[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for atum0:AAK86736.1

[Show Plain Result]


## Summary of Sequence Search
    1::757
   52::597     1e-67  32%  714 aa  PBPF_BACSU RecName: Full=Penicillin-binding protein 1F;       
  186::713     7e-65  34%  777 aa  PBPB_VIBCH RecName: Full=Penicillin-binding protein 1B;       
   60::598     1e-61  33%  624 aa  PBPD_BACSU RecName: Full=Penicillin-binding protein 4;       
   77::610     2e-59  32%  691 aa  PBPG_BACSU RecName: Full=Penicillin-binding protein 2D;       
   64::616     2e-57  32%  914 aa  PBPA_BACSU RecName: Full=Penicillin-binding protein 1A/1B;       
  170::698     1e-53  32%  781 aa  PBPB_HAEIN RecName: Full=Penicillin-binding protein 1B;       
  216::747     2e-51  32%  844 aa  PBPB_ECOLI RecName: Full=Penicillin-binding protein 1B;       
  157::693     1e-50  32%  760 aa  PBPB_BUCAI RecName: Full=Penicillin-binding protein 1B;       
  166::668     1e-50  31%  741 aa  PBPB_BUCBP RecName: Full=Penicillin-binding protein 1B;       
   83::667     5e-46  31%  790 aa  PBPA_CLOTE RecName: Full=Penicillin-binding protein 1A;       
   94::674     5e-45  32%  820 aa  PBPA_CLOPS RecName: Full=Penicillin-binding protein 1A;       
   94::677     1e-43  31%  679 aa  PBPA_CLOPE RecName: Full=Penicillin-binding protein 1A;       
   94::674     2e-43  31%  830 aa  PBPA_CLOP1 RecName: Full=Penicillin-binding protein 1A;       
   49::689     6e-43  39%  726 aa  PBPA_AQUAE RecName: Full=Penicillin-binding protein 1A;       
   96::649     5e-42  31%  809 aa  PBPA_CLOAB RecName: Full=Penicillin-binding protein 1A;       
    3::723     7e-42  35%  798 aa  PBPA_NEIFL RecName: Full=Penicillin-binding protein 1A;       
   71::627     4e-41  32%  830 aa  PBPA_CLOBH RecName: Full=Penicillin-binding protein 1A;       
   71::627     4e-41  32%  830 aa  PBPA_CLOB1 RecName: Full=Penicillin-binding protein 1A;       
   67::551     2e-40  30%  770 aa  PBPC_ECOLI RecName: Full=Penicillin-binding protein 1C;       
   71::627     8e-40  31%  827 aa  PBPA_CLOBL RecName: Full=Penicillin-binding protein 1A;       
   93::654     1e-39  32%  863 aa  PBPA_CLONN RecName: Full=Penicillin-binding protein 1A;       
    8::315     2e-37  33%  798 aa  PBPA_NEILA RecName: Full=Penicillin-binding protein 1A;       
   12::767     5e-37  33%  822 aa  PBPA_PSEAE RecName: Full=Penicillin-binding protein 1A;       
   38::745     7e-37  37%  850 aa  PBPA_ECOLI RecName: Full=Penicillin-binding protein 1A;       
   44::746     9e-37  36%  853 aa  PBPA_HAEIN RecName: Full=Penicillin-binding protein 1A;       
   57::628     1e-36  28%  719 aa  PBPA_STRPN RecName: Full=Penicillin-binding protein 1A;       
  333::768     6e-36  35%  809 aa  PBPA_XYLFA RecName: Full=Penicillin-binding protein 1A;       
   44::708     6e-36  33%  798 aa  PBPA_NEICI RecName: Full=Penicillin-binding protein 1A;       
   57::628     1e-35  28%  719 aa  PBPA_STRR6 RecName: Full=Penicillin-binding protein 1A;       
  333::768     2e-35  36%  809 aa  PBPA_XYLFT RecName: Full=Penicillin-binding protein 1A;       
   55::718     1e-34  36%  825 aa  PBPA_VIBCH RecName: Full=Penicillin-binding protein 1A;       
  373::710     2e-34  33%  798 aa  PBPA_NEIMB RecName: Full=Penicillin-binding protein 1A;       
  373::710     2e-34  33%  798 aa  PBPA_NEIMA RecName: Full=Penicillin-binding protein 1A;       
   77::625     5e-34  28%  637 aa  PBPA_STROR RecName: Full=Penicillin-binding protein 1A;       
   70::333     7e-34  34%  790 aa  PBPA_RICFE RecName: Full=Penicillin-binding protein 1A;       
   44::315     9e-34  32%  798 aa  PBPA_NEIGO RecName: Full=Penicillin-binding protein 1A;       
   44::315     9e-34  32%  798 aa  PBPA_NEIG1 RecName: Full=Penicillin-binding protein 1A;       
   42::333     3e-33  32%  787 aa  PBPA_RICPR RecName: Full=Penicillin-binding protein 1A;       
   70::336     3e-33  34%  790 aa  PBPA_RICCN RecName: Full=Penicillin-binding protein 1A;       
  417::690     3e-33  37%  791 aa  PBPA_RICBR RecName: Full=Penicillin-binding protein 1A;       
  304::690     4e-33  32%  785 aa  PBPA_RICTY RecName: Full=Penicillin-binding protein 1A;       
   48::227     2e-27  37%  231 aa  TRG_RALEH RecName: Full=Putative transglycosylase H16_A0665;       
   64::229     8e-24  31%  230 aa  MTGA_NITMU RecName: Full=Monofunctional biosynthetic peptidoglycan
   61::205     7e-23  38%  224 aa  MTGA_ACIAD RecName: Full=Monofunctional biosynthetic peptidoglycan
   59::208     1e-22  35%  232 aa  MTGA_THIDA RecName: Full=Monofunctional biosynthetic peptidoglycan
   49::155     3e-22  48%  245 aa  MTGA_ALCBS RecName: Full=Monofunctional biosynthetic peptidoglycan
   53::215     1e-21  36%  225 aa  MTGA_ACIBT RecName: Full=Monofunctional biosynthetic peptidoglycan
   65::161     2e-21  47%  231 aa  MTGA_DECAR RecName: Full=Monofunctional biosynthetic peptidoglycan
   53::215     2e-21  36%  225 aa  MTGA_ACIBY RecName: Full=Monofunctional biosynthetic peptidoglycan
   53::215     2e-21  36%  225 aa  MTGA_ACIBS RecName: Full=Monofunctional biosynthetic peptidoglycan
   53::215     2e-21  36%  225 aa  MTGA_ACIBC RecName: Full=Monofunctional biosynthetic peptidoglycan
   53::215     2e-21  36%  225 aa  MTGA_ACIB5 RecName: Full=Monofunctional biosynthetic peptidoglycan
   53::215     2e-21  36%  225 aa  MTGA_ACIB3 RecName: Full=Monofunctional biosynthetic peptidoglycan
   63::259     3e-21  35%  269 aa  MGT_STAAW RecName: Full=Monofunctional glycosyltransferase;        
   63::259     3e-21  35%  269 aa  MGT_STAAT RecName: Full=Monofunctional glycosyltransferase;        
   63::259     3e-21  35%  269 aa  MGT_STAAS RecName: Full=Monofunctional glycosyltransferase;        
   63::259     3e-21  35%  269 aa  MGT_STAAR RecName: Full=Monofunctional glycosyltransferase;        
   63::259     3e-21  35%  269 aa  MGT_STAAN RecName: Full=Monofunctional glycosyltransferase;        
   63::259     3e-21  35%  269 aa  MGT_STAAM RecName: Full=Monofunctional glycosyltransferase;        
   63::259     3e-21  35%  269 aa  MGT_STAAE RecName: Full=Monofunctional glycosyltransferase;        
   63::259     3e-21  35%  269 aa  MGT_STAAC RecName: Full=Monofunctional glycosyltransferase;        
   63::259     3e-21  35%  269 aa  MGT_STAAB RecName: Full=Monofunctional glycosyltransferase;        
   63::259     3e-21  35%  269 aa  MGT_STAA8 RecName: Full=Monofunctional glycosyltransferase;        
   63::259     3e-21  35%  269 aa  MGT_STAA3 RecName: Full=Monofunctional glycosyltransferase;        
   63::259     3e-21  35%  269 aa  MGT_STAA1 RecName: Full=Monofunctional glycosyltransferase;        
   62::218     5e-21  32%  228 aa  MTGA_CHRVO RecName: Full=Monofunctional biosynthetic peptidoglycan
   81::259     5e-21  35%  269 aa  MGT_STAES RecName: Full=Monofunctional glycosyltransferase;        
   81::259     5e-21  35%  269 aa  MGT_STAEQ RecName: Full=Monofunctional glycosyltransferase;        
   62::222     7e-21  35%  233 aa  MTGA_NEIGO RecName: Full=Monofunctional biosynthetic peptidoglycan
   62::222     7e-21  35%  233 aa  MTGA_NEIG1 RecName: Full=Monofunctional biosynthetic peptidoglycan
   53::216     7e-21  36%  225 aa  MTGA_MARMS RecName: Full=Monofunctional biosynthetic peptidoglycan
   59::231     7e-21  34%  242 aa  MTGA_ECOLC RecName: Full=Monofunctional biosynthetic peptidoglycan
   62::222     9e-21  35%  233 aa  MTGA_NEIG2 RecName: Full=Monofunctional biosynthetic peptidoglycan
   60::225     9e-21  34%  230 aa  MTGA_AZOSE RecName: Full=Monofunctional biosynthetic peptidoglycan
   63::259     9e-21  34%  269 aa  MGT_STAA9 RecName: Full=Monofunctional glycosyltransferase;        
   63::259     9e-21  34%  269 aa  MGT_STAA2 RecName: Full=Monofunctional glycosyltransferase;        
   83::259     1e-20  36%  270 aa  MGT_STAHJ RecName: Full=Monofunctional glycosyltransferase;        
   65::161     1e-20  48%  231 aa  MTGA_AZOSB RecName: Full=Monofunctional biosynthetic peptidoglycan
   57::208     2e-20  38%  229 aa  MTGA_SHEDO RecName: Full=Monofunctional biosynthetic peptidoglycan
   81::260     4e-20  35%  270 aa  MGT_STAS1 RecName: Full=Monofunctional glycosyltransferase;        
   78::238     2e-19  32%  244 aa  MTGA_NITEU RecName: Full=Monofunctional biosynthetic peptidoglycan
   71::206     4e-19  35%  229 aa  MTGA_METFK RecName: Full=Monofunctional biosynthetic peptidoglycan
   63::233     6e-19  31%  244 aa  MTGA_PECCP RecName: Full=Monofunctional biosynthetic peptidoglycan
   57::210     8e-19  35%  241 aa  MTGA_PHOLL RecName: Full=Monofunctional biosynthetic peptidoglycan
   56::211     1e-18  34%  231 aa  MTGA_RHOCS RecName: Full=Monofunctional biosynthetic peptidoglycan
   65::225     1e-18  32%  231 aa  MTGA_HERAR RecName: Full=Monofunctional biosynthetic peptidoglycan
   65::161     2e-18  42%  231 aa  MTGA_JANMA RecName: Full=Monofunctional biosynthetic peptidoglycan
   55::165     2e-18  44%  242 aa  MTGA_ECO55 RecName: Full=Monofunctional biosynthetic peptidoglycan
   59::165     4e-18  43%  242 aa  MTGA_SHISS RecName: Full=Monofunctional biosynthetic peptidoglycan
   73::229     4e-18  31%  240 aa  MTGA_BURXL RecName: Full=Monofunctional biosynthetic peptidoglycan
   78::238     5e-18  31%  244 aa  MTGA_NITEC RecName: Full=Monofunctional biosynthetic peptidoglycan
   70::234     5e-18  34%  240 aa  MTGA_BORA1 RecName: Full=Monofunctional biosynthetic peptidoglycan
   59::165     7e-18  43%  242 aa  MTGA_SHIDS RecName: Full=Monofunctional biosynthetic peptidoglycan
   62::222     7e-18  32%  232 aa  MTGA_PSEAE RecName: Full=Monofunctional biosynthetic peptidoglycan
   59::165     7e-18  43%  242 aa  MTGA_ECOSE RecName: Full=Monofunctional biosynthetic peptidoglycan
   59::165     7e-18  43%  242 aa  MTGA_ECOLI RecName: Full=Monofunctional biosynthetic peptidoglycan
   59::165     7e-18  43%  242 aa  MTGA_ECOHS RecName: Full=Monofunctional biosynthetic peptidoglycan
   59::165     7e-18  43%  242 aa  MTGA_ECODH RecName: Full=Monofunctional biosynthetic peptidoglycan
   59::165     7e-18  43%  242 aa  MTGA_ECOBW RecName: Full=Monofunctional biosynthetic peptidoglycan
   59::165     7e-18  43%  242 aa  MTGA_ECO8A RecName: Full=Monofunctional biosynthetic peptidoglycan
   59::165     7e-18  43%  242 aa  MTGA_ECO24 RecName: Full=Monofunctional biosynthetic peptidoglycan
   70::221     9e-18  36%  246 aa  MTGA_PASMU RecName: Full=Monofunctional biosynthetic peptidoglycan
   59::165     9e-18  43%  242 aa  MTGA_ECOUT RecName: Full=Monofunctional biosynthetic peptidoglycan
   59::165     9e-18  43%  242 aa  MTGA_ECOSM RecName: Full=Monofunctional biosynthetic peptidoglycan
   59::165     9e-18  43%  242 aa  MTGA_ECOLU RecName: Full=Monofunctional biosynthetic peptidoglycan
   59::165     9e-18  43%  242 aa  MTGA_ECOL6 RecName: Full=Monofunctional biosynthetic peptidoglycan
   59::165     9e-18  43%  242 aa  MTGA_ECOL5 RecName: Full=Monofunctional biosynthetic peptidoglycan
   59::165     9e-18  43%  242 aa  MTGA_ECOK1 RecName: Full=Monofunctional biosynthetic peptidoglycan
   59::165     9e-18  43%  242 aa  MTGA_ECO81 RecName: Full=Monofunctional biosynthetic peptidoglycan
   59::165     9e-18  43%  242 aa  MTGA_ECO7I RecName: Full=Monofunctional biosynthetic peptidoglycan
   59::165     9e-18  43%  242 aa  MTGA_ECO5E RecName: Full=Monofunctional biosynthetic peptidoglycan
   59::165     9e-18  43%  242 aa  MTGA_ECO57 RecName: Full=Monofunctional biosynthetic peptidoglycan
   59::165     9e-18  43%  242 aa  MTGA_ECO45 RecName: Full=Monofunctional biosynthetic peptidoglycan
   59::165     9e-18  43%  242 aa  MTGA_ECO27 RecName: Full=Monofunctional biosynthetic peptidoglycan
   56::209     1e-17  33%  226 aa  MTGA_NITWN RecName: Full=Monofunctional biosynthetic peptidoglycan
   73::207     2e-17  33%  228 aa  MTGA_LARHH RecName: Full=Monofunctional biosynthetic peptidoglycan
   59::165     2e-17  43%  242 aa  MTGA_SHIBS RecName: Full=Monofunctional biosynthetic peptidoglycan
   62::208     2e-17  35%  226 aa  MTGA_NITHX RecName: Full=Monofunctional biosynthetic peptidoglycan
   56::231     3e-17  31%  235 aa  MTGA_AERHH RecName: Full=Monofunctional biosynthetic peptidoglycan
   60::164     3e-17  41%  241 aa  MTGA_YERP3 RecName: Full=Monofunctional biosynthetic peptidoglycan
   61::241     4e-17  30%  242 aa  MTGA_SALAR RecName: Full=Monofunctional biosynthetic peptidoglycan
   63::159     6e-17  45%  234 aa  MTGA_RALSO RecName: Full=Monofunctional biosynthetic peptidoglycan
   60::154     8e-17  43%  242 aa  MTGA_PSEMY RecName: Full=Monofunctional biosynthetic peptidoglycan
   61::165     8e-17  43%  242 aa  MTGA_KLEOX RecName: Full=Monofunctional biosynthetic peptidoglycan
   57::157     8e-17  43%  250 aa  MTGA_BDEBA RecName: Full=Monofunctional biosynthetic peptidoglycan
   60::164     1e-16  41%  241 aa  MTGA_YERPS RecName: Full=Monofunctional biosynthetic peptidoglycan
   60::164     1e-16  41%  241 aa  MTGA_YERPP RecName: Full=Monofunctional biosynthetic peptidoglycan
   60::164     1e-16  41%  241 aa  MTGA_YERPN RecName: Full=Monofunctional biosynthetic peptidoglycan
   60::164     1e-16  41%  241 aa  MTGA_YERPG RecName: Full=Monofunctional biosynthetic peptidoglycan
   60::164     1e-16  41%  241 aa  MTGA_YERPE RecName: Full=Monofunctional biosynthetic peptidoglycan
   60::164     1e-16  41%  241 aa  MTGA_YERPB RecName: Full=Monofunctional biosynthetic peptidoglycan
   60::164     1e-16  41%  241 aa  MTGA_YERPA RecName: Full=Monofunctional biosynthetic peptidoglycan
   60::164     1e-16  41%  241 aa  MTGA_YERPY RecName: Full=Monofunctional biosynthetic peptidoglycan
   61::241     1e-16  31%  242 aa  MTGA_SALSV RecName: Full=Monofunctional biosynthetic peptidoglycan
   60::154     1e-16  45%  242 aa  MTGA_PSEU5 RecName: Full=Monofunctional biosynthetic peptidoglycan
   87::243     1e-16  31%  256 aa  MTGA_BURTA RecName: Full=Monofunctional biosynthetic peptidoglycan
   81::243     1e-16  39%  256 aa  MTGA_BURPS RecName: Full=Monofunctional biosynthetic peptidoglycan
   73::229     1e-16  30%  240 aa  MTGA_BURPP RecName: Full=Monofunctional biosynthetic peptidoglycan
   79::235     1e-16  30%  246 aa  MTGA_BURP8 RecName: Full=Monofunctional biosynthetic peptidoglycan
   81::243     1e-16  39%  256 aa  MTGA_BURMA RecName: Full=Monofunctional biosynthetic peptidoglycan
   60::164     2e-16  40%  241 aa  MTGA_YERE8 RecName: Full=Monofunctional biosynthetic peptidoglycan
   62::158     2e-16  43%  233 aa  MTGA_NEIM0 RecName: Full=Monofunctional biosynthetic peptidoglycan
   74::169     2e-16  46%  245 aa  MTGA_SHEAM RecName: Full=Monofunctional biosynthetic peptidoglycan
   61::241     2e-16  31%  242 aa  MTGA_SALA4 RecName: Full=Monofunctional biosynthetic peptidoglycan
   54::222     2e-16  30%  236 aa  MTGA_PSE14 RecName: Full=Monofunctional biosynthetic peptidoglycan
   57::214     3e-16  34%  246 aa  MTGA_XANCP RecName: Full=Monofunctional biosynthetic peptidoglycan
   57::214     3e-16  34%  246 aa  MTGA_XANCB RecName: Full=Monofunctional biosynthetic peptidoglycan
   57::214     3e-16  34%  246 aa  MTGA_XANC8 RecName: Full=Monofunctional biosynthetic peptidoglycan
   70::230     3e-16  32%  240 aa  MTGA_HAEIE RecName: Full=Monofunctional biosynthetic peptidoglycan
   64::234     3e-16  29%  245 aa  MTGA_ERWCT RecName: Full=Monofunctional biosynthetic peptidoglycan
   61::165     3e-16  42%  242 aa  MTGA_CITK8 RecName: Full=Monofunctional biosynthetic peptidoglycan
   61::165     4e-16  42%  242 aa  MTGA_SALTY RecName: Full=Monofunctional biosynthetic peptidoglycan
   61::165     4e-16  42%  242 aa  MTGA_SALTI RecName: Full=Monofunctional biosynthetic peptidoglycan
   61::165     4e-16  42%  242 aa  MTGA_SALPB RecName: Full=Monofunctional biosynthetic peptidoglycan
   61::165     4e-16  42%  242 aa  MTGA_SALNS RecName: Full=Monofunctional biosynthetic peptidoglycan
   54::154     4e-16  42%  236 aa  MTGA_PSEU2 RecName: Full=Monofunctional biosynthetic peptidoglycan
    6::102     4e-16  42%  165 aa  MTGA_NEIME RecName: Full=Monofunctional biosynthetic peptidoglycan
   62::158     4e-16  42%  233 aa  MTGA_NEIMB RecName: Full=Monofunctional biosynthetic peptidoglycan
   62::158     4e-16  42%  233 aa  MTGA_NEIMA RecName: Full=Monofunctional biosynthetic peptidoglycan
   53::150     5e-16  45%  226 aa  MTGA_SHEFN RecName: Full=Monofunctional biosynthetic peptidoglycan
   61::165     5e-16  42%  242 aa  MTGA_SALPC RecName: Full=Monofunctional biosynthetic peptidoglycan
   61::165     5e-16  42%  242 aa  MTGA_SALHS RecName: Full=Monofunctional biosynthetic peptidoglycan
   61::165     5e-16  42%  242 aa  MTGA_SALG2 RecName: Full=Monofunctional biosynthetic peptidoglycan
   61::165     5e-16  42%  242 aa  MTGA_SALEP RecName: Full=Monofunctional biosynthetic peptidoglycan
   61::165     5e-16  42%  242 aa  MTGA_SALCH RecName: Full=Monofunctional biosynthetic peptidoglycan
   51::149     5e-16  42%  227 aa  MTGA_RHOP2 RecName: Full=Monofunctional biosynthetic peptidoglycan
   54::156     5e-16  43%  236 aa  MTGA_PSEP1 RecName: Full=Monofunctional biosynthetic peptidoglycan
   54::156     6e-16  43%  236 aa  MTGA_PSEPK RecName: Full=Monofunctional biosynthetic peptidoglycan
   54::156     6e-16  43%  236 aa  MTGA_PSEE4 RecName: Full=Monofunctional biosynthetic peptidoglycan
   62::158     6e-16  42%  233 aa  MTGA_NEIMF RecName: Full=Monofunctional biosynthetic peptidoglycan
   75::225     6e-16  32%  246 aa  MTGA_HAEIN RecName: Full=Monofunctional biosynthetic peptidoglycan
   71::172     6e-16  39%  245 aa  MTGA_BURVG RecName: Full=Monofunctional biosynthetic peptidoglycan
   71::172     6e-16  39%  245 aa  MTGA_BURS3 RecName: Full=Monofunctional biosynthetic peptidoglycan
   71::172     6e-16  39%  245 aa  MTGA_BURCH RecName: Full=Monofunctional biosynthetic peptidoglycan
   71::172     6e-16  39%  245 aa  MTGA_BURCC RecName: Full=Monofunctional biosynthetic peptidoglycan
   71::172     6e-16  39%  245 aa  MTGA_BURCA RecName: Full=Monofunctional biosynthetic peptidoglycan
   54::156     8e-16  44%  236 aa  MTGA_PSEPG RecName: Full=Monofunctional biosynthetic peptidoglycan
   76::172     8e-16  40%  245 aa  MTGA_BURCM RecName: Full=Monofunctional biosynthetic peptidoglycan
   76::172     8e-16  40%  245 aa  MTGA_BURA4 RecName: Full=Monofunctional biosynthetic peptidoglycan
   50::218     8e-16  36%  224 aa  MTGA_BRAJA RecName: Full=Monofunctional biosynthetic peptidoglycan
   61::165     1e-15  41%  242 aa  MTGA_SALPK RecName: Full=Monofunctional biosynthetic peptidoglycan
   61::165     1e-15  41%  242 aa  MTGA_SALPA RecName: Full=Monofunctional biosynthetic peptidoglycan
   54::156     1e-15  43%  236 aa  MTGA_PSEPW RecName: Full=Monofunctional biosynthetic peptidoglycan
   71::172     1e-15  38%  245 aa  MTGA_BURM1 RecName: Full=Monofunctional biosynthetic peptidoglycan
   72::174     1e-15  44%  242 aa  MTGA_BORPE RecName: Full=Monofunctional biosynthetic peptidoglycan
