAGTPMKRFGKPEDLLGTLLWLADEYSGFVTGITVPVDGGF------------------
SOU1_SCHPO      KWKEYT-PQARIGLPDELPGAYLYLASDASSYCTGSDIIVDGGY------------------
SORD_KLEPN      AWTRKNAPIGRAGKLSEVADFVCYLLSARASYITGVTTNIAGG-------------------
DR4L2_HUMAN     --------------------------------------------------------------
DHK2_STRVN      EHVRQTTPLRRTGRPEDVAEAVLGLVR--ATYTTGQVLLVDGGAHLL---------------
DHR11_HUMAN     AAATYEQ--MKCLKPEDVAEAVIYVLSTPAHIQIGDI-------------------------
YIV6_YEAST      --------------------------------------------------------------
VIBA_VIBCH      AGDRLGIPLNKIAEPADIAQAVLFLLSDNAGHITLHDLRVDGG-------------------
ABA2_ARATH      NFAAANANLKGVLTVDDVANAVLFLASDDSRYISGDNLMIDGGF------------------
YVAG_BACSU      KENRPTSIIQRLIRPEEIAHFVTFLSSPLSSAINGAALRADGG-------------------
LINX_PSEPA      KQQTSQIPMGKLGDPIDIANGALFLASDEAKYITGVDLPIDGGW------------------
FABG_RICFE      KQREQKIPLGTYGMPEDVANAVAFLASDQASYITGQTIHVNGG-------------------
FABG_RICCN      KQREQKIPLGTYGMPEDVAHAVAFLASDQASYITGQTIHVNGG-------------------
FABG2_SYNY3     EKITKEIPFRRFGKPEEIAWAVAFLLSPVSSYVTGEVLRVNGAHHT----------------
DRS7B_BOVIN     --------------------------------------------------------------
PHAB_PARDE      EGIIPQIPVAAWAEPEEIARCVVFLASEDAGFITGSTHQAPNG-------------------
KDSR_DICDI      --------------------------------------------------------------
FABG_RICPR      KQREQKIPLGTYGIPEDVAYAVAFLASNNASYITGQTLHVNGG-------------------
DHB8_CANFA      DKVIGMIPMGHLGDPEDVADAVTFLASEDSGYITGASVEVTGGLY-----------------
PHAB_ACISR      KSIEAQIPLQRLAAPAEIAAAVMYLVSEHGAYVTGETLSINGGLY-----------------
DHR11_MOUSE     DPGEAAATYEKCLRPEDVAEAVIYVLSTPPHVQVGDI-------------------------
XYLL_PSEPU      DQSLDSSLMKRYGSIDEQVEAILFLASDAASYITG---------------------------
PTMA_CAMCO      FLEKYRCASKGMLDAEDICGTLVFLLSDESKFVTGQTLVVDDGW------------------
YR419_MIMIV     --GSHGVPMKRTGTTNEISPTVLFLADNQSSYITGSTITIDGGY------------------
Y3106_PSEAE     ELDHDQHLVGRVGTVEDVASLVAWLLSEDAGFVTGQEFLVDGG-------------------
FABG_RICTY      KQREQKIPLGTYGIPEDVAYAVAFLASNHASYITGQTLHVNGG-------------------
DHMA_FLAS1      QVLD-EVALGRPGLPEEVATAAVFLAEDGSSFITGSTITIDGG-------------------
YI78_SCHPO      --------------------------------------------------------------
DHR11_BOVIN     -----KDPEKAAATYEDVAEAVIYVLSTPPHVQIGDI-------------------------
Y432_LISMO      --------------------------------------------------------------
PHBB_ZOORA      ERIIPQIPVGRLGEPDEIARIVVFLASDEAGFITGSTISANGG-------------------
ENTA_ECOLI      GFGEQGIPLGKIARPQEIANTILFLASDLASHITLQDIVVDGG-------------------
DHI2_RABIT      --------------------------------------------------------------
H17B6_BOVIN     KWKETPAHIKET--------------------------------------------------
DHG2_BACME      --PEQRADVESMIPMEEIASVAAFLASSQASYVTGITLFADGG-------------------
CMTB_PSEPU      AQRFLDVPMGRVGEIEEVASMVGYLAQPEAAFVTGQVISVNGG-------------------
CMTB_PSEP1      AQRFLDVPMGRVGEIEEVASMVGYLAQPEAAFVTGQVISVNGG-------------------