[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for atum0:AAK86654.1

[Show Plain Result]


## Summary of Sequence Search
    1::140
    6::139     4e-41  60%  143 aa  Y3023_ACIAD RecName: Full=Uncharacterized protein
    7::142     9e-38  52%  142 aa  OHR_XANCH RecName: Full=Organic hydroperoxide resistance protein;
    7::142     9e-38  52%  142 aa  OHR_XANAC RecName: Full=Organic hydroperoxide resistance protein;
    5::140     8e-24  41%  142 aa  OHRL2_STAS1 RecName: Full=Organic hydroperoxide resistance
    5::139     1e-23  39%  142 aa  OHRL2_STAEQ RecName: Full=Organic hydroperoxide resistance
    5::139     1e-23  39%  142 aa  OHRL2_STAES RecName: Full=Organic hydroperoxide resistance
    1::138     2e-23  41%  141 aa  OHRL1_STAS1 RecName: Full=Organic hydroperoxide resistance
    5::140     7e-23  47%  141 aa  OHRA_BACSU RecName: Full=Organic hydroperoxide resistance protein
    3::135     2e-22  43%  136 aa  OHRB_BACSU RecName: Full=Organic hydroperoxide resistance protein
    1::136     3e-20  38%  140 aa  OHRL1_STAES RecName: Full=Organic hydroperoxide resistance
    1::136     3e-20  38%  140 aa  OHRL1_STAEQ RecName: Full=Organic hydroperoxide resistance
    1::136     9e-20  37%  140 aa  OHRL_STAHJ RecName: Full=Organic hydroperoxide resistance
    1::125     7e-19  40%  140 aa  OHRL_STAAW RecName: Full=Organic hydroperoxide resistance
    1::125     7e-19  40%  140 aa  OHRL_STAAS RecName: Full=Organic hydroperoxide resistance
    1::125     7e-19  40%  140 aa  OHRL_STAAN RecName: Full=Organic hydroperoxide resistance
    1::125     7e-19  40%  140 aa  OHRL_STAAM RecName: Full=Organic hydroperoxide resistance
    1::125     7e-19  40%  140 aa  OHRL_STAAC RecName: Full=Organic hydroperoxide resistance
    1::125     7e-19  40%  140 aa  OHRL_STAA8 RecName: Full=Organic hydroperoxide resistance
    1::125     7e-19  40%  140 aa  OHRL_STAA3 RecName: Full=Organic hydroperoxide resistance
    1::125     1e-18  40%  140 aa  OHRL_STAAR RecName: Full=Organic hydroperoxide resistance
    1::125     1e-18  40%  140 aa  OHRL_STAAB RecName: Full=Organic hydroperoxide resistance
    1::126     7e-12  32%  140 aa  OHRL_MYCPN RecName: Full=Organic hydroperoxide resistance
    1::126     1e-09  32%  140 aa  OHRL_MYCGE RecName: Full=Organic hydroperoxide resistance
   41::132     6e-08  31%  143 aa  OSMC_SHIFL RecName: Full=Peroxiredoxin osmC;       