   72::174     1e-15  44%  242 aa  MTGA_BORPA RecName: Full=Monofunctional biosynthetic peptidoglycan
   72::174     1e-15  44%  242 aa  MTGA_BORBR RecName: Full=Monofunctional biosynthetic peptidoglycan
   51::148     2e-15  43%  229 aa  MTGA_RHOPS RecName: Full=Monofunctional biosynthetic peptidoglycan
   59::164     2e-15  42%  241 aa  MTGA_ENTS8 RecName: Full=Monofunctional biosynthetic peptidoglycan
   50::196     2e-15  32%  229 aa  MTGA_CAUCR RecName: Full=Monofunctional biosynthetic peptidoglycan
   50::196     2e-15  32%  229 aa  MTGA_CAUCN RecName: Full=Monofunctional biosynthetic peptidoglycan
   70::214     3e-15  34%  248 aa  MTGA_XANC5 RecName: Full=Monofunctional biosynthetic peptidoglycan
   87::214     3e-15  37%  246 aa  MTGA_XANAC RecName: Full=Monofunctional biosynthetic peptidoglycan
   61::158     4e-15  42%  236 aa  MTGA_RHOPT RecName: Full=Monofunctional biosynthetic peptidoglycan
   61::158     4e-15  42%  236 aa  MTGA_RHOPA RecName: Full=Monofunctional biosynthetic peptidoglycan
   61::165     5e-15  41%  242 aa  MTGA_SALDC RecName: Full=Monofunctional biosynthetic peptidoglycan
   59::154     7e-15  45%  240 aa  MTGA_PSEFS RecName: Full=Monofunctional biosynthetic peptidoglycan
   54::222     9e-15  28%  236 aa  MTGA_PSESM RecName: Full=Monofunctional biosynthetic peptidoglycan
   62::158     1e-14  39%  233 aa  MTGA_RALME RecName: Full=Monofunctional biosynthetic peptidoglycan
   86::213     2e-14  36%  245 aa  MTGA_XANOR RecName: Full=Monofunctional biosynthetic peptidoglycan
   86::213     2e-14  36%  245 aa  MTGA_XANOM RecName: Full=Monofunctional biosynthetic peptidoglycan
   60::154     2e-14  42%  240 aa  MTGA_PSEF5 RecName: Full=Monofunctional biosynthetic peptidoglycan
   60::154     4e-14  41%  240 aa  MTGA_PSEPF RecName: Full=Monofunctional biosynthetic peptidoglycan
   64::203     4e-14  31%  248 aa  MTGA_BACTN RecName: Full=Monofunctional biosynthetic peptidoglycan
   70::153     8e-14  48%  225 aa  MTGA_VIBPA RecName: Full=Monofunctional biosynthetic peptidoglycan
   61::198     8e-14  33%  233 aa  MTGA_SHEON RecName: Full=Monofunctional biosynthetic peptidoglycan
   72::234     1e-13  31%  243 aa  MTGA_MESSB RecName: Full=Monofunctional biosynthetic peptidoglycan
   71::171     1e-13  38%  244 aa  MTGA_CYTH3 RecName: Full=Monofunctional biosynthetic peptidoglycan
  211::446     2e-13  36%  491 aa  PBPA_MYCS2 RecName: Full=Penicillin-binding protein A;       
   69::213     2e-13  31%  244 aa  MTGA_MANSM RecName: Full=Monofunctional biosynthetic peptidoglycan
   50::159     3e-13  36%  248 aa  MTGA_BACFR RecName: Full=Monofunctional biosynthetic peptidoglycan
   50::159     3e-13  36%  248 aa  MTGA_BACFN RecName: Full=Monofunctional biosynthetic peptidoglycan
   62::159     9e-13  37%  233 aa  MTGA_RHIE6 RecName: Full=Monofunctional biosynthetic peptidoglycan
   62::159     3e-12  36%  233 aa  MTGA_RHILW RecName: Full=Monofunctional biosynthetic peptidoglycan
   62::159     3e-12  36%  233 aa  MTGA_RHIEC RecName: Full=Monofunctional biosynthetic peptidoglycan
   56::154     4e-12  40%  230 aa  MTGA_RHORT RecName: Full=Monofunctional biosynthetic peptidoglycan
   64::158     4e-12  40%  234 aa  MTGA_CHRSD RecName: Full=Monofunctional biosynthetic peptidoglycan
   81::177     6e-12  37%  252 aa  MTGA_RALEJ RecName: Full=Monofunctional biosynthetic peptidoglycan
   74::171     1e-11  36%  245 aa  MTGA_RHIL3 RecName: Full=Monofunctional biosynthetic peptidoglycan
   55::152     1e-11  38%  226 aa  MTGA_AGRT5 RecName: Full=Monofunctional biosynthetic peptidoglycan
   65::229     1e-11  29%  236 aa  MTGA_RHILO RecName: Full=Monofunctional biosynthetic peptidoglycan
   65::162     4e-11  37%  236 aa  MTGA_RHIME RecName: Full=Monofunctional biosynthetic peptidoglycan
   84::235     1e-10  28%  243 aa  MTGA_XYLFA RecName: Full=Monofunctional biosynthetic peptidoglycan
   84::235     2e-10  28%  243 aa  MTGA_XYLFT RecName: Full=Monofunctional biosynthetic peptidoglycan
   84::235     2e-10  28%  243 aa  MTGA_XYLF2 RecName: Full=Monofunctional biosynthetic peptidoglycan
   84::235     3e-10  28%  243 aa  MTGA_XYLFM RecName: Full=Monofunctional biosynthetic peptidoglycan
   49::217     3e-10  27%  224 aa  MTGA_BRUSU RecName: Full=Monofunctional biosynthetic peptidoglycan
   49::217     7e-10  27%  224 aa  MTGA_BRUME RecName: Full=Monofunctional biosynthetic peptidoglycan
   63::204     3e-09  27%  239 aa  MTGA_JANSC RecName: Full=Monofunctional biosynthetic peptidoglycan
  218::509     1e-05  26%  646 aa  SP5D_BACSU RecName: Full=Stage V sporulation protein D;AltName:
  209::529     3e-04  27%  598 aa  FTSI_MESVI RecName: Full=Peptidoglycan synthetase ftsI homolog;    
    1::757

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PBPF_BACSU      ----------------------------------------------------------------------
PBPB_VIBCH      ----------------------------------------------------------------------
PBPD_BACSU      ----------------------------------------------------------------------
PBPG_BACSU      ----------------------------------------------------------------------
PBPA_BACSU      ----------------------------------------------------------------------
PBPB_HAEIN      ----------------------------------------------------------------------
PBPB_ECOLI      ----------------------------------------------------------------------
PBPB_BUCAI      ----------------------------------------------------------------------
PBPB_BUCBP      ----------------------------------------------------------------------
PBPA_CLOTE      ----------------------------------------------------------------------
PBPA_CLOPS      ----------------------------------------------------------------------
PBPA_CLOPE      ----------------------------------------------------------------------
PBPA_CLOP1      ----------------------------------------------------------------------
PBPA_AQUAE      ----------------------------------------------------------------------
PBPA_CLOAB      ----------------------------------------------------------------------
PBPA_NEIFL      ----------------------------------------------------------------------
PBPA_CLOBH      ----------------------------------------------------------------------
PBPA_CLOB1      ----------------------------------------------------------------------
PBPC_ECOLI      ----------------------------------------------------------------------
PBPA_CLOBL      ----------------------------------------------------------------------
PBPA_CLONN      ----------------------------------------------------------------------
PBPA_NEILA      ----------------------------------------------------------------------
PBPA_PSEAE      ----------------------------------------------------------------------
PBPA_ECOLI      ----------------------------------------------------------------------
PBPA_HAEIN      ----------------------------------------------------------------------
PBPA_STRPN      ----------------------------------------------------------------------
PBPA_XYLFA      ----------------------------------------------------------------------
PBPA_NEICI      ----------------------------------------------------------------------
PBPA_STRR6      ----------------------------------------------------------------------
PBPA_XYLFT      ----------------------------------------------------------------------
PBPA_VIBCH      ----------------------------------------------------------------------
PBPA_NEIMB      ----------------------------------------------------------------------
PBPA_NEIMA      ----------------------------------------------------------------------
PBPA_STROR      ----------------------------------------------------------------------
PBPA_RICFE      ----------------------------------------------------------------------
PBPA_NEIGO      ----------------------------------------------------------------------
PBPA_NEIG1      ----------------------------------------------------------------------
PBPA_RICPR      ----------------------------------------------------------------------
PBPA_RICCN      ----------------------------------------------------------------------
PBPA_RICBR      ----------------------------------------------------------------------
PBPA_RICTY      ----------------------------------------------------------------------
TRG_RALEH       ----------------------------------------------------------------------
MTGA_NITMU      ----------------------------------------------------------------------
MTGA_ACIAD      ----------------------------------------------------------------------
MTGA_THIDA      ----------------------------------------------------------------------
MTGA_ALCBS      ----------------------------------------------------------------------
MTGA_ACIBT      ----------------------------------------------------------------------
MTGA_DECAR      ----------------------------------------------------------------------
MTGA_ACIBY      ----------------------------------------------------------------------
MTGA_ACIBS      ----------------------------------------------------------------------
MTGA_ACIBC      ----------------------------------------------------------------------
MTGA_ACIB5      ----------------------------------------------------------------------
MTGA_ACIB3      ----------------------------------------------------------------------
MGT_STAAW       ----------------------------------------------------------------------
MGT_STAAT       ----------------------------------------------------------------------
MGT_STAAS       ----------------------------------------------------------------------
MGT_STAAR       ----------------------------------------------------------------------
MGT_STAAN       ----------------------------------------------------------------------
MGT_STAAM       ----------------------------------------------------------------------
MGT_STAAE       ----------------------------------------------------------------------
MGT_STAAC       ----------------------------------------------------------------------
MGT_STAAB       ----------------------------------------------------------------------
MGT_STAA8       ----------------------------------------------------------------------
MGT_STAA3       ----------------------------------------------------------------------
MGT_STAA1       ----------------------------------------------------------------------
MTGA_CHRVO      ----------------------------------------------------------------------
MGT_STAES       ----------------------------------------------------------------------
MGT_STAEQ       ----------------------------------------------------------------------
MTGA_NEIGO      ----------------------------------------------------------------------
MTGA_NEIG1      ----------------------------------------------------------------------
MTGA_MARMS      ----------------------------------------------------------------------
MTGA_ECOLC      ----------------------------------------------------------------------
MTGA_NEIG2      ----------------------------------------------------------------------
MTGA_AZOSE      ----------------------------------------------------------------------
MGT_STAA9       ----------------------------------------------------------------------
MGT_STAA2       ----------------------------------------------------------------------
MGT_STAHJ       ----------------------------------------------------------------------
MTGA_AZOSB      ----------------------------------------------------------------------
MTGA_SHEDO      ----------------------------------------------------------------------
MGT_STAS1       ----------------------------------------------------------------------
MTGA_NITEU      ----------------------------------------------------------------------
MTGA_METFK      ----------------------------------------------------------------------
MTGA_PECCP      ----------------------------------------------------------------------
MTGA_PHOLL      ----------------------------------------------------------------------
MTGA_RHOCS      ----------------------------------------------------------------------
MTGA_HERAR      ----------------------------------------------------------------------
MTGA_JANMA      ----------------------------------------------------------------------
MTGA_ECO55      ----------------------------------------------------------------------
MTGA_SHISS      ----------------------------------------------------------------------
MTGA_BURXL      ----------------------------------------------------------------------
MTGA_NITEC      ----------------------------------------------------------------------
MTGA_BORA1      ----------------------------------------------------------------------
MTGA_SHIDS      ----------------------------------------------------------------------
MTGA_PSEAE      ----------------------------------------------------------------------
MTGA_ECOSE      ----------------------------------------------------------------------
MTGA_ECOLI      ----------------------------------------------------------------------
MTGA_ECOHS      ----------------------------------------------------------------------
MTGA_ECODH      ----------------------------------------------------------------------
MTGA_ECOBW      ----------------------------------------------------------------------
MTGA_ECO8A      ----------------------------------------------------------------------
MTGA_ECO24      ----------------------------------------------------------------------
MTGA_PASMU      ----------------------------------------------------------------------
MTGA_ECOUT      ----------------------------------------------------------------------
MTGA_ECOSM      ----------------------------------------------------------------------
MTGA_ECOLU      ----------------------------------------------------------------------
MTGA_ECOL6      ----------------------------------------------------------------------
MTGA_ECOL5      ----------------------------------------------------------------------
MTGA_ECOK1      ----------------------------------------------------------------------
MTGA_ECO81      ----------------------------------------------------------------------
MTGA_ECO7I      ----------------------------------------------------------------------
MTGA_ECO5E      ----------------------------------------------------------------------
MTGA_ECO57      ----------------------------------------------------------------------
MTGA_ECO45      ----------------------------------------------------------------------
MTGA_ECO27      ----------------------------------------------------------------------
MTGA_NITWN      ----------------------------------------------------------------------
MTGA_LARHH      ----------------------------------------------------------------------
MTGA_SHIBS      ----------------------------------------------------------------------
MTGA_NITHX      ----------------------------------------------------------------------
MTGA_AERHH      ----------------------------------------------------------------------
MTGA_YERP3      ----------------------------------------------------------------------
MTGA_SALAR      ----------------------------------------------------------------------
MTGA_RALSO      ----------------------------------------------------------------------
MTGA_PSEMY      ----------------------------------------------------------------------
MTGA_KLEOX      ----------------------------------------------------------------------
MTGA_BDEBA      ----------------------------------------------------------------------
MTGA_YERPS      ----------------------------------------------------------------------
MTGA_YERPP      ----------------------------------------------------------------------
MTGA_YERPN      ----------------------------------------------------------------------
MTGA_YERPG      ----------------------------------------------------------------------
MTGA_YERPE      ----------------------------------------------------------------------
MTGA_YERPB      ----------------------------------------------------------------------
MTGA_YERPA      ----------------------------------------------------------------------
MTGA_YERPY      ----------------------------------------------------------------------
MTGA_SALSV      ----------------------------------------------------------------------
MTGA_PSEU5      ----------------------------------------------------------------------
MTGA_BURTA      ----------------------------------------------------------------------
MTGA_BURPS      ----------------------------------------------------------------------
MTGA_BURPP      ----------------------------------------------------------------------
MTGA_BURP8      ----------------------------------------------------------------------
MTGA_BURMA      ----------------------------------------------------------------------
MTGA_YERE8      ----------------------------------------------------------------------
MTGA_NEIM0      ----------------------------------------------------------------------
MTGA_SHEAM      ----------------------------------------------------------------------
MTGA_SALA4      ----------------------------------------------------------------------
MTGA_PSE14      ----------------------------------------------------------------------
MTGA_XANCP      ----------------------------------------------------------------------
MTGA_XANCB      ----------------------------------------------------------------------
MTGA_XANC8      ----------------------------------------------------------------------
MTGA_HAEIE      ----------------------------------------------------------------------
MTGA_ERWCT      ----------------------------------------------------------------------
MTGA_CITK8      ----------------------------------------------------------------------
MTGA_SALTY      ----------------------------------------------------------------------
MTGA_SALTI      ----------------------------------------------------------------------
MTGA_SALPB      ----------------------------------------------------------------------
MTGA_SALNS      ----------------------------------------------------------------------
MTGA_PSEU2      ----------------------------------------------------------------------
MTGA_NEIME      ----------------------------------------------------------------------
MTGA_NEIMB      ----------------------------------------------------------------------
MTGA_NEIMA      ----------------------------------------------------------------------
MTGA_SHEFN      ----------------------------------------------------------------------
MTGA_SALPC      ----------------------------------------------------------------------
