[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for atum0:AAK86734.2

[Show Plain Result]


## Summary of Sequence Search
    1::435
   30::367     3e-53  36%  392 aa  NYLB_FLASK RecName: Full=6-aminohexanoate-dimer hydrolase;       
   30::367     4e-52  35%  392 aa  NYLC_FLASK RecName: Full=6-aminohexanoate-dimer hydrolase;       
   93::237     1e-07  36%  406 aa  DAC_STRSR RecName: Full=D-alanyl-D-alanine carboxypeptidase;       
   35::339     5e-07  29%  377 aa  Y1367_MYCTU RecName: Full=Uncharacterized protein Rv1367c/MT1414;
   83::263     1e-05  27%  379 aa  AMPC_MORMO RecName: Full=Beta-lactamase;       
   41::223     6e-04  30%  392 aa  ESTB_BURGA RecName: Full=Esterase estB;         EC=3.1.1.-;
    1::435

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPKSRWTVCHFRQL
NYLB_FLASK      ---------------------------------------------------------PHNRWAFARLGEL
NYLC_FLASK      ---------------------------------------------------------PHNRWAFAHLGEM
DAC_STRSR       ----------------------------------------------------------------------
Y1367_MYCTU     ----------------------------------------------------------------------
AMPC_MORMO      ----------------------------------------------------------------------
ESTB_BURGA      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           MPTVNVSRGLGAPAALERKLDPAMDAVTFRPTGADQDMTWLQSLSANYTDGIVVLHKGVLVYERYSGCLN
NYLB_FLASK      LPTAAVSRRDPATPA-----EPVLDALATRLPDLEQ------RLEETCTDAFLVLRGSEVLAEYYRAGFA
NYLC_FLASK      VPSAAVSR---------RPVNAPGHALARLGAIAAQLPDLEQRLEQTYTDAFLVLRGTEVVAEYYRAGFA
DAC_STRSR       ----------------------------------------------------------------------
Y1367_MYCTU     ----------------------------------------------------------------------
AMPC_MORMO      ----------------------------------------------------------------------
ESTB_BURGA      ----------------------------------------------------IVARHGEILYRRAQGLAD


                         +         .         .         .         .         *         .:210
query           EAGQHGAMSVTKSLTGLLGEMLVAEGTLDENAKVATVVPELEKSAFGDATIRQVLDMTTGLRYSEDYADP
NYLB_FLASK      PDDRHLLMSVSKSLCGTVVGALIDEGRIDPAQPVTEYVPELAGSVYDGPSVLQVLDMQISIDYNEDYVDP
NYLC_FLASK      PDDRHLLMSVSKSLCGTVVGALVDEGRIDPAQPVTEYVPELAGSVYDGPSVLQVLDMQISIDYNEDYVDP
DAC_STRSR       --------SVTKSFSAVVLLQLVDEGKLDLDASVNTYLPGLLPD--DRITVRQVMSHRSGLY---DYTN-
Y1367_MYCTU     --------SMTKPVTVAAAMSLVDEGKLALRDPITRWAPELCKVAVLDDAIEDLLTHTSGLAYGFSVSGP
AMPC_MORMO      --------SVSKTFTGVLGAVSVAKKEMTLNDPAEKYQPELALPQWKGITL---LDLAT-----------
ESTB_BURGA      EAGRFRLASVTKPIVALAVLRLVARGELALDAPVTRWLPEFRRLADGSVTIHHLLTHTSGLGY-------


                         .         .         .         +         .         .         .:280
query           NADVWIYSAAGNPLPKPDGYEGPRSYFDYLKTVVKQGENGSAFGYKTINSDALGWVIARASGKSVAELLS
NYLB_FLASK      ASEVQTHDRSAGWRTRRDG--DPADTYEFLTTLRGDGGTGE-FQYCSANTDVLAWIVERVTGLRYVEALS
NYLC_FLASK      ASEVQTHGRSAGWRTRATG--DPADTYEFLTTLRGDGSTGE-FQYCSANTDVLAWIVERVTGLRYVEALS
DAC_STRSR       --DMFAQTVPG--------FESVRSYQDLITLSLKHGVTGAAYSYSNTNFVVAGMLIEKLTGHSVATEYQ
Y1367_MYCTU     GPDVWLAALATLPLVHQPGDRVTYSHIDVLGVIVSRIEDAPL--YQIIDERVLGPAGMTDTGFYVSADAQ
AMPC_MORMO      ------YTAGGLPLQVPDAVKSRADLLHFYQQWQPSRKPGDMRLYANSSIGLFGALTANAAGMPYEQLLT
ESTB_BURGA      ----WLLEGAGSVYDRSDGIDLRDFDLDRLASAPLSFAPGSGWQY-SLALDVLGAVVERATGQPLAAAVD


                         .         *         .         .         .         .         +:350
query           QRIWSRIGAEQDAYYTVDSTGTPFAGGGLNAGLRDMARIGQLLLDDGMAGGHRLIPQKAIDNIRHGGDKA
NYLB_FLASK      TYLWAKLDADRDATITVDQTGFGFANGGVSCTARDLARVGRMMLDGGVAPGGRVVSQGWVESVLAGGSRE
NYLC_FLASK      TYLWAKLDADRDATITVDTTGFGFAHGGVSCTARDLARVGRMMLDGGVAPGGRVVSEDWVRRVLAGGSHE
DAC_STRSR       NRIFTPLNL-TDTFYVHPDTVIP-----------------------------------------------
Y1367_MYCTU     RRAATMYRLDEQDRLRHDVMGPPHAGGGLWSTADDYLRFVRMLLGDGTVDGVRVLSPESVDRLTDEQKRH
AMPC_MORMO      ARILAPLGLSHTFITVPESAQSQYAYGGVKSASKDMLRWAEMNMEPSRAG--------------------
ESTB_BURGA      ALVAQPLGMRDCGFVSAE----------------------------------------------------


                         .         .         .         .         *         .         .:420
query           AFAKGGYPALRGWSYRAMWWVTHNANGAFMARGVHGQAIYVDPAADMVIARFSSHPxxxxxxxxxxxxxx
NYLB_FLASK      AMTDEGFSAFPEGSYTRQWWCTGNERGNVSGIGIHGQNLWLDPRTDSVIVKLSSWP--------------
NYLC_FLASK      AMTDKGFTTFPDGSYTRQWWCTGNERGNVSGIGIHGQNLWLDPLTDSVIVKLSSWP--------------
DAC_STRSR       ----------------------------------------------------------------------
Y1367_MYCTU     SFLGAPFWVGRGFGLN-LSVVTDPAKGTFSWPGAYGTWWQADPSADLILLYLIQH---------------
AMPC_MORMO      ----------------------------------------------------------------------
ESTB_BURGA      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxx
NYLB_FLASK      ---------------
NYLC_FLASK      ---------------
DAC_STRSR       ---------------
Y1367_MYCTU     ---------------
AMPC_MORMO      ---------------
ESTB_BURGA      ---------------