   41::132     6e-08  31%  143 aa  OSMC_ECOLI RecName: Full=Peroxiredoxin osmC;       
    1::140

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MPILYTTKASATGGRAGNAKSEDGVLDVTLTVPKELGGDGARGTNPEQLFAAGYSACFLGALKAVAGKHK
Y3023_ACIAD     --VVYTAHAKATGGRDGRATSSDNILDVQLTVPKEMGGMGG-GTNPEQLFAAGYSACFLGAMKFVATRDK
OHR_XANCH       --VLYTAHATATGGREGRAVSSDKALDAKLSTPRELGGAGGDGTNPEQLFAAGYAACFIGAMKAVAAQDK
OHR_XANAC       --VLYTAHATATGGREGRAVSSDKALDAKLSTPRELGGAGGDGTNPEQLFAAGYAACFIGAMKAVAAQDK
OHRL2_STAS1     ---LYETKVISNGGRDGKVFSEDNTFYQDLAVPKEMGGNGVTESNPEQLFAAGYSACFNNALMHIL-KSD
OHRL2_STAEQ     ---IYSTTMISNGGRDGRVFSPDNTFVQSLATPKEMGGQGGNDTNPEQLFAAGYSACFNSALSLILSQNK
OHRL2_STAES     ---IYSTTMISNGGRDGRVFSPDNTFVQNLATPKEMGGQGGNDTNPEQLFAAGYSACFNSALSLILSQNK
OHRL1_STAS1     MAVNYETKATNTGGRNGHVQTDDKAIDVAIVPPAQ--ADAEKGTNPEQLFAAGYASCFNGAFDLILKQNK
OHRA_BACSU      ---LFTATVSAVGGREGKVISSDRVLELDVAMPKKL----EKATNPEQLFAAGYAACFDSALQLVARTER
OHRB_BACSU      ---LFTAKVTARGGRAGHITSDDGVLDFDIVMPNAKK-EGQTGTNPEQLXXXXXXXXXXXXLEHVAKEQN
OHRL1_STAES     MAVQYETKATNVGGRKGHVHTDDNAINVDVLPPQQADG---KATNPEQLFAAGYASCFNGAFDLILKQNK
OHRL1_STAEQ     MAVQYETKATNVGGRKGHVHTDDNAINVDVLPPQQADG---KATNPEQLFAAGYASCFNGAFDLILKQNK
OHRL_STAHJ      MAVQYETKATNVGGRKGHVNTDDNAINVDVLPPQQADGNA---TNPEQLFAAGYASCFNGAFDLILKQNK
OHRL_STAAW      MAIHYETKATNVGGRKGHVYTDDRALDIDIVSPAQADG---KATNPEQLFAAGYASCFNGAFDLILKQNK
OHRL_STAAS      MAIHYETKATNVGGRKGHVYTDDRALDIDIVSPAQADG---KATNPEQLFAAGYASCFNGAFDLILKQNK
OHRL_STAAN      MAIHYETKATNVGGRKGHVYTDDRALDIDIVPPAQADG---KATNPEQLFAAGYASCFNGAFDLILKQNK
OHRL_STAAM      MAIHYETKATNVGGRKGHVYTDDRALDIDIVPPAQADG---KATNPEQLFAAGYASCFNGAFDLILKQNK
OHRL_STAAC      MAIHYETKATNVGGRKGHVYTDDRALDIDIVPPAQADG---KATNPEQLFAAGYASCFNGAFDLILKQNK
OHRL_STAA8      MAIHYETKATNVGGRKGHVYTDDRALDIDIVPPAQADG---KATNPEQLFAAGYASCFNGAFDLILKQNK
OHRL_STAA3      MAIHYETKATNVGGRKGHVYTDDRALDIDIVPPAQADG---KATNPEQLFAAGYASCFNGAFDLILKQNK
OHRL_STAAR      MAIHYETKATNVGGRKGHVYTDDRALDIDIVPPAQADG---KATNPEQLFAAGYASCFNGAFDLILKQNK
OHRL_STAAB      MAIHYETKATNVGGRKGHVYTDDRALDIDIVPPAQADG---KATNPEQLFAAGYASCFNGAFDLILKQNK
OHRL_MYCPN      MAVIYKTTAHASAGREGVVQTVDG-FTVSLAFPKP-GATHQDKNNPEQLFASAYAGCFSXXXXXXXXXXX
OHRL_MYCGE      MALIYKTVAQTETGREGSVKTLDG-FQTKLSFPKP---DLSVQTNPEQLFASAYASCFSQAVIVVMQQHQ
OSMC_SHIFL      --------------------------------------EGEKGTNPEELIGAAHAACFSMALSLMLGEAG
OSMC_ECOLI      --------------------------------------EGEKGTNPEELIGAAHAACFSMALSLMLGEAG