MTGA_SALHS      ----------------------------------------------------------------------
MTGA_SALG2      ----------------------------------------------------------------------
MTGA_SALEP      ----------------------------------------------------------------------
MTGA_SALCH      ----------------------------------------------------------------------
MTGA_RHOP2      ----------------------------------------------------------------------
MTGA_PSEP1      ----------------------------------------------------------------------
MTGA_PSEPK      ----------------------------------------------------------------------
MTGA_PSEE4      ----------------------------------------------------------------------
MTGA_NEIMF      ----------------------------------------------------------------------
MTGA_HAEIN      ----------------------------------------------------------------------
MTGA_BURVG      ----------------------------------------------------------------------
MTGA_BURS3      ----------------------------------------------------------------------
MTGA_BURCH      ----------------------------------------------------------------------
MTGA_BURCC      ----------------------------------------------------------------------
MTGA_BURCA      ----------------------------------------------------------------------
MTGA_PSEPG      ----------------------------------------------------------------------
MTGA_BURCM      ----------------------------------------------------------------------
MTGA_BURA4      ----------------------------------------------------------------------
MTGA_BRAJA      ----------------------------------------------------------------------
MTGA_SALPK      ----------------------------------------------------------------------
MTGA_SALPA      ----------------------------------------------------------------------
MTGA_PSEPW      ----------------------------------------------------------------------
MTGA_BURM1      ----------------------------------------------------------------------
MTGA_BORPE      ----------------------------------------------------------------------
MTGA_BORPA      ----------------------------------------------------------------------
MTGA_BORBR      ----------------------------------------------------------------------
MTGA_RHOPS      ----------------------------------------------------------------------
MTGA_ENTS8      ----------------------------------------------------------------------
MTGA_CAUCR      ----------------------------------------------------------------------
MTGA_CAUCN      ----------------------------------------------------------------------
MTGA_XANC5      ----------------------------------------------------------------------
MTGA_XANAC      ----------------------------------------------------------------------
MTGA_RHOPT      ----------------------------------------------------------------------
MTGA_RHOPA      ----------------------------------------------------------------------
MTGA_SALDC      ----------------------------------------------------------------------
MTGA_PSEFS      ----------------------------------------------------------------------
MTGA_PSESM      ----------------------------------------------------------------------
MTGA_RALME      ----------------------------------------------------------------------
MTGA_XANOR      ----------------------------------------------------------------------
MTGA_XANOM      ----------------------------------------------------------------------
MTGA_PSEF5      ----------------------------------------------------------------------
MTGA_PSEPF      ----------------------------------------------------------------------
MTGA_BACTN      ----------------------------------------------------------------------
MTGA_VIBPA      ----------------------------------------------------------------------
MTGA_SHEON      ----------------------------------------------------------------------
MTGA_MESSB      ----------------------------------------------------------------------
MTGA_CYTH3      ----------------------------------------------------------------------
PBPA_MYCS2      ----------------------------------------------------------------------
MTGA_MANSM      ----------------------------------------------------------------------
MTGA_BACFR      ----------------------------------------------------------------------
MTGA_BACFN      ----------------------------------------------------------------------
MTGA_RHIE6      ----------------------------------------------------------------------
MTGA_RHILW      ----------------------------------------------------------------------
MTGA_RHIEC      ----------------------------------------------------------------------
MTGA_RHORT      ----------------------------------------------------------------------
MTGA_CHRSD      ----------------------------------------------------------------------
MTGA_RALEJ      ----------------------------------------------------------------------
MTGA_RHIL3      ----------------------------------------------------------------------
MTGA_AGRT5      ----------------------------------------------------------------------
MTGA_RHILO      ----------------------------------------------------------------------
MTGA_RHIME      ----------------------------------------------------------------------
MTGA_XYLFA      ----------------------------------------------------------------------
MTGA_XYLFT      ----------------------------------------------------------------------
MTGA_XYLF2      ----------------------------------------------------------------------
MTGA_XYLFM      ----------------------------------------------------------------------
MTGA_BRUSU      ----------------------------------------------------------------------
MTGA_BRUME      ----------------------------------------------------------------------
MTGA_JANSC      ----------------------------------------------------------------------
SP5D_BACSU      ----------------------------------------------------------------------
FTSI_MESVI      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxKKLVVNLTCDALTFGTAGSIVLLALAMPAFEETKKDWRYRGDFAVTFLDRYGNTIGHRGI
PBPF_BACSU      ---------------------------------------------------------VDQNGDEVASLYT
PBPB_VIBCH      ----------------------------------------------------------------------
PBPD_BACSU      ----------------------------------------------------------DRDGSLVSEIVS
PBPG_BACSU      ----------------------------------------------------------------------
PBPA_BACSU      -------------------------------------PSLDESK----LKTPYSSTIYDKNGKEIAEVGA
PBPB_HAEIN      ----------------------------------------------------------------------
PBPB_ECOLI      ----------------------------------------------------------------------
PBPB_BUCAI      ----------------------------------------------------------------------
PBPB_BUCBP      ----------------------------------------------------------------------
PBPA_CLOTE      ----------------------------------------------------------------------
PBPA_CLOPS      ----------------------------------------------------------------------
PBPA_CLOPE      ----------------------------------------------------------------------
PBPA_CLOP1      ----------------------------------------------------------------------
PBPA_AQUAE      ----------------------------------------------------------DAKGRLYGTIGI
PBPA_CLOAB      ----------------------------------------------------------------------
PBPA_NEIFL      ----------KKIIT--TCMGLNNGLAFGVGLIAIAIPKLPSLDSLQHYKPKLPLTIYSSDGQVIGVYGE
PBPA_CLOBH      ---------------------------------------------------------------------I
PBPA_CLOB1      ---------------------------------------------------------------------I
PBPC_ECOLI      ----------------------------------------------------------------------
PBPA_CLOBL      ---------------------------------------------------------------------I
PBPA_CLONN      ----------------------------------------------------------------------
PBPA_NEILA      -----------------TCFGLVFGLCVFAVLLAIAIPKLPSLDSLQHYQPKMPLTVYSADGKIIGIYGE
PBPA_PSEAE      --------------VTLICGVL-LSFSGAYLYLSPSLPSVEALRN---VQLQIPLKVYSEDGKLISEFGE
PBPA_ECOLI      ------------------------------------------TLKDVRLQIPMQIYSAD--GELIAQYGE
PBPA_HAEIN      -------------------------------------------------------------GKLIGEVGE
PBPA_STRPN      ----------------------------------------------------------DNKNQLIADLGS
PBPA_XYLFA      ----------------------------------------------------------------------
PBPA_NEICI      ------------------------------------------------YQPKMPLTIYSADGEVIGIYGE
PBPA_STRR6      ----------------------------------------------------------DNKNQLIADLGS
PBPA_XYLFT      ----------------------------------------------------------------------
PBPA_VIBCH      -------------------------------------------------------------GKLIAQFGE
PBPA_NEIMB      ----------------------------------------------------------------------
PBPA_NEIMA      ----------------------------------------------------------------------
PBPA_STROR      ----------------------------------------------------------------------
PBPA_RICFE      ----------------------------------------------------------------------
PBPA_NEIGO      ------------------------------------------------YQPKMPLTIYSADGEVIGMYGE
PBPA_NEIG1      ------------------------------------------------YQPKMPLTIYSADGEVIGMYGE
PBPA_RICPR      -----------------------------------------------RYYPPSVTRIYSRDGKLIEEYAF
PBPA_RICCN      ----------------------------------------------------------------------
PBPA_RICBR      ----------------------------------------------------------------------
PBPA_RICTY      ----------------------------------------------------------------------
TRG_RALEH       ----------------------------------------------------------------------
MTGA_NITMU      ----------------------------------------------------------------------
MTGA_ACIAD      ----------------------------------------------------------------------
MTGA_THIDA      ---------------------------------------------------------------------V
MTGA_ALCBS      -------------------------------------------------------------------QGN
MTGA_ACIBT      ---------------------------------------------------------------------I
MTGA_DECAR      ----------------------------------------------------------------------
MTGA_ACIBY      ---------------------------------------------------------------------I
MTGA_ACIBS      ---------------------------------------------------------------------I
MTGA_ACIBC      ---------------------------------------------------------------------I
MTGA_ACIB5      ---------------------------------------------------------------------I
MTGA_ACIB3      ---------------------------------------------------------------------I
MGT_STAAW       --------------------------------------------------------FLSTRDNVDELRKI
MGT_STAAT       --------------------------------------------------------FLSTRDNVDELRKI
MGT_STAAS       --------------------------------------------------------FLSTRDNVDELRKI
MGT_STAAR       --------------------------------------------------------FLSTRDNVDELRKI
MGT_STAAN       --------------------------------------------------------FLSTRDNVDELRKI
MGT_STAAM       --------------------------------------------------------FLSTRDNVDELRKI
MGT_STAAE       --------------------------------------------------------FLSTRDNVDELRKI
MGT_STAAC       --------------------------------------------------------FLSTRDNVDELRKI
MGT_STAAB       --------------------------------------------------------FLSTRDNVDELRKI
MGT_STAA8       --------------------------------------------------------FLSTRDNVDELRKI
MGT_STAA3       --------------------------------------------------------FLSTRDNVDELRKI
MGT_STAA1       --------------------------------------------------------FLSTRDNVDELRKI
MTGA_CHRVO      ----------------------------------------------------------------------
MGT_STAES       ----------------------------------------------------------------------
MGT_STAEQ       ----------------------------------------------------------------------
MTGA_NEIGO      ----------------------------------------------------------------------
MTGA_NEIG1      ----------------------------------------------------------------------
MTGA_MARMS      ----------------------------------------------------------------------
MTGA_ECOLC      -------------------------------------------------------------------RYV
MTGA_NEIG2      ----------------------------------------------------------------------
MTGA_AZOSE      ----------------------------------------------------------------------
MGT_STAA9       --------------------------------------------------------FLSTRDNVDELRKI
MGT_STAA2       --------------------------------------------------------FLSTRDNVDELRKI
MGT_STAHJ       ----------------------------------------------------------------------
MTGA_AZOSB      ----------------------------------------------------------------------
MTGA_SHEDO      ----------------------------------------------------------------------
MGT_STAS1       ----------------------------------------------------------------------
MTGA_NITEU      ----------------------------------------------------------------------
MTGA_METFK      ----------------------------------------------------------------------
MTGA_PECCP      ---------------------------------------------------------------------V
MTGA_PHOLL      ---------------------------------------------------------------------V
MTGA_RHOCS      ----------------------------------------------------------------------
MTGA_HERAR      ----------------------------------------------------------------------
MTGA_JANMA      ----------------------------------------------------------------------
MTGA_ECO55      ------------------------------------------------------------YGN---FRYV
MTGA_SHISS      -------------------------------------------------------------------RYV
MTGA_BURXL      ----------------------------------------------------------------------
MTGA_NITEC      ----------------------------------------------------------------------
MTGA_BORA1      ----------------------------------------------------------------------
MTGA_SHIDS      -------------------------------------------------------------------RYV
MTGA_PSEAE      ----------------------------------------------------------------------
MTGA_ECOSE      -------------------------------------------------------------------RYV
MTGA_ECOLI      -------------------------------------------------------------------RYV
MTGA_ECOHS      -------------------------------------------------------------------RYV
MTGA_ECODH      -------------------------------------------------------------------RYV
MTGA_ECOBW      -------------------------------------------------------------------RYV
MTGA_ECO8A      -------------------------------------------------------------------RYV
MTGA_ECO24      -------------------------------------------------------------------RYV
MTGA_PASMU      ----------------------------------------------------------------------
MTGA_ECOUT      -------------------------------------------------------------------RYV
MTGA_ECOSM      -------------------------------------------------------------------RYV
MTGA_ECOLU      -------------------------------------------------------------------RYV
MTGA_ECOL6      -------------------------------------------------------------------RYV
MTGA_ECOL5      -------------------------------------------------------------------RYV
MTGA_ECOK1      -------------------------------------------------------------------RYV
MTGA_ECO81      -------------------------------------------------------------------RYV
MTGA_ECO7I      -------------------------------------------------------------------RYV
MTGA_ECO5E      -------------------------------------------------------------------RYV
MTGA_ECO57      -------------------------------------------------------------------RYV
MTGA_ECO45      -------------------------------------------------------------------RYV
MTGA_ECO27      -------------------------------------------------------------------RYV
MTGA_NITWN      ----------------------------------------------------------------------
MTGA_LARHH      ----------------------------------------------------------------------
MTGA_SHIBS      -------------------------------------------------------------------RYV
MTGA_NITHX      ----------------------------------------------------------------------
MTGA_AERHH      ----------------------------------------------------------------------
MTGA_YERP3      ---------------------------------------------------------------------V
MTGA_SALAR      ---------------------------------------------------------------------V
MTGA_RALSO      ----------------------------------------------------------------------
MTGA_PSEMY      ----------------------------------------------------------------------
MTGA_KLEOX      ---------------------------------------------------------------------I
MTGA_BDEBA      ----------------------------------------------------------------------
MTGA_YERPS      ---------------------------------------------------------------------V
MTGA_YERPP      ---------------------------------------------------------------------V
MTGA_YERPN      ---------------------------------------------------------------------V
MTGA_YERPG      ---------------------------------------------------------------------V
MTGA_YERPE      ---------------------------------------------------------------------V
MTGA_YERPB      ---------------------------------------------------------------------V
MTGA_YERPA      ---------------------------------------------------------------------V
MTGA_YERPY      ---------------------------------------------------------------------V
MTGA_SALSV      ---------------------------------------------------------------------V
MTGA_PSEU5      ----------------------------------------------------------------------
MTGA_BURTA      ----------------------------------------------------------------------
MTGA_BURPS      ---------------------------------------------------------------TIRHRW-
MTGA_BURPP      ----------------------------------------------------------------------
MTGA_BURP8      ----------------------------------------------------------------------
MTGA_BURMA      ---------------------------------------------------------------TIRHRW-
MTGA_YERE8      ---------------------------------------------------------------------V
MTGA_NEIM0      ----------------------------------------------------------------------
MTGA_SHEAM      ----------------------------------------------------------------------
MTGA_SALA4      ---------------------------------------------------------------------V
MTGA_PSE14      ----------------------------------------------------------------------
MTGA_XANCP      --------------------------------------------------------YLEAWGE--GEAGF
MTGA_XANCB      --------------------------------------------------------YLEAWGE--GEAGF
MTGA_XANC8      --------------------------------------------------------YLEAWGE--GEAGF
MTGA_HAEIE      ----------------------------------------------------------------------
MTGA_ERWCT      ---------------------------------------------------------------------V
MTGA_CITK8      ---------------------------------------------------------------------V
MTGA_SALTY      ---------------------------------------------------------------------V
MTGA_SALTI      ---------------------------------------------------------------------V
MTGA_SALPB      ---------------------------------------------------------------------V
MTGA_SALNS      ---------------------------------------------------------------------V
MTGA_PSEU2      ----------------------------------------------------------------------
MTGA_NEIME      ----------------------------------------------------------------------
MTGA_NEIMB      ----------------------------------------------------------------------
MTGA_NEIMA      ----------------------------------------------------------------------
MTGA_SHEFN      ----------------------------------------------------------------------
MTGA_SALPC      ---------------------------------------------------------------------V
MTGA_SALHS      ---------------------------------------------------------------------V
MTGA_SALG2      ---------------------------------------------------------------------V
MTGA_SALEP      ---------------------------------------------------------------------V
MTGA_SALCH      ---------------------------------------------------------------------V
MTGA_RHOP2      ----------------------------------------------------------------------
MTGA_PSEP1      ----------------------------------------------------------------------
MTGA_PSEPK      ----------------------------------------------------------------------
MTGA_PSEE4      ----------------------------------------------------------------------
MTGA_NEIMF      ----------------------------------------------------------------------
MTGA_HAEIN      ----------------------------------------------------------------------
MTGA_BURVG      ----------------------------------------------------------------------
MTGA_BURS3      ----------------------------------------------------------------------
MTGA_BURCH      ----------------------------------------------------------------------
MTGA_BURCC      ----------------------------------------------------------------------
MTGA_BURCA      ----------------------------------------------------------------------
MTGA_PSEPG      ----------------------------------------------------------------------
MTGA_BURCM      ----------------------------------------------------------------------
MTGA_BURA4      ----------------------------------------------------------------------
MTGA_BRAJA      ----------------------------------------------------------------------
MTGA_SALPK      ---------------------------------------------------------------------V
MTGA_SALPA      ---------------------------------------------------------------------V
MTGA_PSEPW      ----------------------------------------------------------------------
MTGA_BURM1      ----------------------------------------------------------------------
MTGA_BORPE      ----------------------------------------------------------------------
MTGA_BORPA      ----------------------------------------------------------------------
MTGA_BORBR      ----------------------------------------------------------------------
MTGA_RHOPS      ----------------------------------------------------------------------
MTGA_ENTS8      -------------------------------------------------------------------RYV
MTGA_CAUCR      -------------------------------------------------------------------RGL
MTGA_CAUCN      -------------------------------------------------------------------RGL
MTGA_XANC5      ----------------------------------------------------------------------
MTGA_XANAC      ----------------------------------------------------------------------
MTGA_RHOPT      ----------------------------------------------------------------------
MTGA_RHOPA      ----------------------------------------------------------------------
MTGA_SALDC      ---------------------------------------------------------------------V
MTGA_PSEFS      ----------------------------------------------------------------------
MTGA_PSESM      ----------------------------------------------------------------------
MTGA_RALME      ----------------------------------------------------------------------
MTGA_XANOR      ----------------------------------------------------------------------
MTGA_XANOM      ----------------------------------------------------------------------
MTGA_PSEF5      ----------------------------------------------------------------------
MTGA_PSEPF      ----------------------------------------------------------------------
MTGA_BACTN      ----------------------------------------------------------------------
MTGA_VIBPA      ----------------------------------------------------------------------
MTGA_SHEON      ----------------------------------------------------------------------
MTGA_MESSB      ----------------------------------------------------------------------
MTGA_CYTH3      ----------------------------------------------------------------------
PBPA_MYCS2      ----------------------------------------------------------------------
MTGA_MANSM      ----------------------------------------------------------------------
MTGA_BACFR      -----------------------------------------------------------------GEKVV
MTGA_BACFN      -----------------------------------------------------------------GEKVV
MTGA_RHIE6      ----------------------------------------------------------------------
MTGA_RHILW      ----------------------------------------------------------------------
MTGA_RHIEC      ----------------------------------------------------------------------
MTGA_RHORT      ----------------------------------------------------------------------
MTGA_CHRSD      ----------------------------------------------------------------------
MTGA_RALEJ      ----------------------------------------------------------------------
MTGA_RHIL3      ----------------------------------------------------------------------
MTGA_AGRT5      ----------------------------------------------------------------------
MTGA_RHILO      ----------------------------------------------------------------------
MTGA_RHIME      ----------------------------------------------------------------------
MTGA_XYLFA      ----------------------------------------------------------------------
MTGA_XYLFT      ----------------------------------------------------------------------
MTGA_XYLF2      ----------------------------------------------------------------------
MTGA_XYLFM      ----------------------------------------------------------------------
MTGA_BRUSU      ----------------------------------------------------------------------
MTGA_BRUME      ----------------------------------------------------------------------
MTGA_JANSC      --------------------------------------------------------------------GG
SP5D_BACSU      ----------------------------------------------------------------------
FTSI_MESVI      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           IHEDSVPIDQMPDHFIKAVLATEDRRFFDHFGIDFIGLARAMSENARAGGVVQGGSTLTQQLAKNLFLTN
PBPF_BACSU      ENREPVSINEIPKQVREAFIAVEDKRFYEHHGIDAKSVGRAVYRDILAGGKVEGGSTITQQLAKNIFLTH
PBPB_VIBCH      --------DQFPEVLVDALLVTEDRDFYQHDGVSPLAIGRAMVVNLKAGRTVQGGSTLTQQLAKNIFLSS
PBPD_BACSU      DHENRVPFNKIPEEVKQIFLTSEDRHFYEHKGFDFMGMVRATASNVKDKKIDQGASTITQQLSRNLYLSH
PBPG_BACSU      -----VPLKDMNPTIVKATVAIEDQNFYDHHGFDYKRMXXXXXXXXXXXXXVQGASTITQQYARNLYLEH
PBPA_BACSU      EKRTYVSIDEIPDVVKEAFIATEDARFYEHHGIDPVRIGGALVANFKDGFGAEGGSTITQQVVKNSLLSH
PBPB_HAEIN      ----AIPLQNYPRLLIDTLILTEDRRFYEHNGINPVGILRALIANIRAGQTVQGGSTLTQQLVKNLFLSR
PBPB_ECOLI      -----VPRSGFPDLLVDTLLATEDRHFYEHDGISLYSIGRAVLANLTAGRTVQGASTLTQQLVKNLFLSS
PBPB_BUCAI      -----IPRNQYPEMLVKTLLAIEDKYFYEHDGIHLSSIGRAFLVNLMAGRTIQGGSTLTQQLIKNLFLTN
PBPB_BUCBP      -----------PKALIQTLLTIEDKCFYNHYGINFYSMFRAFFVNLISGHSIQGGSTLTQQLVKNLFLTN
PBPA_CLOTE      -----VSYEDVPDNLKNAFISIEDERFFNHRGIDFGAFFRNISNKLKGKSALQGASTITQQLVRNTLLSQ
PBPA_CLOPS      -----VKSDEIPDNLKKAFVAIEDERFYEHKGIDIKRIAGVIASNIKGSNTVQGASTITQQLIKNAVLTN
PBPA_CLOPE      -----VKSEEIPDNLKKAFVAIEDERFYEHKGIDIKRIFGVIASNIKGSNTVQGASTITQQLIKNAVLTN
PBPA_CLOP1      -----VKSEEIPDNLKKAFVAIEDERFYEHKGIDIKRIFGVIASNIKGSNTVQGASTITQQLIKNAVLTN
PBPA_AQUAE      QKRFYVSIDKIPEHVINAFVATEDRNFWHHFGIDPVAIVRAAIVNYRAGRIVQGGSTITQQLAKNLFLTR
PBPA_CLOAB      -----VSIKDMPKNLSNAFVSIEDERFYKHSGIDTKRILGAFYNDIKSKNSIQGASTITQQLIKNRMFLN
PBPA_NEIFL      QRREFTKIDDFPKILKDAVIAAEDKRFYDHWGVDVWGVARAVIGNVMAGGVQSGASTITQQVAKNFYLSS
PBPA_CLOBH      TNEQRIVVDNVPQNLKNAFVSIEDERFYKHHGVDFTGVILIVTNKIKRSSKLQGASTLTQQLIKNTVLSS
PBPA_CLOB1      TNEQRIVVDNVPQNLKNAFVSIEDERFYKHHGVDFTGVILIVTNKIKRSSKLQGASTLTQQLIKNTVLSS
PBPC_ECOLI      -----VTIEDVSPRYLEALINYEDRWFWKHPGVNPFSVARAAWQDLTSGRVISGGSTLTMQVAR-LLDPH
PBPA_CLOBL      TNEQRIVVDNVPQNLKNAFVSIEDERFYKHHGVDFTGVILIVTNKIKRSSKLQGASTLTQQLIKNTVLSS
PBPA_CLONN      -----VKYDEVPENLINAFVSIEDERFFKHSGIDVKRIAGAMKNIVSGKPALQGASTITQQLIKNVFETH
PBPA_NEILA      QRREFTKIGDFPEVLRNAVIAAEDKRFYQHWGVDVWGVARAVVGNIVSGSMQSGASTITQQVAKNFYLSS
PBPA_PSEAE      MRRTPIRFADIPQDFIHALLSAEDDNFANHYGVDVKSLMRAAAQLLKSGHIQTGGSTITMQVAKNYFLTN
PBPA_ECOLI      KRRIPVTLDQIPPEMVKAFIATEDSRFYEHHGVDPVGIFRAASVALFSGHASQGASTITQQLARNFFLSP
PBPA_HAEIN      QRRIPVKLADVPQRLIDAFLATEDSRFYDHHGLDPIGIARALFVAVSNGGASQGASTITQQLARNFFLTS
PBPA_STRPN      ERRVNAQANDIPTDLVKAIVSIEDHRFFDHRGIDTIRILGAFLRNLQSNS-LQGGSTLTQQLIKLTYFTS
PBPA_XYLFA      ----------------------------------------------------------------------
PBPA_NEICI      QRREFTKIGDFPEVLRNAVIAAEDKRFYQHWGVDVWGVARAVVGNIVAGGVQSGASTITQQVAKNFYLSS
PBPA_STRR6      ERRVNAQANDIPTDLVKAIVSIEDHRFFDHRGIDTIRILGAFLRNLQSNS-LQGGSALTQQLIKLTYFTS
PBPA_XYLFT      ----------------------------------------------------------------------
PBPA_VIBCH      KRRIPLKLEEMPKELIEAVIATEDSRYYEHYGFDPIGITRAAFAVLASGSASQGASTITQQLARNFFLSN
PBPA_NEIMB      ----------------------------------------------------------------------
PBPA_NEIMA      ----------------------------------------------------------------------
PBPA_STROR      --------NEIPTDLVNAIVSIEDHRFFNHRGIDTIRIXXXXXXXXXXXXXXXXXXXXXXXXIKLTYFTS
PBPA_RICFE      -----VPINSIPSSLIESFIAAEDKNFYNHPGVDLLGIVRAAFSNYLHHRRMEGASTITQQVVKNFLLTN
PBPA_NEIGO      QRREFTKIGDFPEVLRNAVIAAEDKRFYRHWGVDXXXXXXXXXXXXXXXXXXXXXXTITQQVAKNFYLSS
PBPA_NEIG1      QRREFTKIGDFPEVLRNAVIAAEDKRFYRHWGVDXXXXXXXXXXXXXXXXXXXXXXTITQQVAKNFYLSS
PBPA_RICPR      ERRVFVPINNVPSSLIESFIAAEDKNFYTHPGIDLLGIVRAAFSNYLHNRRMEGASTITQQVVKNFLLTN
PBPA_RICCN      -----VPINSVPSSLIESFIAAEDKNFYNHPGVDLFGIVRAAFSNYLHHRRMEGASTITQQVVKNFLLTN
PBPA_RICBR      ----------------------------------------------------------------------
PBPA_RICTY      ----------------------------------------------------------------------
TRG_RALEH       ---DYVPIGKIPRELTGAVVAIEDERFYVHDGIDYIGVVRAGVANL-SDELSQGASTITMQVARNFYLSR
MTGA_NITMU      -----IPYEQISPHLKRAIIAAEDAKFLEHEGFDFDAIQKAYEKNLKKGRLIMGGSTISQQLAKNLFLSG
MTGA_ACIAD      --------DEISDNFKKAVVAAEDGKFVHHHGFDWEGIQYALEKNEKSGEVVNGGSTISQQLAKNLFLYN
MTGA_THIDA      LRHKWVPYDRISNNLKRAVVAAEDARFVEHAGFDVAGIQKAFQKNVKKGRLVAGGSTITQQLAKNLFLSG
MTGA_ALCBS      VQQDWRDYDQISDYLKRAVLISEDAHFTQHTGFDWEGIRYALKRNMEAGKPVAGGSTITQQLAKNLYLSG
MTGA_ACIBT      IHE-WLDYDDISDNFKHAILAGEDAKFIHHHGFDWDGIRFALERNNEQGEVVAGGSTVSQQLAKNLFLYN
MTGA_DECAR      -----VPYERISIHLKRAIIAAEDAKFVDHEGFDWEGIQKAMEKNQKKGRFVAGGSTISQQLAKNLFLTP
MTGA_ACIBY      IHE-WLDYDDISDNFKHAILAGEDAKFIHHHGFDWDGIRFALERNNEEGEVVAGGSTVSQQLAKNLFLYN
MTGA_ACIBS      IHE-WLDYDDISDNFKHAILAGEDAKFIHHHGFDWDGIRFALERNNEEGEVVAGGSTVSQQLAKNLFLYN
MTGA_ACIBC      IHE-WLDYDDISDNFKHAILAGEDAKFIHHHGFDWDGIRFALERNNEQGEVVAGGSTVSQQLAKNLFLYN
MTGA_ACIB5      IHE-WLDYDDISDNFKHAILAGEDAKFIHHHGFDWDGIRFALERNNEEGEVVAGGSTVSQQLAKNLFLYN
MTGA_ACIB3      IHE-WLDYDDISDNFKHAILAGEDAKFIHHHGFDWDGIRFALERNNEEGEVVAGGSTVSQQLAKNLFLYN
MGT_STAAW       ENKSSVSADNMPEYVKGAFISMEDERFYNHHGFDLKGTTRALFSTI-SDRDVQGGSTITQQVVKNYFYDN
MGT_STAAT       ENKSSVSADNMPEYVKGAFISMEDERFYNHHGFDLKGTTRALFSTI-SDRDVQGGSTITQQVVKNYFYDN
MGT_STAAS       ENKSSVSADNMPEYVKGAFISMEDERFYNHHGFDLKGTTRALFSTI-SDRDVQGGSTITQQVVKNYFYDN
MGT_STAAR       ENKSSVSADNMPEYVKGAFISMEDERFYNHHGFDLKGTTRALFSTI-SDRDVQGGSTITQQVVKNYFYDN
MGT_STAAN       ENKSSVSADNMPEYVKGAFISMEDERFYNHHGFDLKGTTRALFSTI-SDRDVQGGSTITQQVVKNYFYDN
MGT_STAAM       ENKSSVSADNMPEYVKGAFISMEDERFYNHHGFDLKGTTRALFSTI-SDRDVQGGSTITQQVVKNYFYDN
MGT_STAAE       ENKSSVSADNMPEYVKGAFISMEDERFYNHHGFDLKGTTRALFSTI-SDRDVQGGSTITQQVVKNYFYDN
MGT_STAAC       ENKSSVSADNMPEYVKGAFISMEDERFYNHHGFDLKGTTRALFSTI-SDRDVQGGSTITQQVVKNYFYDN
MGT_STAAB       ENKSSVSADNMPEYVKGAFISMEDERFYNHHGFDLKGTTRALFSTI-SDRDVQGGSTITQQVVKNYFYDN
MGT_STAA8       ENKSSVSADNMPEYVKGAFISMEDERFYNHHGFDLKGTTRALFSTI-SDRDVQGGSTITQQVVKNYFYDN
MGT_STAA3       ENKSSVSADNMPEYVKGAFISMEDERFYNHHGFDLKGTTRALFSTI-SDRDVQGGSTITQQVVKNYFYDN
MGT_STAA1       ENKSSVSADNMPEYVKGAFISMEDERFYNHHGFDLKGTTRALFSTI-SDRDVQGGSTITQQVVKNYFYDN
MTGA_CHRVO      -----VPYDKISPNLKRALIASEDARFVDHEGFDWDGIEAAFEKNLKKGKIVAGGSTISQQLAKNLFLSS
MGT_STAES       ---DFVATENMPNYVKGAFISMEDERFYKHHGFDIKGTTRALFSTI-SDRDVQGGSTITQQVVKNYYYDN
MGT_STAEQ       ---DFVATENMPNYVKGAFISMEDERFYKHHGFDIKGTTRALFSTI-SDRDVQGGSTITQQVVKNYYYDN
MTGA_NEIGO      -----VPYNRISTNLKKALIASEDVRFAGHGGFDWDGIQNAIRRNRNSGEVKAGGSTISQQLAKNLFLNE
MTGA_NEIG1      -----VPYNRISTNLKKALIASEDVRFAGHGGFDWDGIQNAIRRNRNSGEVKAGGSTISQQLAKNLFLNE
MTGA_MARMS      -----ISIDKLPTYMPLAVVASEDQRFPDHFGVDFTAISKALDQYDDGDGL-RGASTITQQTAKNLFLWS
MTGA_ECOLC      AHSDWVSMDQISPWMGLAVIAAEDQKFPEHWGFDVASIEKALAHNERNENRIRGASTISQQTAKNLFLWD
MTGA_NEIG2      -----VPYNRISTNLKKALIASEDVRFAGHGGFDWGGIQNAIRRNRNSGEVKAGGSTISQQLAKNLFLNE
MTGA_AZOSE      LRHEWVPYDRISIHLKRAVITAEDDTFIDHDGFDWEGMQRALEKNQRKGRAVAGGSTISQQLAKNLFLSP
MGT_STAA9       ENKSSVSADNVPEYVKGAFISMEDERFYNHHGFDLKGTTRALFSTI-SDRDVQGGSTITQQVVKNYFYDN
MGT_STAA2       ENKSSVSADNVPEYVKGAFISMEDERFYNHHGFDLKGTTRALFSTI-SDRDVQGGSTITQQVVKNYFYDN
MGT_STAHJ       -----VSADNMPDYVKGAFISMEDERFYKHHGFDVKGTTRALFSTI-GDRDVQGGSTITQQTVKNYYYDN
MTGA_AZOSB      -----VPYEQISIHLKRAVVAAEDDGFVDHEGFDWDGIQRALEKNERKGRPVSGGSTISQQLAKNLFLSP
MTGA_SHEDO      -----VSIDELPSHLPLAVVASEDQLFPKHFGIDFTSITKALNQYDDGQGL-RGASTITQQTAKNLLLWP
MGT_STAS1       --ESFVYASDMRDYTKGAFIAMEDERFYKHHGFDVKGTSRALFSTL-SDKSVQGGSTITQQVVKNYYYDN
MTGA_NITEU      -----VDYEQISSHLKRAVIAAEDARFLQHQGFDYKAIETAWKKNLKQRKWAAGGSTISQQLAKNLFLST
MTGA_METFK      -------------HLKRAVIAAEDAKFVGHEGFDWDGIQKAYEKNWKQGKIVAGGSTISQQLAKNLFLST
MTGA_PECCP      AHSDWVSMEEIAPEMALAVMAAEDQKFPDHWGFDLDAIGQALKHNERNTQRIRGASTLSQQMVKNLFLWD
MTGA_PHOLL      SHSDWVGQGQISPNIALAVIAAEDQKFPQHWGFDFDAIESVLERNQNHSGRLRGASTISQQTAKNLFLWD
MTGA_RHOCS      -----VPLDAISPHLVAAVVASEDSRFCTHHGIDWDAVEAARDHN-EAGGRLRGASTLSMQTAKNAFLWP
MTGA_HERAR      -----VPYKRISNNLKRAIIASEDSNFSGHEGIDWDALEKAYEKNVRKGKVVAGGSTITQQLAKNLFLSG
MTGA_JANMA      -----IPYNRISNNLKRAIIASEDSNFSEHEGVDWDALQKAYEKNIKKGKVVAGGSTITQQLAKNLFLSG
MTGA_ECO55      AHSDWVSMDQISPWMGLAVIAAEDQKFPEHWGFDVASIEKALAHNERNENRIRGASTISQQTAKNLFLWD
MTGA_SHISS      AHSDWVSMDQISPWMGLAVIAAEDQKFSEHWGFDVASIEKALAHNERNENRIRGASTISQQTAKNLFLWD
MTGA_BURXL      -----VPYDQISRNLKRAIIASEDANFVNNNGYETDAILQAWERNKAKGKIVRGGSTITQQLARNLFLSR
MTGA_NITEC      -----VDYEQISNHLKRAVIATEDARFMQHQGFDYKAIEVAWKKNLKQRKLAAGGSTISQQLAKNLFLSS
MTGA_BORA1      -----VPYDRINVTLKRAVIASEDANFTEHDGVEWDAIRKAWAYNAQGRATIRGGSTITQQLAKNLFLSG
MTGA_SHIDS      AHSDWVSMDQISPWMGLAVIAAEDQKFPEHWGFDVASIEKALAHNERNENRIRGASTISQQTAKNLFLWD
MTGA_PSEAE      --------EQLPDSLKVAVIAGEDQHFAEHHGFDLPAIQQALAHNER-GGSIRGASTLSQQVAKNVFLWS
MTGA_ECOSE      AHSDWVSMDQISPWMGLAVIAAEDQKFPEHWGFDVASIEKALAHNERNENRIRGASTISQQTAKNLFLWD
MTGA_ECOLI      AHSDWVSMDQISPWMGLAVIAAEDQKFPEHWGFDVASIEKALAHNERNENRIRGASTISQQTAKNLFLWD
MTGA_ECOHS      AHSDWVSMDQISPWMGLAVIAAEDQKFPEHWGFDVASIEKALAHNERNENRIRGASTISQQTAKNLFLWD
MTGA_ECODH      AHSDWVSMDQISPWMGLAVIAAEDQKFPEHWGFDVASIEKALAHNERNENRIRGASTISQQTAKNLFLWD
MTGA_ECOBW      AHSDWVSMDQISPWMGLAVIAAEDQKFPEHWGFDVASIEKALAHNERNENRIRGASTISQQTAKNLFLWD
MTGA_ECO8A      AHSDWVSMDQISPWMGLAVIAAEDQKFPEHWGFDVASIEKALAHNERNENRIRGASTISQQTAKNLFLWD
MTGA_ECO24      AHSDWVSMDQISPWMGLAVIAAEDQKFPEHWGFDVASIEKALAHNERNENRIRGASTISQQTAKNLFLWD
MTGA_PASMU      IHYQWVPLEQISQSMQLAVIASEDQRFATHYGFDWDAIQSALQHNQR-GKRIRGGSTISQQTAKNLYLWH
MTGA_ECOUT      AHSDWVSMDQISPWMGLAVIAAEDQKFPEHWGFDVASIEQALAHNERNENRIRGASTISQQTAKNLFLWD
MTGA_ECOSM      AHSDWVSMDQISPWMGLAVIAAEDQKFPEHWGFDVASIEQALAHNERNENRIRGASTISQQTAKNLFLWD
MTGA_ECOLU      AHSDWVSMDQISPWMGLAVIAAEDQKFPEHWGFDVASIEQALAHNERNENRIRGASTISQQTAKNLFLWD
MTGA_ECOL6      AHSDWVSMDQISPWMGLAVIAAEDQKFPEHWGFDVASIEQALAHNERNENRIRGASTISQQTAKNLFLWD
MTGA_ECOL5      AHSDWVSMDQISPWMGLAVIAAEDQKFPEHWGFDVASIEQALAHNERNENRIRGASTISQQTAKNLFLWD
MTGA_ECOK1      AHSDWVSMDQISPWMGLAVIAAEDQKFPEHWGFDVASIEQALAHNERNENRIRGASTISQQTAKNLFLWD
MTGA_ECO81      AHSDWVSMDQISPWMGLAVIAAEDQKFPEHWGFDVASIEQALAHNERNENRIRGASTISQQTAKNLFLWD
MTGA_ECO7I      AHSDWVSMDQISPWMGLAVIAAEDQKFPEHWGFDVASIEQALAHNERNENRIRGASTISQQTAKNLFLWD
MTGA_ECO5E      AHSDRVSMDQISPWMGLAVIAAEDQTFPEHWGFDVASIEKALAHNERNENRIRGASTISQQTAKNLFLWD
MTGA_ECO57      AHSDRVSMDQISPWMGLAVIAAEDQTFPEHWGFDVASIEKALAHNERNENRIRGASTISQQTAKNLFLWD
MTGA_ECO45      AHSDWVSMDQISPWMGLAVIAAEDQKFPEHWGFDVASIEQALAHNERNENRIRGASTISQQTAKNLFLWD
MTGA_ECO27      AHSDWVSMDQISPWMGLAVIAAEDQKFPEHWGFDVASIEQALAHNERNENRIRGASTISQQTAKNLFLWD
MTGA_NITWN      ----------LPPSLPRSVVASEDAKFCSHQGIDWDSL-REVLDDAEDGEFKRGGSTITQQVAKNLFLWP
MTGA_LARHH      ----------------RAIVASEDAKFLQHEGFDWEGIQTAWEKNLQKGRIVAGGSTISQQLAKNLFLSS
MTGA_SHIBS      AHSDWVSMDQISPWMGLAVIAAEDQKFPEHRGFDVASIEKALAHNERNENRIRGASTISQQTAKNLFLWD
MTGA_NITHX      ----------------RSVVASEDAKFCSHHGIDWDSL-RDVLDDAEDGEVKRGGSTITQQVAKNLFLWP
MTGA_AERHH      VKHDWVPLEQISRELQLAVIAAEDQRFAEHNGFDMDAISSALKHNQHSERV-RGASTLSQQTAKNLFMWS
MTGA_YERP3      AHSDWVPMDEISPYMVLAVMAAEDQKFPDHWGFDVGAIESALSHNQRNQKRIRGASTLSQQTAKNVFLWD
MTGA_SALAR      AHSDWVSMEDISPWMGLAVMAAEDQKFPEHWGFDVLAIEKALAHNERNESRIRGASTLSQQTVKNLFLWD
MTGA_RALSO      -----VPYDQISRNLKRAVIASEDADFVSHSGWEVDAMLDAWEKNKRRGHVVAGGSTITQQLAKNLFLSG
MTGA_PSEMY      ------PWNELPDHLKMAVIAAEDQKFAEHWGFDVGAIQAALAHN-QSGGSLRGASTLSQQVAKNLFLWS
MTGA_KLEOX      AHSDWVGMDEISPWMGLAVIAAEDQKFPEHWGFDVPAIEKALAHNERNENRIRGASTLSQQTAKNLFLWD
MTGA_BDEBA      IHKDWVPLEEIAPSVQKAVLKAEDYRFFEHNGFDFDAIEKAMKYN-KTHKRKKGASTITQQTAKNVFLWP
MTGA_YERPS      AHSDWVPMDEISPYMALAVMAAEDQKFPDHWGFDVGAIESALSHNQRNQKRIRGASTLSQQTAKNVFLWD
MTGA_YERPP      AHSDWVPMDEISPYMALAVMAAEDQKFPDHWGFDVGAIESALSHNQRNQKRIRGASTLSQQTAKNVFLWD
MTGA_YERPN      AHSDWVPMDEISPYMALAVMAAEDQKFPDHWGFDVGAIESALSHNQRNQKRIRGASTLSQQTAKNVFLWD
MTGA_YERPG      AHSDWVPMDEISPYMALAVMAAEDQKFPDHWGFDVGAIESALSHNQRNQKRIRGASTLSQQTAKNVFLWD
MTGA_YERPE      AHSDWVPMDEISPYMALAVMAAEDQKFPDHWGFDVGAIESALSHNQRNQKRIRGASTLSQQTAKNVFLWD