                         .         .         *         .         .         .         .:140
query           VKIPEDTTVTATVGIGPREDGTGFGIEVTLKVNIPGLEREKAEELVAAAHIVCPYSHAMRTSTEVPVSVA
Y3023_ACIAD     FNIPKDAYVEGDVGIGPIPN--GFGIEVKLHVHLPGMDTDEAKKLVDAAHIVCPYSNATRNNIDVDFEI-
OHR_XANCH       LKLPGEVSIDSSVGIG--QIPGGFGIVVELRIAVPGMDKAELQTLVDKAHQVCPYSNATRGNIDVTLTLA
OHR_XANAC       LKLPGEVSIDSSVGIG--QIPGGFGIVVELRIAVPGMDKAELQTLVDKAHQVCPYSNATRGNIDVTLTLA
OHRL2_STAS1     SKGTIEPEVSVTAYLLPDKNDGGVKLAAELDVTLTDMTQEEAETYVEKAHNYCPYSKALKESIDIEIQVS
OHRL2_STAEQ     IS-DANPEVEITIELLKDDTDNGFKLGADIKVTLENMSQQDAEKFVEQAHQFCPYSKATRGNIDVQLDV-
OHRL2_STAES     IS-DANPEVEITIELLKDDTDNGFKLGADIKVTLENMSQQDAEKFVEQAHQFCPYSKATRGNIDVQLDV-
OHRL1_STAS1     VRGAEEVTLTVRLEDDPEAESPKLSVSIDAKVNV--LSQEEAEKYLQDAHEFCPYSKATRGNIEVDLNVA
OHRA_BACSU      VKV--ETEVTANVSLLKDEADQGYKLGVTLQVKGEGVSASELEALVKKAHGVCPYSKATSGNIDVTLEVA
OHRB_BACSU      IEI--DSEIEGQVSLMKDESDGGFKIGVTLVVNTKDLDREKAQELVNAAHEFCPYSKATRGNVDVKLEL-
OHRL1_STAES     VRDAEEVTLTVRLEDDPDAESPKLSVDIHAKVNV--LSQEDAEKYLQDAHDFCPYSKATRGNIDVNLNV-
OHRL1_STAEQ     VRDAEEVTLTVRLEDDPDAESPKLSVDIHAKVNV--LSQEDAEKYLQDAHDFCPYSKATRGNIDVNLNV-
OHRL_STAHJ      VRDAEEVTLTVRLEDDPDAESPKLSVAIDAKVNV--LSQEDAEKYLQDAHEFCPYSKATRGNIDVDLNL-
OHRL_STAAW      VR-DAHPEVTLTVRLEDDSDSESPKLSVSIDATIKNISQEEAEKYLQMAHEFCPYSKA------------
OHRL_STAAS      VR-DAHPEVTLTVRLEDDSDSESPKLSVSIDATIKNISQEEAEKYLQMAHEFCPYSKA------------
OHRL_STAAN      VR-DAHPEVTLTVRLEDDSDSESPKLSVSIDATIKNISQEEAEKYLQMAHEFCPYSKA------------
OHRL_STAAM      VR-DAHPEVTLTVRLEDDSDSESPKLSVSIDATIKNISQEEAEKYLQMAHEFCPYSKA------------
OHRL_STAAC      VR-DAHPEVTLTVRLEDDSDSESPKLSVSIDATIKNISQEEAEKYLQMAHEFCPYSKA------------
OHRL_STAA8      VR-DAHPEVTLTVRLEDDSDSESPKLSVSIDATIKNISQEEAEKYLQMAHEFCPYSKA------------
OHRL_STAA3      VR-DAHPEVTLTVRLEDDSDSESPKLSVSIDATIKNISQEEAEKYLQMAHEFCPYSKA------------
OHRL_STAAR      VR-DAHPEVTLTVRLEDDPDSESPKLSVSIDATIKNISQEEAEKYLQMAHEFCPYSKA------------
OHRL_STAAB      VR-DAHPEVTLTVRLEDDPDSESPQLSVSIDATIKNISQEEAEKYLQMAHEFCPYSKA------------
OHRL_MYCPN      XXXXXXPIVGVSVELHD-QDGL-FHIKAGVELAITGVDQTTAQTVITAAHAMCPFSRLIK----------
OHRL_MYCGE      XXXXXXXXXXXXXEL-HQENGL-FHIKAGVELTTNSNDQEVGKKLIQKAHEMCPFSRLIR----------
OSMC_SHIFL      F---TPTSIDTTADVSLDKVDAGFAIKIALKVAVPGIDASTFDGIIQKAKAGCPVSQVLK----------
OSMC_ECOLI      F---TPTSIDTTADVSLDKVDAGFAIKIALKVAVPGIDASTFDGIIQKAKAGCPVSQVLK----------