MTGA_YERPB      AHSDWVPMDEISPYMALAVMAAEDQKFPDHWGFDVGAIESALSHNQRNQKRIRGASTLSQQTAKNVFLWD
MTGA_YERPA      AHSDWVPMDEISPYMALAVMAAEDQKFPDHWGFDVGAIESALSHNQRNQKRIRGASTLSQQTAKNVFLWD
MTGA_YERPY      AHSDWVPMDEISPYMALAVMAAEDQKFPDHWGFDVGAIESALSHNQRNQKRIRGASTLSQQTAKNVFLWD
MTGA_SALSV      AHSDWVSMADISPWMGLAVIAAEDQKFPEHWGFDVPAIEKALAHNERNESRIRGASTLSQQTAKNLFLWD
MTGA_PSEU5      ------PWRELPDDLKMAVIAAEDQKFADHWGFDVAAIRAALSHNER-GGSLRGASTLSQQVAKNLFLWS
MTGA_BURTA      -----VPYDKISRNLKRAVIASEDADFANNSGYEVDAILQAWEKNRARGRIVSGGSTITQQLARNLFLSG
MTGA_BURPS      -----VPYDQIARTLKRAVIASEDADFANNSGYEVDAILQAWEKNRARGRIVSGGSTITQQLARNLFLSG
MTGA_BURPP      -----VSYDQISRNLKRAIIASEDANFVNNNGYETDAILQAWERNKAKGKIVRGGSTITQQLARNLFLSR
MTGA_BURP8      -----VPYEQISRNLKRAIIASEDANFVNNNGYETDAILQAWERNKARGKIVAGGSTITQQLARNLFLSR
MTGA_BURMA      -----VPYDQIARTLKRAVIASEDADFANNSGYEVDAILQAWEKNRARGRIVSGGSTITQQLARNLFLSG
MTGA_YERE8      AHSDWVPMDEISPYMALAVMAAEDQKFPEHWGFDVGAIESALAHNQRNQNRIRGASTLSQQTAKNLFLWD
MTGA_NEIM0      -----VPYNRISVNLKKALIASEDARFAGHGGFDWGGIQNAIRRNRNSGKVKAGGSTISQQLAKNLFLNE
MTGA_SHEAM      -----VPLDKIAAHMQLAVIAAEDQRFTLHNGVDFAAIKTAIADRD-PGEPLRGASTLTQQTAKNLFLWS
MTGA_SALA4      AHSDWVSMADISPWMGLAVIAAEDQKFPEHWGFDVPAIEKALAHNERNESRIRGASTLSQQTAKNLFLWD
MTGA_PSE14      LQRDWEPWDRISDNLKIAVIAGEDQKFAEHWGFDVDAIQAAILHNER-GGSIRGASTLSQQVSKNLFLWS
MTGA_XANCP      LHHQWRDLDEIAPSLPISVVAAEDQQFPSHHGFDLQAIEKARDYNAR-GGRVRGASTISQQVAKNVFLWQ
MTGA_XANCB      LHHQWRDLDEIAPSLPISVVAAEDQQFPSHHGFDLQAIEKARDYNAR-GGRVRGASTISQQVAKNVFLWQ
MTGA_XANC8      LHHQWRDLDEIAPSLPISVVAAEDQQFPSHHGFDLQAIEKARDYNAR-GGRVRGASTISQQVAKNVFLWQ
MTGA_HAEIE      IQYDWVSLENISPNIQLAVISSEDQRFPEHLGFDFEAIQRAIRYNEKSNKGIRGASTISQQTAKNLMLWH
MTGA_ERWCT      AHSDWVAMDDIXXXXXXXXXXXEDQKFPQHWGFDVDAIGQALKHNERNTQRVRGASTLSQQMVKNLFLWD
MTGA_CITK8      AHSDWAGMDAISPWMGLAVIAAEDQKFPEHWGFDVSAIEKALAHNERNENRIRGASTLSQQTAKNLFLWD
MTGA_SALTY      AHSDWVSMADISPWMGLAVIAAEDQKFPEHWGFDVPAIEKALAHNERNESRIRGASTLSQQTAKNLFLWD
MTGA_SALTI      AHSDWVSMADISPWMGLAVIAAEDQKFPEHWGFDVPAIEKALAHNERNESRIRGASTLSQQTAKNLFLWD
MTGA_SALPB      AHSDWVSMADISPWMGLAVIAAEDQKFPEHWGFDVPAIEKALAHNERNESRIRGASTLSQQTAKNLFLWD
MTGA_SALNS      AHSDWVSMADISPWMGLAVIAAEDQKFPEHWGFDVPAIEKALAHNERNESRIRGASTLSQQTAKNLFLWD
MTGA_PSEU2      LQRDWEPLDKISDNLKIAVIAGEDQKFAEHWGFDVDAIQAAILHNER-GGSIRGASTLSQQVSKNLFLWS
MTGA_NEIME      -----MPYKRISTNLKKALIASEDARFAGHGGFDWGGIQNAIRRNRNSGKVKAGGSTISQQLAKNLFLNE
MTGA_NEIMB      -----MPYKRISTNLKKALIASEDARFAGHGGFDWGGIQNAIRRNRNSGKVKAGGSTISQQLAKNLFLNE
MTGA_NEIMA      -----MPYKRISTNLKKALIASEDARFAGHGGFDWGGIQNAIRRNRNSGKVKAGGSTISQQLAKNLFLNE
MTGA_SHEFN      -----VSIDELPAHMPLAVVAAEDQLFPEHFGVDINSITKALNQYDDGEGL-RGASTITQQTAKNLLLWP
MTGA_SALPC      AHSDWVSMADISPWMGLAVIAAEDQKFPEHWGFDVPAIEKALAHNERNESRIRGASTLSQQTAKNLFLWD
MTGA_SALHS      AHSDWVSMADISPWMGLAVIAAEDQKFPEHWGFDVPAIEKALAHNERNESRIRGASTLSQQTAKNLFLWD
MTGA_SALG2      AHSDWVSMADISPWMGLAVIAAEDQKFPEHWGFDVPAIEKALAHNERNESRIRGASTLSQQTAKNLFLWD
MTGA_SALEP      AHSDWVSMADISPWMGLAVIAAEDQKFPEHWGFDVPAIEKALAHNERNESRIRGASTLSQQTAKNLFLWD
MTGA_SALCH      AHSDWVSMADISPWMGLAVIAAEDQKFPEHWGFDVPAIEKALAHNERNESRIRGASTLSQQTAKNLFLWD
MTGA_RHOP2      -----VDIERMAPALPRTVVASEDAKFCSHSGIDWDSVRDVLDDLQDGGEASRGGSTITQQVAKNLFLWP
MTGA_PSEP1      LQRDWEPWENISDELKVAVIAGEDQKFANHWGFDLPAIQAALAHNER-GGNIRGASTLTQQVAKNLFLWS
MTGA_PSEPK      LQRDWEPWENISDELKVAVIAGEDQKFASHWGFDLPAIQAALAHNER-GGNIRGASTLTQQVAKNLFLWS
MTGA_PSEE4      LQRDWTPWEDISDELKVAVIAGEDQKFASHWGFDIPAIQAALAYNER-GGKVRGASTLTQQVAKNMFLWS
MTGA_NEIMF      -----VPYNRISVNLKKALIASEDAHFAGHGGFDWGGIQNAIRRNRNSGKVKAGGSTISQQLAKNLFLNE
MTGA_HAEIN      -----VSLENISPNIQLAVISSEDQRFLEHLGFDFEAIQRAIRYNEKSNKGIRGASTISQQTAKNLMLWH
MTGA_BURVG      IQHQWVPYDQISRNLKRALIASEDATFATNNGYDVDAILQAWEKNKARGHIVAGGSTITQQLARNLFLSR
MTGA_BURS3      IQHQWVPYDQISRNLKRALIASEDSTFATNNGYDVDAILQAWEKNKARGRIVAGGSTITQQLARNLFLSR
MTGA_BURCH      IRHQWVPYDQISRNLKRALIASEDSTFATNNGYDVDAILQAWEKNKARGRIVAGGSTITQQLARNLFLSR
MTGA_BURCC      IRHQWVPYDQISRNLKRALIASEDSTFATNNGYDVDAILQAWEKNKARGRIVAGGSTITQQLARNLFLSR
MTGA_BURCA      IRHQWVPYDQISRNLKRALIASEDSTFATNNGYDVDAILQAWEKNKARGRIVAGGSTITQQLARNLFLSR
MTGA_PSEPG      LQRDWEPWENISDELKVAVIAGEDQKFASHWGFDIPAIQAALAYNER-GGNVRGASTLTQQVAKNLFLWS
MTGA_BURCM      -----VPYDQISRNLKRALIASEDSTFATNNGYDVDAILQAWEKNKARGRIVAGGSTITQQLARNLFLSR
MTGA_BURA4      -----VPYDQISRNLKRALIASEDSTFATNNGYDVDAILQAWEKNKARGRIVAGGSTITQQLARNLFLSR
MTGA_BRAJA      -----IDLAAMSPYLPRSVVAAEDAHFCKHHGIDWGALREAIDDAKEDGTAFRGASTITQQVAKNLFLWQ
MTGA_SALPK      AHSDWVSMADISPWMGLAVITAEDQKFPEHWGFDVPAIEKALAHNERNESRIRGASTLSQQTAKNLFLWD
MTGA_SALPA      AHSDWVSMADISPWMGLAVITAEDQKFPEHWGFDVPAIEKALAHNERNESRIRGASTLSQQTAKNLFLWD
MTGA_PSEPW      LQRDWQPWESISDDLKVAVIAGEDQKFANHWGFDIPAIQAALAYNER-GGNIRGASTLTQQVAKNLFLWS
MTGA_BURM1      IQHQWVPYDKISRNLKRAIIASEDATFATNNGYDVDAILQAWEKNKARGRIVAGGSTITQQLARNLFLSR
MTGA_BORPE      -----VPYDRISNTLKQAVVASEDANFTEHDGVEWDAIRKAWEYNQRQAEKMRGGSTITQQLAKNLFLSG
MTGA_BORPA      -----VPYDRISNTLKQAVVASEDANFTEHDGVEWDAIRKAWEYNQRQAEKMRGGSTITQQLAKNLFLSG
MTGA_BORBR      -----VPYDRISNTLKQAVVASEDANFTEHDGVEWDAIRKAWEYNQRQAEKMRGGSTITQQLAKNLFLSG
MTGA_RHOPS      -----VDIERISPALPRTVVASEDAKFCSHRGIDWDSV-RDVIDDMQDGEATRGGSTITQQVAKNLFLWP
MTGA_ENTS8      AHSDWVSMDEISPWMGLAVIAAEDQTFPEHWGFDVAAIQKAVAHNENSRRI-RGASTLSQQTAKNLFLWD
MTGA_CAUCR      DHRWR-PMDKISPALPRVLIAAEDAKFCEHRGFDFEALQKAY-ENNESGRKIRGGSTISQQTAKNVFLWP
MTGA_CAUCN      DHRWR-PMDKISPALPRVLIAAEDAKFCEHRGFDFEALQKAY-ENNESGRKIRGGSTISQQTAKNVFLWP
MTGA_XANC5      LHQQWRDYDKIAASLPILVVAAEDQQFPMHHGFDLQAIEKARDHNAR-GGRVRGASTISQQVAKNVFLWQ
MTGA_XANAC      -----------------SVVAAEDQQFPMHHGFDLQAIEKARDHNAR-GGRVRGASTISQQVAKNVFLWQ
MTGA_RHOPT      -----IDIENISPALPRSVVAAEDAKFCSHHGIDWDSV-RDVIDDMQDGEASRGGSTITQQVAKNLFLWP
MTGA_RHOPA      -----IDIENISPALPRSVVAAEDAKFCSHHGIDWDSV-RDVIDDMQDGEASRGGSTITQQVAKNLFLWP
MTGA_SALDC      AHSDWVSMADISPWMGLAVIAAEDQKFPEHWGFDVPAIEKALAHNERNESRIRGASTLSQQTAKNLFLWD
MTGA_PSEFS      -----VPWDEISDDLKVAVMAGEDQRFPQHWGFDFGAIQAAIQHNER-GGSIRGASTLSQQVSKNLFLWA
MTGA_PSESM      LQRDWEPWDKISNNLKIAVIAGEDQKFAEHWGFDVDAIQAAILHNEQ-GGSIRGASTLSQQVSKNLFLWS
MTGA_RALME      -----VRYDEISRNIKRAVIASEDADFVNHPGYELDAMLDAWERNKQRGRIVRGGSTITQQLAKNLFLSS
MTGA_XANOR      -----------------SVVAAEDQQFPMHHGFDLQAIEKARDHNAR-GGRVRGASTISQQVAKNVFLWQ
MTGA_XANOM      -----------------SVVAAEDQQFPMHHGFDLQAIEKARDHNAR-GGRVRGASTISQQVAKNVFLWQ
MTGA_PSEF5      ------PWDEISDNLKVAVIAGEDQKFPEHWGFDIDAIQAALIHNER-GGSIRGASTLSQQVSKNLFLWS
MTGA_PSEPF      ------PWDEISDDLKVAVIAGEDQKFPEHWGFDLSAIKAALAHN-ELGGSIRGASTLSQQVSKNLFLWS
MTGA_BACTN      -----VSFDKISPHLPMAVIASEDNRFAEHNGFDFIEIEKAMKENEKRKR-KRGASTISQQTAKNVFLWP
MTGA_VIBPA      -----------------AVIATEDQKFPHHYGVDFESLFDVISE-AGDHGPSRGASTITQQAAKNVFLFP
MTGA_SHEON      -------LEQISPELQLAVIAAEDQKFAGHSGFDLDAISSAIEYNQK-GKKVRGASTLSQQAAKNLFMWS
MTGA_MESSB      ------PLEEAGRNVIHSVMMSEDGQFCSHRGIDLGELKAAINE-ALSGERTRGASTIPMQTVKNLYLWP
MTGA_CYTH3      ------PIKEISPNMVCAVIASEDHHFLEHNGFDWEAIRAARAYNERKNGIKRGASTISQQTAKNVFLFP
PBPA_MYCS2      ----------------------------------------------------------------------
MTGA_MANSM      VNYDWISLEDISPYMQLAVIAAEDQNFPNHGGFDWNAIKSAIKYNEKSSRI-RGASTISQQTAKNMFLWH
MTGA_BACFR      CKHTWVPFDKISPSLPMAVIASEDNRFASHNGFDMIEIKKAMKEN-ETRKKKRGASTISQQTAKNVFLWP
MTGA_BACFN      CKHTWVPFDKISPSLPMAVIASEDNRFASHNGFDMIEIKKAMKEN-ETRKKKRGASTISQQTAKNVFLWP
MTGA_RHIE6      -----VSLDQISPALVQSVMMSEDGQYCFHGGVDWAEM-RMLVEDTLKGQATRGGSTIPMQTAKNLFLWN
MTGA_RHILW      -----VSLDEIAPVLVQSVMMSEDGQYCFHGGVDWAEM-RMLVEDTLKGQATRGGSTIPMQTAKNLFLWN
MTGA_RHIEC      -----VSLDEISPVLVQSVMMSEDGQYCFHGGVDWAEM-RMLVEDTLKGQATRGGSTIPMQTAKNLFLWN
MTGA_RHORT      --KDWVPLEAIAPALRRAVIASEDGRFCQHGGFDTKELEKAWSDYQR-GDRLRGASTLSMQTAKNLMLWD
MTGA_CHRSD      ------PWNALSDNAKLAVIASEDQRFPMHHGFDFNQMQKAL-DAWFSGDSLRGASTISQQTAKNLFLWT
MTGA_RALEJ      -----VPYDQISRNLKRAVIASEDADFVNHPGYEIDAMLDAWERNXXXXXXXXXXSTITQQLAKNLFLSS
MTGA_RHIL3      -----VSLDNIAPVVVQSVMMSEDGQYCFHGGVDWAEM-RMLVEDTLKGQATRGGSTIPMQTAKNLFLWN
MTGA_AGRT5      -----VPLEDISPRLVQSVMMSEDGQFCFHGGVDWNQMQSVVS-NALDGASTRGASTIPMQTAKNLFLWN
MTGA_RHILO      -----VSIDDVAPVLAHSVIMSEDGQFCFHRGVD-LGELRGVVDDALAGEATRGASTITMQTVKNLFLSR
MTGA_RHIME      -----VEFDDIAPVLVQSVMMSEDGQFCAHAGIDWAQM-RGVVEDALDGEQTRGASTIPMQTVKNLFLWN
MTGA_XYLFA      -----------------SLVAAEDQRFPLHHGFDFDAIKKXXXXXXXXXXXXXXX-TISQQVAKNLFLWS
MTGA_XYLFT      -----------------SLVAAEDQRFPFHHGFDFDAIKKXXXXXXXXXXXXXXX-TISQQVAKNLFLWS
MTGA_XYLF2      -----------------SLVAAEDQRFPFHHGFDFDAIKKXXXXXXXXXXXXXXX-TISQQVAKNLFLWS
MTGA_XYLFM      -----------------SLVAAEDQRFPFHHGFDFDAI-KNXXXXXXXXXXXXXXXTISQQVAKNLFLWS
MTGA_BRUSU      VNRQWVDIENIAPVLVNSVMMAEDGQFCSHGGVDW-HQXXXXXXXXXXXXPSRGASTITMQMVKNLFLWN
MTGA_BRUME      VNRQWVDIENIAPVLVNSVMMAEDGQFCSHGGVDW-HQXXXXXXXXXXXXPSRGASTITMQMVKNLFLWN
MTGA_JANSC      IERDWVPMDQIAPVLARSVVAAEDANFCLHWGFDM-----TXXXXXXXXXXXXXXSTISQQTVKNAFLWH
SP5D_BACSU      ----------------------------------------------------------------------
FTSI_MESVI      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ERSLERKIKEAFLALWLESNMSKKEILSLYLDRAYMXXXXXXXXXXXXXXXXKNLTDVTLSESAILAGLF
PBPF_BACSU      DKTFLRKTKEVIIAINLERDYSKDKLLEMYLNQLYFGHGVYGIQAASHYYFNKEVKDLTVSEGAVLAAIP
PBPB_VIBCH      DRTLWRKLREAYMALIIDYRYSKDRILEAYLNEVYLADAIHGFGLASRLYFGQPLQELRIDQLALLVGMV
PBPD_BACSU      ERSFSRKLTELAYSYQLEKKYTKNEILEAYLNTIYFNNGVYGVGSAAQFYFSKPLKSLTVGEMAFICAIP
PBPG_BACSU      DKTWKRKWNEAFYTIRLEQNYSKDEILEGYLNTIYYGHGAYGIEAASRLYFGKHAKNLTDAEAALLAGIP
PBPA_BACSU      QKTLKRKVQEVWLSIQLERNYSKDEILEMYLNRIYFPRAYGIGKAAEEFFGVTDLSKLTVEQAATLAGMP
PBPB_HAEIN      ERTITRKANEALMSLVLDWRYDKNRILETYLNEIYLDTQIHGFELASQFYFGRSIREISLDQIALLVGMV
PBPB_ECOLI      ERSYWRKANEAYMALIMDARYSKDRILELYMNEVYLDNEIRGFPLASLYYFGRPVEELSLDQQALLVGMV
PBPB_BUCAI      TRSILRKINEIYMALILDRFYTKDRILELYLNEVYLDEQIRGFPLASIYYFGRPINELNLEQYALLVGMV
PBPB_BUCBP      IRSLWRKINEIYMALILDFQYSKEKILELYLNEVYLNEQIRGFALASLYYFGRPINELRLDECALLVGMV
PBPA_CLOTE      EVRIKRKVQEMYLSIQLEKKVSKEQILEAYMNTIPLGGSAYGIEAASKQYFGKSVKDLNLIESAFIAGLP
PBPA_CLOPS      EVSYERKIKEMYLALELEKHLSKDEILTTYLNTIPMGGYQYGVSAAAQRFFSKNVSDLNLIECAYLGGLT
PBPA_CLOPE      EVSYERKIKEMYLALELEKHLSKDEILTTYLNTIPMGGYQYGVSAAAQRFFSKNVSDLNLVECAYLGGLT
PBPA_CLOP1      EVSYERKIKEMYLALELEKHLSKDEILTTYLNTIPMGGYQYGVSAAAQRFFSKNVSDLNLVECAYLGGLT
PBPA_AQUAE      ERTLERKIKEALLAIKIERTFDKKKIMELYLNQIYLGSGAYGVEAAAQVYFGKHVWELSLDEXXXXXXXX
PBPA_CLOAB      DSSFKRKIQEAYLSIKLEQSLSKSQILEAYMNTIFLGVQANGVEAASRQYFNKSAKDLNLIECAFIAGLA
PBPA_NEIFL      ERSFTRKFNEALLAYKIEQSLSKDKILELYFNQIYLGQRAYGFASAAQTYFNKNVNDLTLAEAAMLAGLP
PBPA_CLOBH      EVSIKRKVQEMYLSIQLEKELSKDEILGAYMNSIFLGGNALGVEAASKQYFNKSVKDLSLIECAFIAGVX
PBPA_CLOB1      EVSIKRKVQEMYLSIQLEKELSKDEILGAYMNSIFLGGNALGVEAASKQYFNKSVKDLSLIECAFIAGVX
PBPC_ECOLI      PKTFGGKIRQLWRALQLEWHLSKREILTLYLNRAPFGGTLQGIGAASWAYLGKSPANLSYSEAAMLAVLP
PBPA_CLOBL      EVSIKRKVQEMYLSIQLEKELSKDEILGAYMNSIFLGGNALGVEAASKQYFNKSVKDLSLIECAFIAGVX
PBPA_CLONN      GNSLNRKVQEWYLAPKLEKEVGKKSIMEAYLNTIYLGGRAIGVGAAADQYFNVSIDKLDLVQCAFIAGLP
PBPA_NEILA      EKTFTRKFNEALLAYKIEQSLSKDKILELYFNQIYLGQRAYGFASAAQIYFNKDVRDLTLAEAAMLAGLP
PBPA_PSEAE      ERSFSRKINEILLALQIERQLTKDEILELYVNKIYLGNRAYGIEAAAQVYYGKPIKDLSLAEMAMIAGLP
PBPA_ECOLI      ERTLMRKIKEVFLAIRIEQLLTKDEILELYLNKIYLGYRAYGVGAAAQVYFGKTVDQLTLNEMAVIAGLP
PBPA_HAEIN      EKTIIRKAREAVLAVEIENTLNKQEILELYLNKIFLGYRSYGVAAAAQTYFGKSLNELTLSEMAIIAGLP
PBPA_STRPN      DQTISRKAQEAWLAIQLEQKATKQEILTYYINKVYMSNGNYGMQTAAQNYYGKDXXXXXXXXXXXXXGMP
PBPA_XYLFA      ----------------------------------------------------------------------
PBPA_NEICI      EKTFTRKFNEALLAYKIEQSLSKDKILELYFNQIYLGQRAYGFASAAQIYFNKDVRELTLAEVAMLAGLP
PBPA_STRR6      DQTISRKAQEAWLAIQLEQKATKQEILTYYINKVYMSNGNYGMQTAAQNYYGKDXXXXXXXXXXXXXGMP
PBPA_XYLFT      ----------------------------------------------------------------------
PBPA_VIBCH      EKKVMRKVKEIFIAIHIEQLLSKQEILELYLNKIYLGYRSYGVGAAAQAYFGKEVKDLTLGEIALIAGLP
PBPA_NEIMB      ----------------------------------------------------------------------
PBPA_NEIMA      ----------------------------------------------------------------------
PBPA_STROR      DQTLSRKAQEAWLAVQLEQKATKQEILTYYINKVYMSNGNYGMQTAAQSYYGKDLKDLSIPQLALLAGMP
PBPA_RICFE      EVSLERKIKEAILSYMISRVFTKEQILELYLNQTFFGRGAYGVAAAAQNYFNKSVEELTIAESAFIAALP
PBPA_NEIGO      EKTFTRKFNEVLLAYKIEQSLSKDKILELYFNQIYLGQRAYGFASAAQIYFNKNVRDLTLAEAAMLAGLP
PBPA_NEIG1      EKTFTRKFNEVLLAYKIEQSLSKDKILELYFNQIYLGQRAYGFASAAQIYFNKNVRDLTLAEAAMLAGLP
PBPA_RICPR      EVSLERKIKEVIISYMISRIFTKHQILELYLNQTFFGRGAYGVAAAAQNYFNKSVEELTIAESAFIAALP
PBPA_RICCN      EVSLERKIKEAILSYMISRVFTKDQILELYLNQTFFGRGAYGVAVAAQNYFNKSVEELTIAESAFIAALP
PBPA_RICBR      ----------------------------------------------------------------------
PBPA_RICTY      -----------------------------------------------------------LAENALRKGLR
TRG_RALEH       DKTYTRKLYEVLLSYRIEKALTKDEILELYMNKIYLGQGAYGFADAARTYFGKRLDQLTLAECAMLAGLP
MTGA_NITMU      DKTPWRKLQEAFITLMLEKVMSKRRILEIYLNVIEWGNVVFGAEAAARHYYGISASSVSREQAARLAAMV
MTGA_ACIAD      QRSLIRKGQEAIATWMMERMWSKQRILEVYMNSVQFGDHLYGVEAASHYYFHRSAQNLTRDQAAFLAALL
MTGA_THIDA      ERSFLRKGQEVVITLMIESTWSKRRILEVYLNVIEWGNGIYGAEAASRRYYKKSAATLSRDQAARMAAMI
MTGA_ALCBS      ERTYTRKAQEAVIALMLEIGLSKRRILELYLNVA------------------------------------
MTGA_ACIBT      KRSFIRKGQETVATWMMERMWSKRRILEVYMNSVEFGKNLYGVEAAAQYYYGKSAKNLTREQAAFLAALL
MTGA_DECAR      TKSYFRKVEEAIITLMLENLWSKKRIFEVYLN--------------------------------------
MTGA_ACIBY      KRSFIRKGQETVATWMMERMWSKRRILEVYMNSVEFGKNLYGVEAAAQYYYGKSAKSLTREQAAFLAALL
MTGA_ACIBS      KRSFIRKGQETVATWMMERMWSKRRILEVYMNSVEFGKNLYGVEAAAQYYYGKSAKSLTREQAAFLAALL
MTGA_ACIBC      KRSFIRKGQETVATWMMERMWSKRRILEVYMNSVEFGKNLYGVEAAAQYYYGKSAKSLTREQAAFLAALL
MTGA_ACIB5      KRSFIRKGQETVATWMMERMWSKRRILEVYMNSVEFGKNLYGVEAAAQYYYGKSAKSLTREQAAFLAALL
MTGA_ACIB3      KRSFIRKGQETVATWMMERMWSKRRILEVYMNSVEFGKNLYGVEAAAQYYYGKSAKSLTREQAAFLAALL
MGT_STAAW       DRSFTRKVKELFVAHRVEKQYNKNEILSFYLNNIYLEGAANHYFGTTVNKNSTTMSHITVLQSAILASKV
MGT_STAAT       DRSFTRKVKELFVAHRVEKQYNKNEILSFYLNNIYLEGAANHYFGTTVNKNSTTMSHITVLQSAILASKV
MGT_STAAS       DRSFTRKVKELFVAHRVEKQYNKNEILSFYLNNIYLEGAANHYFGTTVNKNSTTMSHITVLQSAILASKV
MGT_STAAR       DRSFTRKVKELFVAHRVEKQYNKNEILSFYLNNIYLEGAANHYFGTTVNKNSTTMSHITVLQSAILASKV
MGT_STAAN       DRSFTRKVKELFVAHRVEKQYNKNEILSFYLNNIYLEGAANHYFGTTVNKNSTTMSHITVLQSAILASKV
MGT_STAAM       DRSFTRKVKELFVAHRVEKQYNKNEILSFYLNNIYLEGAANHYFGTTVNKNSTTMSHITVLQSAILASKV
MGT_STAAE       DRSFTRKVKELFVAHRVEKQYNKNEILSFYLNNIYLEGAANHYFGTTVNKNSTTMSHITVLQSAILASKV
MGT_STAAC       DRSFTRKVKELFVAHRVEKQYNKNEILSFYLNNIYLEGAANHYFGTTVNKNSTTMSHITVLQSAILASKV
MGT_STAAB       DRSFTRKVKELFVAHRVEKQYNKNEILSFYLNNIYLEGAANHYFGTTVNKNSTTMSHITVLQSAILASKV
MGT_STAA8       DRSFTRKVKELFVAHRVEKQYNKNEILSFYLNNIYLEGAANHYFGTTVNKNSTTMSHITVLQSAILASKV
MGT_STAA3       DRSFTRKVKELFVAHRVEKQYNKNEILSFYLNNIYLEGAANHYFGTTVNKNSTTMSHITVLQSAILASKV
MGT_STAA1       DRSFTRKVKELFVAHRVEKQYNKNEILSFYLNNIYLEGAANHYFGTTVNKNSTTMSHITVLQSAILASKV
MTGA_CHRVO      GKTPWRKLEEALITVMLETVLDKRRIYEIYLNVIEWGNGVFGAEAASRYYFRTGASRLSSSQAAKLAAMV
MGT_STAES       ERSFTRKIKELFVARKVEKQYSKNQILSFYMNNIYVEGAANHYFGVTVDKNNSNMSQISVLQSAILASKV
MGT_STAEQ       ERSFTRKIKELFVARKVEKQYSKNQILSFYMNNIYVEGAANHYFGVTVDKNNSNMSQISVLQSAILASKV
MTGA_NEIGO      SRNYLRKGEEAAITAMMEAVTDKNRIFELYLNSIEWHYGVFGAEAASRYFYKKPAADLTKQQAAKLTALV
MTGA_NEIG1      SRNYLRKGEEAAITAMMEAVTDKNRIFELYLNSIEWHYGVFGAEAASRYFYKKPAADLTKQQAAKLTALV
MTGA_MARMS      GRSFIRKGLEAGLAIGLETLWGKKRILEVYLNIAEFGKGIYGVEAASQHYFGRSASKLTMNQAARLAVLL
MTGA_ECOLC      GRSWVRKGLEAGLTLGIETVWSKKRILTVYLNIAEFGDGVFGVEAAAQRYFHKPASKLTRSEAALLAAVL
MTGA_NEIG2      SRNYLRKGEEAAITAMMEAVTDKNRIFELYLNSIEWHYGVFGAEAASRYFYKKPAADLTKQQAAKLTALV
MTGA_AZOSE      SKSYFRKAQEALITVMIEAVWSKRRILEVYLNVVEWGNGIFGCEAAARRYFRVAASRLGPAEAARLAVML
MGT_STAA9       DRSFTRKVKELFVAHRVEKQYNKNEILSFYLNNIYLEGAANHYFGTTVNKNSTTMSHITVLQSAILASKV
MGT_STAA2       DRSFTRKVKELFVAHRVEKQYNKNEILSFYLNNIYLEGAANHYFGTTVNKNSTTMSHITVLQSAILASKV
MGT_STAHJ       ERSFTRKLKELFVAHKVEQQYSKNEILSFYLNNIYIESAANYYFGTTVNKNSDSMSQITVLQSAILASKV
MTGA_AZOSB      SRSYFRKAQEAVITVMIEQLWSKRRILEVYLN--------------------------------------
MTGA_SHEDO      GRNLVRKGLEAMLAVSLEAVWGKKRILEVYLNVAEFGKGIYGVEAASRHYFNKSARYLSINEAARLAVLL
MGT_STAS1       EQSITRKIKELFVAHRVEKEYDKNEILSFYMNNIYIESAANHYFGVTTDKNNPNLPQISVLQSAILASKI
MTGA_NITEU      EKTVWRKSRETLITLMLEEFLTKRRILEIYLNIIEWGDGIFGIEAAARHYFGISAASLTPAQAAWLASII
MTGA_METFK      KRTPWRKLEEAVITWMLERMMSKRRIFEIYLNVIEWGNGVFGAEAAARHYYRTSASSLNVAQAARLAAMI
MTGA_PECCP      GRSWVRKGLEAGITTGVELVWTKRRILTVYLNIAEFGPGIFGVEAAARRYFNKPASRLTASESALLAAVL
MTGA_PHOLL      GRSWLRKGLEAGMTFAIELGWSKSRILTVYLNIAEFGDGIFGVEEASKHYFHKSASKLTASEAALLAAVL
MTGA_RHOCS      DRTWLRKGAELGFTLLIEATWPKRRIAEVYLNLAEWGDGIFGAEAAARRHFGKPAADLSAQEAALLAAVL
MTGA_HERAR      DRSYIRKGQEVVITYMLEYWMDKERIFEIYLNVVEWGVGVFGAEAAAQHYYGTSAAQLSAPQAARLAVML
MTGA_JANMA      DRSYLRKGQEVIITYMLEYWMDKERIFEIYLN--------------------------------------
MTGA_ECO55      GRSWVRKGLEAGLTLGIETVWSKKRILTVYLNIA------------------------------------
MTGA_SHISS      GRSWVRKGLEAGLTLGIETVWSKKRILTVYLNIA------------------------------------
MTGA_BURXL      EKSYIRKGQELIITWMLETLMDKERIFEIYLNSVEWGNGVYGAEAAAHYYFKTSASKLTAAQSARLAVML
MTGA_NITEC      EKTVWRKLQXXXXXXXXXXFLSKRRILEIYLNVIEWGEGVFGIEAAARHYFGIPASSLAPEQSAWLASII
MTGA_BORA1      SRSYLRKGQELILTYMIEHVMSKERILELYLNIAEWGVGIFGAEAAARHYYGISAANLNASQSARLAAML
MTGA_SHIDS      GRSWVRKGLEAGLTLGIETVWSKKRILTVYLNIA------------------------------------
MTGA_PSEAE      GRSWLRKGLEAWFTLLIETLWTKQRILEVYLNSAEWGPGVFGAQAAARYHFGLDAERLSRTQASQLAAVL
MTGA_ECOSE      GRSWVRKGLEAGLTLGIETVWSKKRILTVYLNIA------------------------------------
MTGA_ECOLI      GRSWVRKGLEAGLTLGIETVWSKKRILTVYLNIA------------------------------------
MTGA_ECOHS      GRSWVRKGLEAGLTLGIETVWSKKRILTVYLNIA------------------------------------
MTGA_ECODH      GRSWVRKGLEAGLTLGIETVWSKKRILTVYLNIA------------------------------------
MTGA_ECOBW      GRSWVRKGLEAGLTLGIETVWSKKRILTVYLNIA------------------------------------
MTGA_ECO8A      GRSWVRKGLEAGLTLGIETVWSKKRILTVYLNIA------------------------------------
MTGA_ECO24      GRSWVRKGLEAGLTLGIETVWSKKRILTVYLNIA------------------------------------
MTGA_PASMU      GQSWLRKAIEMPTTLVLETLWSKKRILEVYLNIAEFGPNIFGVEAASQHYFRKPAKQLSNAEAALLAAVL
MTGA_ECOUT      GRSWVRKGLEAGLTLGIETVWSKKRILTVYLNIA------------------------------------
MTGA_ECOSM      GRSWVRKGLEAGLTLGIETVWSKKRILTVYLNIA------------------------------------
MTGA_ECOLU      GRSWVRKGLEAGLTLGIETVWSKKRILTVYLNIA------------------------------------
MTGA_ECOL6      GRSWVRKGLEAGLTLGIETVWSKKRILTVYLNIA------------------------------------
MTGA_ECOL5      GRSWVRKGLEAGLTLGIETVWSKKRILTVYLNIA------------------------------------
MTGA_ECOK1      GRSWVRKGLEAGLTLGIETVWSKKRILTVYLNIA------------------------------------
MTGA_ECO81      GRSWVRKGLEAGLTLGIETVWSKKRILAVYLNIA------------------------------------
MTGA_ECO7I      GRSWVRKGLEAGLTLGIETVWSKKRILTVYLNIA------------------------------------
MTGA_ECO5E      GRSWVRKGLEAGLTLGIETVWSKKRILTVYLNIA------------------------------------
MTGA_ECO57      GRSWVRKGLEAGLTLGIETVWSKKRILTVYLNIA------------------------------------
MTGA_ECO45      GRSWVRKGLEAGLTLGIETVWSKKRILTVYLNIA------------------------------------
MTGA_ECO27      GRSWVRKGLEAGLTLGIETVWSKKRILTVYLNIA------------------------------------
MTGA_NITWN      GRSMVRKALEFPLAMWIDAVLSKQRILEIYLNIAWGPGGQFGVEAGSRYAFGRSAASLTAREAALMAAIL
MTGA_LARHH      RRTPWRKAEEALITVMLEAVMDKRRIFEIYLNVIEWGDGVFGAESAARHYYRVPASRLSAGQAAKLAAMV
MTGA_SHIBS      GRSWVRKGLEAGLTLGIETVWSKKRILTVYLNIA------------------------------------
MTGA_NITHX      GRSVIRKALEFPLAMWIDAVLPKQRILEIYLNIAWGPDGQFGVEAGSRYAFGRSATGLTAREAALMAAIL
MTGA_AERHH      DRSFLRKGIEAWFTLLMELGWDKSRILEMYLNIVEFGPGIYGAEAAARHYFGKPAARLTRYEASLLAAAL
MTGA_YERP3      GRSWVRKGLEVGLTAGIELIWTKRRILTVYLNIA------------------------------------
MTGA_SALAR      GRSWVRKGLEAGLTLGIETVWSKKRILTVYLNIAEFGDGIFGVEAAARRYFNKPASRLNMTEXXXXXXXX
MTGA_RALSO      ERHYLRKGEELVITWMLEFWLDKERILEIYLN--------------------------------------
MTGA_PSEMY      GRSWPRKALEAWFTALIELFWPKERILEVYLN--------------------------------------
MTGA_KLEOX      GRSWLRKGLEAGLTVGIETVWSKKRILTVYLNIA------------------------------------
MTGA_BDEBA      QRDWVRKGLEAYFTILIESTWPKERIMEVYLN--------------------------------------
MTGA_YERPS      GRSWVRKGLEVGLTAGIELIWTKRRILTVYLNIA------------------------------------
MTGA_YERPP      GRSWVRKGLEVGLTAGIELIWTKRRILTVYLNIA------------------------------------
MTGA_YERPN      GRSWVRKGLEVGLTAGIELIWTKRRILTVYLNIA------------------------------------
MTGA_YERPG      GRSWVRKGLEVGLTAGIELIWTKRRILTVYLNIA------------------------------------
MTGA_YERPE      GRSWVRKGLEVGLTAGIELIWTKRRILTVYLNIA------------------------------------
MTGA_YERPB      GRSWVRKGLEVGLTAGIELIWTKRRILTVYLNIA------------------------------------
MTGA_YERPA      GRSWVRKGLEVGLTAGIELIWTKRRILTVYLNIA------------------------------------
MTGA_YERPY      GRSWIRKGLEVGLTAGIELIWTKRRILTVYLNIA------------------------------------
MTGA_SALSV      GRSWVRKGLEAGLTLGIETVWSKKRILTVYLNIAEFGDGIFGVEAAAQRYFHKPASRLSMSEXXXXXXXX
MTGA_PSEU5      GRSWPRKGLEAWFTALIELMWPKQRILEVYLN--------------------------------------
MTGA_BURTA      ERSYIRKGQELIITWMLETLLDKERIFEIYLNSVEFGRGVYGAEAAAQYYYRIPASRLSAWQSARLAVML
MTGA_BURPS      ERSYIRKGQELIITWMLETLLDKERIFEIYLNSVEFGRGVXXXXXXXXXXXRIPASRLSAWQSARLAVML
MTGA_BURPP      EKSYIRKGQELIITWMLETLMDKERIFEIYLNSVEWGNGVYGAEAAAHYYYKTSASKLTAAQSARLAVML
MTGA_BURP8      EKSYIRKGQELIITWMLETLMDKERIFEIYLNSVEWGNGVYGAEAAARYYFRTSAAKLTAGQSARLAVML
MTGA_BURMA      ERSYIRKGQELIITWMLETLLDKERIFEIYLNSVEFGCGVXXXXXXXXXXXRIPASRLSAWQSARLAVML
MTGA_YERE8      GRSWVRKGLEVGLTAGIELVWTKRRILTVYLNIA------------------------------------
MTGA_NEIM0      SRSYIRKGEEAAITAMMEAVTDKDRIFELYLN--------------------------------------
MTGA_SHEAM      SRSFVRKGLEAWFALLLDTLSGKRRTLELYLN--------------------------------------
MTGA_SALA4      GRSWLRKGLEAGLTLGIETVWSKKRILTVYLNIAEFGDGIFGVEAAAQRYFHKPASRLNMSEXXXXXXXX
MTGA_PSE14      GRSYLRKGLEAWFTMLIELLWSKERILEVYLNSVEWDEGVFGAQAAAQHHFRTNASALSVQQASYLAAVL
MTGA_XANCP      GRSWVRKGLEAWYTLLIELFWPKQRILEMYVNVAEFGDGIYGAQAAARQFWGKDASRLTPTESARLAAVL
MTGA_XANCB      GRSWVRKGLEAWYTLLIELFWPKQRILEMYVNVAEFGDGIYGAQAAARQFWGKDASRLTPTESARLAAVL
MTGA_XANC8      GRSWVRKGLEAWYTLLIELFWPKQRILEMYVNVAEFGDGIYGAQAAARQFWGKDASRLTPTESARLAAVL
MTGA_HAEIE      GQNWLRKGLEVPATMLLELTWSKKRILEVYLNIAEFGNGIFGVEAASRYYFKKSAKNLSQNEAALLVAVL
MTGA_ERWCT      GRSWVRKGLEAGITTGVELVWTKRRIITVYLNIAEFGPGVFGVEAAARRYFNKSASKLTASESALLAAVL
MTGA_CITK8      GRSWLRKGLEAGLTVGLETVWSKKRILTVYLNIA------------------------------------
MTGA_SALTY      GRSWVRKGLEAGLTLGIETVWSKKRILTVYLNIA------------------------------------
MTGA_SALTI      GRSWVRKGLEAGLTLGIETVWSKKRILTVYLNIA------------------------------------
MTGA_SALPB      GRSWVRKGLEAGLTLGIETVWSKKRILTVYLNIA------------------------------------
MTGA_SALNS      GRSWVRKGLEAGLTLGIETVWSKKRILTVYLNIA------------------------------------
MTGA_PSEU2      GRSYLRKGLEAWFTMLIELLWSKERILEVYLN--------------------------------------
MTGA_NEIME      SRSYIRKGEEAAITAMMEAVTDKDRIFELYLN--------------------------------------
MTGA_NEIMB      SRSYIRKGEEAAITAMMEAVTDKDRIFELYLN--------------------------------------
MTGA_NEIMA      SRSYIRKGEEAAITAMMEAVTDKDRIFELYLN--------------------------------------
MTGA_SHEFN      GRNFVRKGLEAMLAVSLEAIWGKKRILEVYLNVA------------------------------------
MTGA_SALPC      GRSWLRKGLEAGLTLGIETVWSKKRILTVYLNIA------------------------------------
MTGA_SALHS      GRSWLRKGLEAGLTLGIETVWSKKRILTVYLNIA------------------------------------
MTGA_SALG2      GRSWLRKGLEAGLTLGIETVWSKKRILTVYLNIA------------------------------------
MTGA_SALEP      GRSWLRKGLEAGLTLGIETVWSKKRILTVYLNIA------------------------------------
MTGA_SALCH      GRSWLRKGLEAGLTLGIETVWSKKRILTVYLNIA------------------------------------
MTGA_RHOP2      GRSVVRKALEFPLAMWIDLVLSKQRILELYLNIA------------------------------------
MTGA_PSEP1      GRSWFRKGLEAWFTALIELFWSKERILEVYLNSA------------------------------------
MTGA_PSEPK      GRSWFRKGLEAWFTALIELFWSKERILEVYLNSA------------------------------------
MTGA_PSEE4      GRSWLRKGLEAWFTALIELFWSKERILEVYLNSA------------------------------------
MTGA_NEIMF      SRSYIRKGEEAAITAMMEAVTDKDRIFELYLN--------------------------------------
MTGA_HAEIN      GQNWLRKGLEVPATMLLELTWSKKRILEVYLNIAEFGNGIFGVEAASRYYFKKSAKNLSQNEAALLAAVL
MTGA_BURVG      EKSYIRKGQELIITWMLETVLDKERIFEIYLN--------------------------------------
MTGA_BURS3      EKSYIRKGQELIITWMLETVLDKERIFEIYLN--------------------------------------
MTGA_BURCH      EKSYIRKGQELIITWMLETVLDKERIFEIYLN--------------------------------------
MTGA_BURCC      EKSYIRKGQELIITWMLETVLDKERIFEIYLN--------------------------------------
MTGA_BURCA      EKSYIRKGQELIITWMLETVLDKERIFEIYLN--------------------------------------
MTGA_PSEPG      GRSWFRKGLEAWFTALIELFWSKERILEVYLNSA------------------------------------
MTGA_BURCM      EKSYIRKGQELIITWMLETVLDKERIFEIYLN--------------------------------------
MTGA_BURA4      EKSYIRKGQELIITWMLETVLDKERIFEIYLN--------------------------------------
MTGA_BRAJA      GRDFIRKALEFPLALWIDFVLPKPRILEIYLNIAELPQGQFGVEXXXXXXXXXXXXXLSPREAALLASIL
MTGA_SALPK      GRSWVRKGLEAGLTLGIETVWSKKRILTVYLNIA------------------------------------
MTGA_SALPA      GRSWVRKGLEAGLTLGIETVWSKKRILTVYLNIA------------------------------------
MTGA_PSEPW      GRSWLRKGLEAWFTALIELFWSKERILEVYLNSA------------------------------------
MTGA_BURM1      EKSYIRKGQELIITWMLETLLDKERIFEIYLN--------------------------------------
MTGA_BORPE      SRSYLRKGQELVLAYMIEHVMPKERILELYLNVA------------------------------------
MTGA_BORPA      SRSYLRKGQELVLAYMIEHVMPKERILELYLNVA------------------------------------
MTGA_BORBR      SRSYLRKGQELVLAYMIEHVMPKERILELYLNVA------------------------------------
MTGA_RHOPS      GRSMVRKALEFPLALWIDLVLSKQRVLELYLNIA------------------------------------
MTGA_ENTS8      GRSWVRKGLEAGLTLGIETVWSKRRILTVYLNIA------------------------------------
MTGA_CAUCR      GRSYVRKGLEAWFTVLIETFWGKKRIMEVYMNSIEYGSGIYGAEAAAQRYFGVSAAKLTQAQSARLAAIL
MTGA_CAUCN      GRSYVRKGLEAWFTVLIETFWGKKRIMEVYMNSIEYGSGIYGAEAAAQRYFGVSAAKLTQAQSARLAAIL
MTGA_XANC5      GRSWVRKGLEAWYTVLIELFWPKQRILEMYLNVAEFGDGVYGAQAAAQQFWSKDAAGLSPSESARLAAVL
MTGA_XANAC      GRSWVRKGLEAWYTVLIELFWPKQRILEMYLNVAEFGDGVYGAQAAAQQFWSKDAAGLSPSESARLAAVL
MTGA_RHOPT      GRSMIRKALEAPLALWIDFVLPKQRILEIYLNIA------------------------------------
MTGA_RHOPA      GRSMIRKALEAPLALWIDFVLPKQRILEIYLNIA------------------------------------
MTGA_SALDC      GRSWLRKGLEAGLTLGIETVWSKKRILTVSLNIA------------------------------------
MTGA_PSEFS      GRSYLRKGLEAWFTGLIEVLWPKQRILEVYLN--------------------------------------
MTGA_PSESM      GRSYLRKGLEAWFTMLIELLWSKERILEVYLNSVEWDEGIFGAQAAAQHHFRTNASALSEQQASYLAAVL
MTGA_RALME      EQNYLRKGQELAITWMLELWLDKQRIFEIYLN--------------------------------------
MTGA_XANOR      GRSWVRKGLEAWYTVLIELFWPKQRILEMYLNVAEFGDGVYGAQAAAQQFWGKDAAGLSPTESARLAAVL
MTGA_XANOM      GRSWVRKGLEAWYTVLIELFWPKQRILEMYLNVAEFGDGVYGAQAAAQQFWGKDAAGLSPTESARLAAVL
MTGA_PSEF5      GRSYLRKGLEAWFTALIEVFWPKQRILEVYLN--------------------------------------
MTGA_PSEPF      GRSYLRKGLEAWFTALIEVFWPKQRILEVYLN--------------------------------------
MTGA_BACTN      QSSWVRKGFEVYFTFLIELFWSKERIMEVYLNSIEMGKGIYGAQATAKYKFNTTAAKLSSGQCALIAATL
MTGA_VIBPA      SHSYVRKAYELYFALLMELMWSKERILEVYLN--------------------------------------
MTGA_SHEON      SRSFIRKGIEAWFTLLMELIWDKARILEVYLNIVEFGPGIYGAEAASKHYFGKSAAKLTRYEASLLAAAL
MTGA_MESSB      GRSFLRKAIEAPLAIYLDAVMPKHRIMEIYLNIAEWGPGIYGVEAAAQHYFGRPSRDLSRREAALLAVTL
MTGA_CYTH3      SRSWIRKGFEAYFTFLIELLWSKERIMEMYLNEIEM----------------------------------
PBPA_MYCS2      ----------------------------------------------------------------------
MTGA_MANSM      GQSWIRKGIEVPVTFMLETLWSKKRILEVYLNIAEFGNGIFGVEAASRYYFKKPAKRLTQSEAALLAAVL
MTGA_BACFR      QSSWIRKGFEVYFTFLIETCWSKERIMEVYLNSIEM----------------------------------
MTGA_BACFN      QSSWIRKGFEVYFTFLIETCWSKERIMEVYLNSIEM----------------------------------
MTGA_RHIE6      SRSFVRKAMELPLAVSTDFVLSKRRLMEIYLNIA------------------------------------
MTGA_RHILW      SRSFVRKAMELPLAVSTDFVLSKRRLMEIYLNIA------------------------------------
MTGA_RHIEC      SRSFVRKAMELPLAVSTDFVLSKRRLMEIYLNIA------------------------------------
MTGA_RHORT      GRNWLRKGLEAYDTVLLEALWPKRRILEVYLN--------------------------------------
MTGA_CHRSD      DRSWVRKGLEAWFTVLIELLWPKERILEVYLN--------------------------------------
MTGA_RALEJ      EQHYLRKGQELAITWMLEFWLDKQRIFEIYLN--------------------------------------
MTGA_RHIL3      GRSFVRKALELPLAVTTDFVLSKRRLMEIYLNIA------------------------------------
MTGA_AGRT5      GRSFLRKGLELPLAIAADFVWSKKRMMEIYLNVA------------------------------------
MTGA_RHILO      PLGSVRKVVELPLAVFFDAVMSKRRIMEIYLNIAEWGPGIYGIEAAAQHHFGIPAKQLSRRQAALLAVTL
MTGA_RHIME      GRSFVRKAMELPLAIAADFAWSKRRLMEIYLNVA------------------------------------
MTGA_XYLFA      GRSFVRKGLEGWYTFWIELFWPKRRILEIYANIAEFGDGVYGVQAAAQRYLEKDAADLDESDAAQLAAVL
MTGA_XYLFT      GRSFVRKGLEGWYTFWIELFWPKRRILEIYANIAEFGDGVYGVQAAARRYLGKGAADLDESDAAQLAAVL
MTGA_XYLF2      GRSFVRKGLEGWYTFWIELFWPKRRILEIYANIAEFGDGVYGVQAAARRYLGKGAADLDESDAAQLAAVL
MTGA_XYLFM      GRSFVRKGLEGWYTFWIELFWPKRRILEIYANIAEFGDGVYGVQAAARRYLGKGAADLDESDAAQLAAVL
MTGA_BRUSU      GRSYLRKGLEFPLALIADAVLSKKRIMEIYLNIAEWGPGIYGIEAAARHYFKRSAAKLTARQAALLAVTL
MTGA_BRUME      GRSYLRKGLEFPLALIADAVLSRKRIMEIYLNIAEWGPGIYGIEAAARHYFKRSAAKLTARQAALLAVTL
MTGA_JANSC      GRSWVRKALEAAITPVMELVWPKRRVLEVYLNVAEFAPGVFGAEAGAQHHFGVSAADLTARQASLMAAVL
SP5D_BACSU      ----------------------------------------------------------------------
FTSI_MESVI      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           KAPAKYAPHVNLPAARARANTVLSNLVQSGLMTEGQVIGARRNPATVIDRADVKAPDYFLDWAFDEVQRL
PBPF_BACSU      KAPSTYSPILHPDKNKERRDTILGMMNDQGYISAKEAVTAQGRTLGLHVKKQSETPDSYIDLVIKEAEKY
PBPB_VIBCH      KGPSYYNPMRYAERARERRDLVLKLMMEHDILTAPEYQQAVTRPLDVQKTAQIRQPAYFQQVSIELKEKL
PBPD_BACSU      NNPTLYDPLKHFDYTKSRQERLLKGLKDAGVITDKELKKAVKQKIKLVEKREDKYPDY-VSYVNDEFTQL
PBPG_BACSU      KGPSGYSPYVNETKAKERQKTIVRMMEKQQMISQKKADELIKEPLSLNKQVSKRKAPYFYDNAMRELEKK
PBPA_BACSU      QSPTAYNPVKNPDKAEKRRNIVLSLMKKQGFISDSQYNKAKK--VAVKDEGVVSQKEYFVEEVMKEIDEK
PBPB_HAEIN      KGPSLYNPWRNPQNALERRNIVLRLMLEHKMIGDELYQLLSQRPLGVQKKGQIKYPAFIQTLQADLRRKL
PBPB_ECOLI      KGASIYNPWRNPKXXXXXXXXXXXXXXXXXXXXXXXYDMLSARPLGVQPRGGVISPQAFMQLVRQELQAK
PBPB_BUCAI      KGASLYSPWTNPNLALKRRNLVLFLLYKQKYITRKIYKDLCKRSLNVQPKGNISSHPSFIQLVCEEFHKK
PBPB_BUCBP      KGASLYNPWNNPVLTLNRRNLVLYVLFKHKVINRTLYEKLKSKPLNIQSRGNIWFRSAFVQIVEKEFQKK
PBPA_CLOTE      QSPSTF-----YNAAMSQKNTINRTKLVLGKMREHNYISKEDFDKSMIDKSNINISRLNYEWFSREIIKL
PBPA_CLOPS      QAPTSYINKENPSRYLNRTKSVLFKMHELGYISSEQY----NNAINEIDTNGIKKPNNKLSYTQDEVDKL
PBPA_CLOPE      QAPTSYANKENPSRYLNRTKSVLFKMHELGYISSEQTNGIKFTPNNKLSKAITQVKQDLMDYTQEEVDKL
PBPA_CLOP1      QAPTSYANKENPSRYLNRTKSVLFKMHELGYISSEQTNGIKFTPNNKLSKTNFEKQDLMNKYKYEEVDKL
PBPA_AQUAE      XXXXXYNPFYHPERALQRRNLVLKRMLEEGYITPEQYEEAVNKPLTVKKENKYKFSDYFLDYVFNKYGEI
PBPA_CLOAB      QSPSAYYPRTKLVLYKMRQNNAINDLNNNKLAFSQQKISNKYTPVVNQVKQDLKSQYHYTD---EEIDSL
PBPA_NEIFL      KAPSAYNPIVNPERAKLRQAYILNNMLEEGMITRDQALKEELHYERFVQNIDQSAL-YVAEMARQELFEK
PBPA_CLOBH      XXXXKKNPSIYL----NRTKTVLYKMLDNGYITQNDYNKALKDDSKKLVFAKPSAPEWFSIPAIEQVKKL
PBPA_CLOB1      XXXXKKNPSIYL----NRTKTVLYKMLDNGYITQNDYNKALKDDSKKLVFAKPSAPEWFSIPAIEQVKKL
PBPC_ECOLI      QAPSRLRPDRWPERAEAARNKVLERMAVQGVWSREQVKESREEPIWLAPRQMPQLAPLFSRMML------
PBPA_CLOBL      XXXXKKNPSIYL----NRTKTVLYKMLDNGYITQNDYNXXXXXXXXXXXXSNKLAYEWFSIPAIEQVKKL
PBPA_CLONN      QSPSVYYPYSRTSKKDPRTKTVLAKMKENGYISQNEYISALASKSTVTNDESIQTEKYNFEWSDDEIEKL
PBPA_NEILA      KAPSAYNPIVNPERAKLRQKYILNNMLEEKMITRDQALNEELHYERFVQKIDQSAL-YVAEMVRQELYEK
PBPA_PSEAE      KAPSRYNPLVNPTRSTERRNWILERMLKLGFIDQQRYQAAVEEPINAVQTPELNAP-YIAEMARAEVGRY
PBPA_ECOLI      KAPSTFNPLYSMDRAVARRNVVLSRMLDEGYITQQQFDQTR----TEAINANYHAPEYLSEMVRQEMYNR
PBPA_HAEIN      KAPSTMNPLYSLKRSEERRNVVLSRMLDEKYISKEEYDAALKEPIVASAKFEFRA-DYVTEMVRQEMVRR
PBPA_STRPN      QAPNQYDPYSHPEAAQDRRNLVLSEMKNQGYISAEQYEKAVNTPITQSLKSASNYPAYMDNYLKEVINQV
PBPA_XYLFA      ----------------ANADTATLAAHLSGISSQGPVIVARTTPAVVVDRSELTLPPAAARWTGTPLNKL
PBPA_NEICI      KAPSAYNPIVNPERAKLRQKYILNNMLEEKMITRDQALNEELHYERFVQKIDQSAL-YVAEMVRQELYEK
PBPA_STRR6      QAPNQYDPYSHPEAAQDRRNLVLSEMKNQGYISAEQYEKAVNTPITQSLKSASNYPAYMDNYLKEVINQV
PBPA_XYLFT      ----------------ANADTATLAAHLSGISSQGPVIVARTTPAIVVDRSELTLPPAASRWTGTPLNKL
PBPA_VIBCH      KAPSTMNPIYSVERATNRRNVVLQRMLDEKYITKAEYDAARAEP--------------------------
PBPA_NEIMB      ----------------------------------------------------------------------
PBPA_NEIMA      ----------------------------------------------------------------------
PBPA_STROR      QAPNQYDPYSHPEAAQERRNLVLSEMKGQGYITAEQYEKAINTPITSLKSANSYPPDNYLKEVIDQVEQE
PBPA_RICFE      KAPSELNPERNYARVKARRDYVIARMFEDGYITKDAAKEAMDSPIVLRKRAETVTADYYAAQVREEVIRL
PBPA_NEIGO      KAPSAYNPIVNPERAKLRQKYILNNMLEEKMITRDQALNEELHYERFVRKIDQSAL-YVAEMVRRELYEK
PBPA_NEIG1      KAPSAYNPIVNPERAKLRQKYILNNMLEEKMITRDQALNEELHYERFVRKIDQSAL-YVAEMVRRELYEK
PBPA_RICPR      KAPSELNPDKNYSRVKARRDYVIERMFEDGYITRDTMKEAIGSPIVLRKRAETVTADYYAEQVREEVIRL
PBPA_RICCN      KAPSELNPERNYARVKARRDYVITRMFEDGYITRDAAKEAMDSPIVLRKRAETVTADYYAAQVREEVIRL
PBPA_RICBR      ----------------------------------------------------------------------
PBPA_RICTY      EFDRRHGPIANIPLDHWQE--ALKNIPTPSSLLEYKVLDVSDNHAKIIDGSKARIPIIEMQWARSNLKSV
TRG_RALEH       KAPSANNPVANPRRARQRQVYILQRMLELGRISRGEYDGALLEP--------------------------
MTGA_NITMU      PSPRFYDENRNTPWLSKKTRMILGRMASASI---------------------------------------
MTGA_ACIAD      PNPKYYQENRNDP---------------------------------------------------------
MTGA_THIDA      PNPRWYENH-------------------------------------------------------------
MTGA_ALCBS      ----------------------------------------------------------------------
MTGA_ACIBT      PDPKYYQDHRNDRKLQYRKRVIL-----------------------------------------------
MTGA_DECAR      ----------------------------------------------------------------------
MTGA_ACIBY      PDPKYYQDHRNDRKLQYRKRVIL-----------------------------------------------
MTGA_ACIBS      PDPKYYQDHRNDRKLQYRKRVIL-----------------------------------------------
MTGA_ACIBC      PDPKYYQDHRNDRKLQYRKRVIL-----------------------------------------------
MTGA_ACIB5      PDPKYYQDHRNDRKLQYRKRVIL-----------------------------------------------
MTGA_ACIB3      PDPKYYQDHRNDRKLQYRKRVIL-----------------------------------------------
MGT_STAAW       NAPSVYNINNMSENFTQRVSTNLEKMKQQNYINETQ----------------------------------
MGT_STAAT       NAPSVYNINNMSENFTQRVSTNLEKMKQQNYINETQ----------------------------------
MGT_STAAS       NAPSVYNINNMSENFTQRVSTNLEKMKQQNYINETQ----------------------------------
MGT_STAAR       NAPSVYNINNMSENFTQRVSTNLEKMKQQNYINETQ----------------------------------
MGT_STAAN       NAPSVYNINNMSENFTQRVSTNLEKMKQQNYINETQ----------------------------------
MGT_STAAM       NAPSVYNINNMSENFTQRVSTNLEKMKQQNYINETQ----------------------------------
MGT_STAAE       NAPSVYNINNMSENFTQRVSTNLEKMKQQNYINETQ----------------------------------
MGT_STAAC       NAPSVYNINNMSENFTQRVSTNLEKMKQQNYINETQ----------------------------------
MGT_STAAB       NAPSVYNINNMSENFTQRVSTNLEKMKQQNYINETQ----------------------------------
MGT_STAA8       NAPSVYNINNMSENFTQRVSTNLEKMKQQNYINETQ----------------------------------
MGT_STAA3       NAPSVYNINNMSENFTQRVSTNLEKMKQQNYINETQ----------------------------------
MGT_STAA1       NAPSVYNINNMSENFTQRVSTNLEKMKQQNYINETQ----------------------------------
MTGA_CHRVO      PNPRYYDEHRNAPGLARKTRII------------------------------------------------
MGT_STAES       NAPSVYDVNDMSNNYINRVKTNLEKMKQQNFISESQ----------------------------------
MGT_STAEQ       NAPSVYDVNDMSNNYINRVKTNLEKMKQQNFISESQ----------------------------------
MTGA_NEIGO      PAPLYYADHPKSKRLRNKTNIVLRRM--------------------------------------------
MTGA_NEIG1      PAPLYYADHPKSKRLRNKTNIVLRRM--------------------------------------------
MTGA_MARMS      PSPRTRNPNDLTFYLRERVDWVERQMQQLG----------------------------------------
MTGA_ECOLC      PNPRRFKVSAPSGYVHSRQAWILRQMYQLG----------------------------------------
MTGA_NEIG2      PAPLYYADHPKSKRLRNKTNIVLRRM--------------------------------------------
MTGA_AZOSE      PNPRRYEKQFG-PRLAAHARRIRSRMV-------------------------------------------
MGT_STAA9       NAPSVYNINNMSENFTQRVSTNLEKMKQQNYINETQ----------------------------------
MGT_STAA2       NAPSVYNINNMSENFTQRVSTNLEKMKQQNYINETQ----------------------------------
MGT_STAHJ       NAPSVYDISNMSDNFKNRIKTNLEKMKQQEYISDSQ----------------------------------
MTGA_AZOSB      ----------------------------------------------------------------------
MTGA_SHEDO      PSPRSRSPHHLTPYLHQR----------------------------------------------------
MGT_STAS1       NAPSVYNINDMSDNFTNRVKTDLEKMKQQGYISNSQ----------------------------------
MTGA_NITEU      PNPRFYDTRRTLPKLLNKSRIILSRL--------------------------------------------
MTGA_METFK      PNPRYYDKH-------------------------------------------------------------
MTGA_PECCP      PNPIRFRANAPSSYVIQRQQWILRQMRQMG----------------------------------------
MTGA_PHOLL      PNPHRY--KVNSPSA-------------------------------------------------------
MTGA_RHOCS      PNPRRWSPERPTAYIRNRAATI------------------------------------------------
MTGA_HERAR      PNPRFYDTHRGTAYLGRRTDLILRRM--------------------------------------------
MTGA_JANMA      ----------------------------------------------------------------------
MTGA_ECO55      ----------------------------------------------------------------------
MTGA_SHISS      ----------------------------------------------------------------------
MTGA_BURXL      PQPKYFDEHRGSPYLAQRSRVI------------------------------------------------
MTGA_NITEC      SNPRFYDTHRQSPRLLKKARIILSRL--------------------------------------------
MTGA_BORA1      PNPRYYDKHRSTRYLNSRTAILLRRM--------------------------------------------
MTGA_SHIDS      ----------------------------------------------------------------------
MTGA_PSEAE      PSPLKWSAARPGPYVRQRAAWIRQQMWQLG----------------------------------------
MTGA_ECOSE      ----------------------------------------------------------------------
MTGA_ECOLI      ----------------------------------------------------------------------
MTGA_ECOHS      ----------------------------------------------------------------------
MTGA_ECODH      ----------------------------------------------------------------------
MTGA_ECOBW      ----------------------------------------------------------------------
MTGA_ECO8A      ----------------------------------------------------------------------
MTGA_ECO24      ----------------------------------------------------------------------
MTGA_PASMU      PNPIIF--KVNKPSA-------------------------------------------------------
MTGA_ECOUT      ----------------------------------------------------------------------
MTGA_ECOSM      ----------------------------------------------------------------------
MTGA_ECOLU      ----------------------------------------------------------------------
MTGA_ECOL6      ----------------------------------------------------------------------
MTGA_ECOL5      ----------------------------------------------------------------------
MTGA_ECOK1      ----------------------------------------------------------------------
MTGA_ECO81      ----------------------------------------------------------------------
MTGA_ECO7I      ----------------------------------------------------------------------
MTGA_ECO5E      ----------------------------------------------------------------------
MTGA_ECO57      ----------------------------------------------------------------------
MTGA_ECO45      ----------------------------------------------------------------------
MTGA_ECO27      ----------------------------------------------------------------------
MTGA_NITWN      PNPVRRSARKPGPGVRRLAGTYMA----------------------------------------------
MTGA_LARHH      PNPRYYDTHRN-----------------------------------------------------------
MTGA_SHIBS      ----------------------------------------------------------------------
MTGA_NITHX      PNPVRRSARKPGPGVRRLAGTYM-----------------------------------------------
MTGA_AERHH      PNPWRYRVKPPSPYVQQRSAWIRRQMGQLGQITLNKV---------------------------------
MTGA_YERP3      ----------------------------------------------------------------------
MTGA_SALAR      XXXXRYKADAPSGYVRSRQSWILRQMRQLGFMTRNQL---------------------------------
MTGA_RALSO      ----------------------------------------------------------------------
MTGA_PSEMY      ----------------------------------------------------------------------
MTGA_KLEOX      ----------------------------------------------------------------------
MTGA_BDEBA      ----------------------------------------------------------------------
MTGA_YERPS      ----------------------------------------------------------------------
MTGA_YERPP      ----------------------------------------------------------------------
MTGA_YERPN      ----------------------------------------------------------------------
MTGA_YERPG      ----------------------------------------------------------------------
MTGA_YERPE      ----------------------------------------------------------------------
MTGA_YERPB      ----------------------------------------------------------------------
MTGA_YERPA      ----------------------------------------------------------------------
MTGA_YERPY      ----------------------------------------------------------------------
MTGA_SALSV      XXXXRYKANAPSGYVRSRQAWIMRQMRQLGFMTRNQL---------------------------------
MTGA_PSEU5      ----------------------------------------------------------------------
MTGA_BURTA      PNPKYFDAHRSSPYLAQRASVI------------------------------------------------
MTGA_BURPS      PNPKYFDAHRGSPYLAQRAGVI------------------------------------------------
MTGA_BURPP      PQPKYFDEHRGSQYLAQRARVI------------------------------------------------
MTGA_BURP8      PRPKYFDEHRSSGYLTQRARVI------------------------------------------------
MTGA_BURMA      PNPKYFDAHRGSPYLAQRAGVI------------------------------------------------
MTGA_YERE8      ----------------------------------------------------------------------
MTGA_NEIM0      ----------------------------------------------------------------------
MTGA_SHEAM      ----------------------------------------------------------------------
MTGA_SALA4      XXXXRYKANAPSGYVRSRQAWIMRQMRQLGFMTRNQL---------------------------------
MTGA_PSE14      PNPREWSASHPSSYVSRRAGWIRQQMRQLG----------------------------------------
MTGA_XANCP      PSPRRY----------------------------------------------------------------
MTGA_XANCB      PSPRRY----------------------------------------------------------------
MTGA_XANC8      PSPRRY----------------------------------------------------------------
MTGA_HAEIE      PNPIIY--KVNKPSLLVRKKTSL-----------------------------------------------
MTGA_ERWCT      PNPIRFRANAPSGYVIQRQQWILRQMRQMG----------------------------------------
MTGA_CITK8      ----------------------------------------------------------------------
MTGA_SALTY      ----------------------------------------------------------------------
MTGA_SALTI      ----------------------------------------------------------------------
MTGA_SALPB      ----------------------------------------------------------------------
MTGA_SALNS      ----------------------------------------------------------------------
MTGA_PSEU2      ----------------------------------------------------------------------
MTGA_NEIME      ----------------------------------------------------------------------
MTGA_NEIMB      ----------------------------------------------------------------------
MTGA_NEIMA      ----------------------------------------------------------------------
MTGA_SHEFN      ----------------------------------------------------------------------
MTGA_SALPC      ----------------------------------------------------------------------
MTGA_SALHS      ----------------------------------------------------------------------
MTGA_SALG2      ----------------------------------------------------------------------
MTGA_SALEP      ----------------------------------------------------------------------
MTGA_SALCH      ----------------------------------------------------------------------
MTGA_RHOP2      ----------------------------------------------------------------------
MTGA_PSEP1      ----------------------------------------------------------------------
MTGA_PSEPK      ----------------------------------------------------------------------
MTGA_PSEE4      ----------------------------------------------------------------------
MTGA_NEIMF      ----------------------------------------------------------------------
MTGA_HAEIN      PNPIIY--KVNKPSLLVR----------------------------------------------------
MTGA_BURVG      ----------------------------------------------------------------------
MTGA_BURS3      ----------------------------------------------------------------------
MTGA_BURCH      ----------------------------------------------------------------------
MTGA_BURCC      ----------------------------------------------------------------------
MTGA_BURCA      ----------------------------------------------------------------------
MTGA_PSEPG      ----------------------------------------------------------------------
MTGA_BURCM      ----------------------------------------------------------------------
MTGA_BURA4      ----------------------------------------------------------------------
MTGA_BRAJA      PNPVKRSARTPGPGVRRLAGTYVARAQASTLAT-------------------------------------
MTGA_SALPK      ----------------------------------------------------------------------
MTGA_SALPA      ----------------------------------------------------------------------
MTGA_PSEPW      ----------------------------------------------------------------------
MTGA_BURM1      ----------------------------------------------------------------------
MTGA_BORPE      ----------------------------------------------------------------------
MTGA_BORPA      ----------------------------------------------------------------------
MTGA_BORBR      ----------------------------------------------------------------------
MTGA_RHOPS      ----------------------------------------------------------------------
MTGA_ENTS8      ----------------------------------------------------------------------
MTGA_CAUCR      PSPLKW----------------------------------------------------------------
MTGA_CAUCN      PSPLKW----------------------------------------------------------------
MTGA_XANC5      PSPRRY----------------------------------------------------------------
MTGA_XANAC      PSPRRY----------------------------------------------------------------
MTGA_RHOPT      ----------------------------------------------------------------------
MTGA_RHOPA      ----------------------------------------------------------------------
MTGA_SALDC      ----------------------------------------------------------------------
MTGA_PSEFS      ----------------------------------------------------------------------
MTGA_PSESM      PNPRQWSASHPSGYVSRRAGWIRQQMRQLG----------------------------------------
MTGA_RALME      ----------------------------------------------------------------------
MTGA_XANOR      PSPRHY----------------------------------------------------------------
MTGA_XANOM      PSPRHY----------------------------------------------------------------
MTGA_PSEF5      ----------------------------------------------------------------------
MTGA_PSEPF      ----------------------------------------------------------------------
MTGA_BACTN      PNPIRF----------------------------------------------------------------
MTGA_VIBPA      ----------------------------------------------------------------------
MTGA_SHEON      PNPWRY----------------------------------------------------------------
MTGA_MESSB      PNPSERNPAQPSAALRRLASVVEARAQRAG----------------------------------------
MTGA_CYTH3      ----------------------------------------------------------------------
PBPA_MYCS2      ----------------------------------------------------------------------
MTGA_MANSM      PNPIIY----------------------------------------------------------------
MTGA_BACFR      ----------------------------------------------------------------------
MTGA_BACFN      ----------------------------------------------------------------------
MTGA_RHIE6      ----------------------------------------------------------------------
MTGA_RHILW      ----------------------------------------------------------------------
MTGA_RHIEC      ----------------------------------------------------------------------
MTGA_RHORT      ----------------------------------------------------------------------
MTGA_CHRSD      ----------------------------------------------------------------------
MTGA_RALEJ      ----------------------------------------------------------------------
MTGA_RHIL3      ----------------------------------------------------------------------
MTGA_AGRT5      ----------------------------------------------------------------------
MTGA_RHILO      PNPIARNPAKPGPGLRRLANLIERRAGRSG----------------------------------------
MTGA_RHIME      ----------------------------------------------------------------------
MTGA_XYLFA      PSPRRYNIQDPGPYIRWRSSWIQRQAEQLG----------------------------------------
MTGA_XYLFT      PSPRHYNIQHPGPYIRWRSSWIQRQAKQLG----------------------------------------
MTGA_XYLF2      PSPRHYNIQHPGPYIRWRSSWIQRQAKQLG----------------------------------------
MTGA_XYLFM      PSPRHYNIQHPGPYIRWRSSWIQRQAKQLG----------------------------------------
MTGA_BRUSU      PNPALRNPAKPTRNMQRIARIVAGRAMRSG----------------------------------------
MTGA_BRUME      PNPALRNPAKPTRNMQRIARIVAGRAMRSG----------------------------------------
MTGA_JANSC      PNPQR-----------------------------------------------------------------
SP5D_BACSU      ----------------------------------------------------------------------
FTSI_MESVI      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           AAEGKFKDHTVVVRTTIDTGLQQAAEQAMEMELREYGEGYRVKQGAMVMIENGGGVRAMVGGRDYGESQF
PBPF_BACSU      SISGQLLQGGYTIKVPLDSKLQKTAYQVMKEGSYYPGTDQNAEGSAVFINNKTGGVEAAIGGRDYTSKGY
PBPB_VIBCH      G--DKFKDSGLRVFTSLDPVSQSKLEQAIHDQIPQLAKGKDLEAAAIAVDRHSGEIRAMVGGKRTGYDGF
PBPD_BACSU      VSEGKQKEKIVKIYTALDPYMQNQVVAQMNSKL-PYAD---VQGGAAVINHQTHQIIALSGGKNYQKYDF
PBPG_BACSU      LGMTREQIETLNVYTTVDKRMQRIAEETI---TETVNAGSDIQVGFSAIDPRTGNVLALVGGRDYQKSPF
PBPA_BACSU      SDVDPSAD-GLKIYTTLDTKAQDKLDELMDGDTVGFTEG--MQGGVTLLDTKNGEVRAIGAGRNQPVGGF
PBPB_HAEIN      ---GEHKISSLLIFSTMDLKQQAQAENAVQLQLKMKNPHL---EGAMIITDRTGEIRAVVGGLQTQYAGF
PBPB_ECOLI      LGD-KVKDLSVKIFTTFDSVAQDAAEKAAVEGIPALKKQRKLSETAIVVVDRSGEVRAMVGGSEPQFAGY
PBPB_BUCAI      IYNPIKNFPGTKIFTTLDYTSQNAVEQAVKIEIPILKRKKRLKEVAMIVIDRTGEVQALIGSSKPEFNGY
PBPB_BUCBP      VGYYFQNFSGIKIFTTLDLISQIAAENAIRIXXXXXXXXXXXXEASMVIIDRSGEIRGVLGSSNPNLLGY
PBPA_CLOTE      MNEYKISDKTIMIYGTMDKSLQDFSQNTLDINSKDYSGIIQPEASVSIVDYKTGNVKVLIGGRGKQPPSF
PBPA_CLOPS      IANGGLK-----IYTSMDRNLQNNVQKVLDPNEKNEDDVYKLQASATIIDYKTGHVKALVGGREQPAMSH
PBPA_CLOPE      IANGGLK-----IYTSMDRNLQNNVQKVLDNEKNEDGV-YKLQASATIIDYKTGHVKALVGGREQPAMSH
PBPA_CLOP1      IANGGLK-----IYTSMDRNLQNNVQKVLDNEKNEDGV-YKLQASATIIDYKTGHVKALVGGREQPAMSH
PBPA_AQUAE      AYKGRLK-----IYTTIDLDYQKIAQKSLEEGLK---------EGSLVSIDKTGEIKAIVGGRSYAYSQF
PBPA_CLOAB      LRDGGLKIYTTM-NTSMESNVQNILDNNSTLKSYSYADKNGIIQAATLFDYHTGEIKAIVGGRQQPPSSY
PBPA_NEIFL      YGEDAY-TQGFKVYTTVDTAHQRVATEALRKVLRNFDRG----QGALVSLDKTGAVRALVGGYDYHSKTF
PBPA_CLOBH      KTQYKYDDHNLLVNTTMNKNLQDKTQNTINYYLNSYKSNGMIQASAVIMDYHNGEVKTIIGGRDQPARSY
PBPA_CLOB1      KTQYKYDDHNLLVNTTMNKNLQDKTQNTINYYLNSYKSNGMIQASAVIMDYHNGEVKTIIGGRDQPARSY
PBPC_ECOLI      ---GKSKSDKIT--TTLDAGLQRRLE-----ELAQNWKGRLPPRSSLAMIHTDMRVRGWVGSVDLNDSRF
PBPA_CLOBL      KTQYKYDDHNLLVNTTMNKNLQDKTQNTINYYLNSYKSNGIIQASAVIMDYHNGEVKTIVGGRDQPARSY
PBPA_CLONN      LVNGNLK-----IYTTMNKDLQVSTQEIIDNDXXXXXXXVEPQASAVLTDYHTGEVKVIIGGRGTQPAAY
PBPA_NEILA      YGEDAY-TQGLKVYTTVRTDHQKAATEALRKALRNFDRG-------------------------------
PBPA_PSEAE      GSEAYTEGYKVI--TTVRSDLQNAASQSVRDGLIDYDQGYR--QSALISLDKDGAIRSLVGGFSFEQSNY
PBPA_ECOLI      YGESAYEDYTTITRKVXXXXXXXVRNNVLDYDMR---HGYR-----------------------------
PBPA_HAEIN      FGEENAYTSGYKVFTTVLSKDQAEAQKAVRNNLIDYDMRHGYRGGAPLWQKN------------------
PBPA_STRPN      EEETGYNLLTMDVYTNVD---QEAQKHLWDIYNTDEYVAYELQVASTIVDVSNGKVIAQLGARHQSSNGI
PBPA_XYLFA      LKRGD------VVRV-------RPGEKWGEWTLEQLPSA----QSTLVSLDNNGALRALVGGFSFTANKF
PBPA_NEICI      YGEDAY-TQGFKVYTTVRTDHQKVATEALRKALRNFDRG--------------GAVRALVGGYDFHSKTF
PBPA_STRR6      EEETGYNLLTMDVYTNVD---QEAQKHLWDIYNTDEYVAYELQVASTIVDVSNGKVIAQLGARHQSSNGI
PBPA_XYLFT      LKRGD------VVRV-------RPGEKRGEWTLEQLPSA----QSTLVSLDNNGALRALVGGFSFTANKF
PBPA_VIBCH      ----------------------------------------------VAMNPENGAVTALVGGFNFVHNKF
PBPA_NEIMB      -------------RVTLDRRALGFAARAVNNE--KMGED-RIRRGAVIRVKNNGGVRALVGGYDFHSKTF
PBPA_NEIMA      -------------RVTLDRRALGFAARAVNNE--KMGED-RIRRGAVIRVKNNGGVRALVGGYDFHSKTF
PBPA_STROR      TGYNLLTTG-MEVYTNVDSKVQQRLWDIYNTDEYVNYPDDELQVASTIVDVTDGKVIAQLGARHQSSNVI
PBPA_RICFE      NSKEEFYTGGLTIITSLDAKMQQLAENSLRKGLREFDRGFR-KPIANIPLDN------------------
PBPA_NEIGO      YGEDAY-TQGFKVYTTVRTDHQKAATEALRKALRNFDRG----QGALVSLDKTGAVRALVGGYDFHSKTF
PBPA_NEIG1      YGEDAY-TQGFKVYTTVRTDHQKAATEALRKALRNFDRG----QGALVSLDKTGAVRALVGGYDFHSKTF
PBPA_RICPR      NSKEEFYRGGLTIITSLDAKMQQLAENSLRKGLREFDSGFR-KPIANIPLDN------------------
PBPA_RICCN      NSKEVFYTGGLTIITSLDAKMQQLAENSLRKGLREFDRGFR-KPIANISLDNWQG---------------
PBPA_RICBR      -----------------------------------------VNGAIMVMNPNTGQVLTSVGGYDFFASKF
PBPA_RICTY      KTLLKKGDVIVVEPIKDCYALRQIPE---------------INGAIMVMNPHTGQVLASVGGYDFSTSKF
TRG_RALEH       ----------------------------------------------------------------------
MTGA_NITMU      ----------------------------------------------------------------------
MTGA_ACIAD      ----------------------------------------------------------------------
MTGA_THIDA      ----------------------------------------------------------------------
MTGA_ALCBS      ----------------------------------------------------------------------
MTGA_ACIBT      ----------------------------------------------------------------------
MTGA_DECAR      ----------------------------------------------------------------------
MTGA_ACIBY      ----------------------------------------------------------------------
MTGA_ACIBS      ----------------------------------------------------------------------
MTGA_ACIBC      ----------------------------------------------------------------------
MTGA_ACIB5      ----------------------------------------------------------------------
MTGA_ACIB3      ----------------------------------------------------------------------
MGT_STAAW       ----------------------------------------------------------------------
MGT_STAAT       ----------------------------------------------------------------------
MGT_STAAS       ----------------------------------------------------------------------
MGT_STAAR       ----------------------------------------------------------------------
MGT_STAAN       ----------------------------------------------------------------------
MGT_STAAM       ----------------------------------------------------------------------
MGT_STAAE       ----------------------------------------------------------------------
MGT_STAAC       ----------------------------------------------------------------------
MGT_STAAB       ----------------------------------------------------------------------
MGT_STAA8       ----------------------------------------------------------------------
MGT_STAA3       ----------------------------------------------------------------------
MGT_STAA1       ----------------------------------------------------------------------
MTGA_CHRVO      ----------------------------------------------------------------------
MGT_STAES       ----------------------------------------------------------------------
MGT_STAEQ       ----------------------------------------------------------------------
MTGA_NEIGO      ----------------------------------------------------------------------
MTGA_NEIG1      ----------------------------------------------------------------------
MTGA_MARMS      ----------------------------------------------------------------------
MTGA_ECOLC      ----------------------------------------------------------------------
MTGA_NEIG2      ----------------------------------------------------------------------
MTGA_AZOSE      ----------------------------------------------------------------------
MGT_STAA9       ----------------------------------------------------------------------
MGT_STAA2       ----------------------------------------------------------------------
MGT_STAHJ       ----------------------------------------------------------------------
MTGA_AZOSB      ----------------------------------------------------------------------
MTGA_SHEDO      ----------------------------------------------------------------------
MGT_STAS1       ----------------------------------------------------------------------
MTGA_NITEU      ----------------------------------------------------------------------
MTGA_METFK      ----------------------------------------------------------------------
MTGA_PECCP      ----------------------------------------------------------------------
MTGA_PHOLL      ----------------------------------------------------------------------
MTGA_RHOCS      ----------------------------------------------------------------------
MTGA_HERAR      ----------------------------------------------------------------------
MTGA_JANMA      ----------------------------------------------------------------------
MTGA_ECO55      ----------------------------------------------------------------------
MTGA_SHISS      ----------------------------------------------------------------------
MTGA_BURXL      ----------------------------------------------------------------------
MTGA_NITEC      ----------------------------------------------------------------------
MTGA_BORA1      ----------------------------------------------------------------------
MTGA_SHIDS      ----------------------------------------------------------------------
MTGA_PSEAE      ----------------------------------------------------------------------
MTGA_ECOSE      ----------------------------------------------------------------------
MTGA_ECOLI      ----------------------------------------------------------------------
MTGA_ECOHS      ----------------------------------------------------------------------
MTGA_ECODH      ----------------------------------------------------------------------
MTGA_ECOBW      ----------------------------------------------------------------------
MTGA_ECO8A      ----------------------------------------------------------------------
MTGA_ECO24      ----------------------------------------------------------------------
MTGA_PASMU      ----------------------------------------------------------------------
MTGA_ECOUT      ----------------------------------------------------------------------
MTGA_ECOSM      ----------------------------------------------------------------------
MTGA_ECOLU      ----------------------------------------------------------------------
MTGA_ECOL6      ----------------------------------------------------------------------
MTGA_ECOL5      ----------------------------------------------------------------------
MTGA_ECOK1      ----------------------------------------------------------------------
MTGA_ECO81      ----------------------------------------------------------------------
MTGA_ECO7I      ----------------------------------------------------------------------
MTGA_ECO5E      ----------------------------------------------------------------------
MTGA_ECO57      ----------------------------------------------------------------------
MTGA_ECO45      ----------------------------------------------------------------------
MTGA_ECO27      ----------------------------------------------------------------------
MTGA_NITWN      ----------------------------------------------------------------------
MTGA_LARHH      ----------------------------------------------------------------------
MTGA_SHIBS      ----------------------------------------------------------------------
MTGA_NITHX      ----------------------------------------------------------------------
MTGA_AERHH      ----------------------------------------------------------------------
MTGA_YERP3      ----------------------------------------------------------------------
MTGA_SALAR      ----------------------------------------------------------------------
MTGA_RALSO      ----------------------------------------------------------------------
MTGA_PSEMY      ----------------------------------------------------------------------
MTGA_KLEOX      ----------------------------------------------------------------------
MTGA_BDEBA      ----------------------------------------------------------------------
MTGA_YERPS      ----------------------------------------------------------------------
MTGA_YERPP      ----------------------------------------------------------------------
MTGA_YERPN      ----------------------------------------------------------------------
MTGA_YERPG      ----------------------------------------------------------------------
MTGA_YERPE      ----------------------------------------------------------------------
MTGA_YERPB      ----------------------------------------------------------------------
MTGA_YERPA      ----------------------------------------------------------------------
MTGA_YERPY      ----------------------------------------------------------------------
MTGA_SALSV      ----------------------------------------------------------------------
MTGA_PSEU5      ----------------------------------------------------------------------
MTGA_BURTA      ----------------------------------------------------------------------
MTGA_BURPS      ----------------------------------------------------------------------
MTGA_BURPP      ----------------------------------------------------------------------
MTGA_BURP8      ----------------------------------------------------------------------
MTGA_BURMA      ----------------------------------------------------------------------
MTGA_YERE8      ----------------------------------------------------------------------
MTGA_NEIM0      ----------------------------------------------------------------------
MTGA_SHEAM      ----------------------------------------------------------------------
MTGA_SALA4      ----------------------------------------------------------------------
MTGA_PSE14      ----------------------------------------------------------------------
MTGA_XANCP      ----------------------------------------------------------------------
MTGA_XANCB      ----------------------------------------------------------------------
MTGA_XANC8      ----------------------------------------------------------------------
MTGA_HAEIE      ----------------------------------------------------------------------
MTGA_ERWCT      ----------------------------------------------------------------------
MTGA_CITK8      ----------------------------------------------------------------------
MTGA_SALTY      ----------------------------------------------------------------------
MTGA_SALTI      ----------------------------------------------------------------------
MTGA_SALPB      ----------------------------------------------------------------------
MTGA_SALNS      ----------------------------------------------------------------------
MTGA_PSEU2      ----------------------------------------------------------------------
MTGA_NEIME      ----------------------------------------------------------------------
MTGA_NEIMB      ----------------------------------------------------------------------
MTGA_NEIMA      ----------------------------------------------------------------------
MTGA_SHEFN      ----------------------------------------------------------------------
MTGA_SALPC      ----------------------------------------------------------------------
MTGA_SALHS      ----------------------------------------------------------------------
MTGA_SALG2      ----------------------------------------------------------------------
MTGA_SALEP      ----------------------------------------------------------------------
MTGA_SALCH      ----------------------------------------------------------------------
MTGA_RHOP2      ----------------------------------------------------------------------
MTGA_PSEP1      ----------------------------------------------------------------------
MTGA_PSEPK      ----------------------------------------------------------------------
MTGA_PSEE4      ----------------------------------------------------------------------
MTGA_NEIMF      ----------------------------------------------------------------------
MTGA_HAEIN      ----------------------------------------------------------------------
MTGA_BURVG      ----------------------------------------------------------------------
MTGA_BURS3      ----------------------------------------------------------------------
MTGA_BURCH      ----------------------------------------------------------------------
MTGA_BURCC      ----------------------------------------------------------------------
MTGA_BURCA      ----------------------------------------------------------------------
MTGA_PSEPG      ----------------------------------------------------------------------
MTGA_BURCM      ----------------------------------------------------------------------
MTGA_BURA4      ----------------------------------------------------------------------
MTGA_BRAJA      ----------------------------------------------------------------------
MTGA_SALPK      ----------------------------------------------------------------------
MTGA_SALPA      ----------------------------------------------------------------------
MTGA_PSEPW      ----------------------------------------------------------------------
MTGA_BURM1      ----------------------------------------------------------------------
MTGA_BORPE      ----------------------------------------------------------------------
MTGA_BORPA      ----------------------------------------------------------------------
MTGA_BORBR      ----------------------------------------------------------------------
MTGA_RHOPS      ----------------------------------------------------------------------
MTGA_ENTS8      ----------------------------------------------------------------------
MTGA_CAUCR      ----------------------------------------------------------------------
MTGA_CAUCN      ----------------------------------------------------------------------
MTGA_XANC5      ----------------------------------------------------------------------
MTGA_XANAC      ----------------------------------------------------------------------
MTGA_RHOPT      ----------------------------------------------------------------------
MTGA_RHOPA      ----------------------------------------------------------------------
MTGA_SALDC      ----------------------------------------------------------------------
MTGA_PSEFS      ----------------------------------------------------------------------
MTGA_PSESM      ----------------------------------------------------------------------
MTGA_RALME      ----------------------------------------------------------------------
MTGA_XANOR      ----------------------------------------------------------------------
MTGA_XANOM      ----------------------------------------------------------------------
MTGA_PSEF5      ----------------------------------------------------------------------
MTGA_PSEPF      ----------------------------------------------------------------------
MTGA_BACTN      ----------------------------------------------------------------------
MTGA_VIBPA      ----------------------------------------------------------------------
MTGA_SHEON      ----------------------------------------------------------------------
MTGA_MESSB      ----------------------------------------------------------------------
MTGA_CYTH3      ----------------------------------------------------------------------
PBPA_MYCS2      ----------------------------------------------------------------------
MTGA_MANSM      ----------------------------------------------------------------------
MTGA_BACFR      ----------------------------------------------------------------------
MTGA_BACFN      ----------------------------------------------------------------------
MTGA_RHIE6      ----------------------------------------------------------------------
MTGA_RHILW      ----------------------------------------------------------------------
MTGA_RHIEC      ----------------------------------------------------------------------
MTGA_RHORT      ----------------------------------------------------------------------
MTGA_CHRSD      ----------------------------------------------------------------------
MTGA_RALEJ      ----------------------------------------------------------------------
MTGA_RHIL3      ----------------------------------------------------------------------
MTGA_AGRT5      ----------------------------------------------------------------------
MTGA_RHILO      ----------------------------------------------------------------------
MTGA_RHIME      ----------------------------------------------------------------------
MTGA_XYLFA      ----------------------------------------------------------------------
MTGA_XYLFT      ----------------------------------------------------------------------
MTGA_XYLF2      ----------------------------------------------------------------------
MTGA_XYLFM      ----------------------------------------------------------------------
MTGA_BRUSU      ----------------------------------------------------------------------
MTGA_BRUME      ----------------------------------------------------------------------
MTGA_JANSC      ----------------------------------------------------------------------
SP5D_BACSU      ------------MKLTVDSKVQTIMERELDNAEAKYHPDGMI---AVAMNPKNGEILGMSSRPDFDPADY
FTSI_MESVI      -----FKQDSLCLQLTIDLDLQKASYLAIYDGIKKCN----AKRGTVIILDPTGAILALVTAPSYDPNVY


                         .         .         +         .         .         .         .:490
query           NRATAALRQPGSSFKVYTYSAAMEKGMKPDTLISDAPVTWRGWSPQNYGRSYAGKVTLQVALAKSYNTVP
PBPF_BACSU      NRVT-AVRQPGSTFKLAVYGPAMEKKFKPYSLLKDELQSYGDYTPKNYDSRYEGEVTMSDAITYSKN-AP
PBPB_VIBCH      NRVLNASRQIGSLVKPAVYLTAL---AHPDTTLEDKPLTLKGWTPRNYDRQYRGEVPLYLALAQSLNVPT
PBPD_BACSU      NRAYQAYRQPGSSIKLLDYGPYIEQGATTSSTIDASKFCSKDYCPQNYNNRTYGTVTLDTAFKNSYNTPA
PBPG_BACSU      DRTTQAKRQPASTIKPLLYYKAIQSGFTPVTLMKSEETEFQTYSPSNYNGYYANKITLLQALALSDNIYA
PBPA_BACSU      NYATQTKAQPGSTIKILDYGPVIEKKWSTYEQIDDSAYTYSNGKPRDWDRKYLGPISMRYALAQSRN-IP
PBPB_HAEIN      NRALMAKRQIGSLVKPSIYLTALSNXXXXXXXVKGSP----PWQPRNYDKKYSDSVMLMDALARSLNIPT
PBPB_ECOLI      NRAMQARRSIGSLAKPATYLTALSKIYRLNTWIADAPIALRQWSPQNDDRRYSGRVMLVDALTRSMNVPT
PBPB_BUCAI      NRALKTRRSIGSLSKPITYLTALSQPEKLNTWISNYPLSGQYWTPKNNNFSFSKKVLLLDALIHSINIPT
PBPB_BUCBP      NRAIQAKRSIGSLSKPITYLAALSQPFRLNTWIPDTPINGKLWKPQNNNFEFVGKVMLIDALKNSMN-VP
PBPA_CLOTE      NRATEFYRAPGSTIKPLTYGPAIDKTSTAASSYNDAPVPEEPYNPKNSPNIYEGKMTLREALMKSKNVIS
PBPA_CLOPS      NRAYYDLKSIGSATKPLTYGPAIDLGLGAGSVVNDSPLTNKELSPKNEYNSYRGPLTFREAIKISSNLAA
PBPA_CLOPE      NRAYYDLKSIGSATKPLTYGPAIDLGLGAGSVVNDSPLSNKELSPKNEYNSYRGPLTFREAIKISSNLAA
PBPA_CLOP1      NRAYYDLKSIGSATKPLTYGPAIDLGLGAGSVVNDSPLSNKELSPKNEYNSYRGPLTFREAIKISSNLAA
PBPA_AQUAE      NRAVKALRQPGSAIKPVIYLSALLKGMTQISTIDASPSKGEDWIPKNYDEKEYGNVTLRYALAHSINTAA
PBPA_CLOAB      NRADSSLRSVGSSIKPLTYAPAIDKLATEDTIVNDSPLSSDPYNPHNDDGGYSGPVNLKTALTKSINLVA
PBPA_NEIFL      NRATQAMRQPGSTFKPFIYSAALAKGMTASTMINDAPISLPGWNPKNSDGRYAGYITLRQALTASKNMVS
PBPA_CLOBH      NRAASYLRPAGSSIKPLTYSAAIDKKATAATGFEDSPISGAPYNPKNSPDIYYGYVNVREALMRSINVVA
PBPA_CLOB1      NRAASYLRPAGSSIKPLTYSAAIDKKATAATGFEDSPISGAPYNPKNSPDIYYGYVNVREALMRSINVVA
PBPC_ECOLI      GHVDMSIRSPGSVLKPFVYGLALDEGLHPASLLQDVPRRTGDYRPGNFDSGFHGPISMSEALVRSLNLPA
PBPA_CLOBL      NRAASYLRPAGSSIKPLTYSAAIDKKATAATGFEDSPISGAPYNPRNTPDIYYGYVNVREALMRSINVVA
PBPA_CLONN      NRATNAKVAAGSSIKPLTYSAAIDSKLATATVLEDSPLPGTNWQPKNANGVYSGYLGLRDALKNSVNVYA
PBPA_NEILA      ----------------------------------------------------------------------
PBPA_PSEAE      NRAIQAKRQPGSSFKPFIYSAALDNGFTAASLVNDAPIVFKVWRPKNDTNTFLGPIPLREALYKSRNMVS
PBPA_ECOLI      ----------------------------------------------------------------------
PBPA_HAEIN      ----------------------------------------------------------------------
PBPA_STRPN      NQAVETNRDWGSTMKPITYAPALEYGVSTATIVHDEPYNYPGTNTYNWDRGYFGNITLQYALQQSRN-VP
PBPA_XYLFA      NRATQARRQPGSSFKPFVYSAALEKGFNPASIVPDAPVIFRDWSPQNDDGKFQGPMRIRDALVQSRNLVS
PBPA_NEICI      NRAAQAMRQPGSTFKPFIYSAALSKGMTASTMVNDAPISLPGWTPKNSDGRYSGYITLRQALTASKNMVS
PBPA_STRR6      NQAVETNRDWGSTMKPITYAPALEYGVSTATIVHDEPYNYPGTNTYNWDRGYFGNITLQYALQQSRN-VP
PBPA_XYLFT      NRATQARRQPGSSFKPFVYSAALEKGFNPASIVPDAPVIFRDWSPQNDDGKFQGPMRIRDALVQSRNLVS
PBPA_VIBCH      NRATQSVRQVGSSIKPFIYSAALNKGLTLATLINDAPINWTAWRPKNSPPTYTGPTRLRIGLAQSKNVMA
PBPA_NEIMB      NRAVQAMRQPGSTFKPFVYSAALSKGMTASTVVNDAPISLPGWTPKNSDGRYSGYITLRQALTASKNMVS
PBPA_NEIMA      NRAVQAMRQPGSTFKPFVYSAALSKGMTASTVVNDAPISLPGWTPKNSDGRYSGYITLRQALTASKNMVS
PBPA_STROR      NQAVETNRDWGSTMKPITYAPALEYGVYDSTIVHDSPYNYPGTSTPNWDKSYFGNITLQYALQQSRN-VP
PBPA_RICFE      ----------------------------------------------------------------------
PBPA_NEIGO      NRAVQAMRQPGSTFKPFVYSAALSKGMTASTVVNDAPISLPGWTPKNSDGRYSGYITLRQALTASKNMVS
PBPA_NEIG1      NRAVQAMRQPGSTFKPFVYSAALSKGMTASTVVNDAPISLPGWTPKNSDGRYSGYITLRQALTASKNMVS
PBPA_RICPR      ----------------------------------------------------------------------
PBPA_RICCN      ----------------------------------------------------------------------
PBPA_RICBR      DRVTQALRQPGSLSKTFVYLAALENGVKPNQIFNDGPIEMPSWRPKNYEGKFLGPITMRTGLEKSRNLVT
PBPA_RICTY      DRVTQALRQPGSLTKTFVYLAALENGVKPNQIFNDGPIEMPSWRPKNYEGQFLGEMTMRTGFEKSRNLIT
TRG_RALEH       ----------------------------------------------------------------------
MTGA_NITMU      ----------------------------------------------------------------------
MTGA_ACIAD      ----------------------------------------------------------------------
MTGA_THIDA      ----------------------------------------------------------------------
MTGA_ALCBS      ----------------------------------------------------------------------
MTGA_ACIBT      ----------------------------------------------------------------------
MTGA_DECAR      ----------------------------------------------------------------------
MTGA_ACIBY      ----------------------------------------------------------------------
MTGA_ACIBS      ----------------------------------------------------------------------
MTGA_ACIBC      ----------------------------------------------------------------------
MTGA_ACIB5      ----------------------------------------------------------------------
MTGA_ACIB3      ----------------------------------------------------------------------
MGT_STAAW       ----------------------------------------------------------------------
MGT_STAAT       ----------------------------------------------------------------------
MGT_STAAS       ----------------------------------------------------------------------
MGT_STAAR       ----------------------------------------------------------------------
MGT_STAAN       ----------------------------------------------------------------------
MGT_STAAM       ----------------------------------------------------------------------
MGT_STAAE       ----------------------------------------------------------------------
MGT_STAAC       ----------------------------------------------------------------------
MGT_STAAB       ----------------------------------------------------------------------
MGT_STAA8       ----------------------------------------------------------------------
MGT_STAA3       ----------------------------------------------------------------------
MGT_STAA1       ----------------------------------------------------------------------
MTGA_CHRVO      ----------------------------------------------------------------------
MGT_STAES       ----------------------------------------------------------------------
MGT_STAEQ       ----------------------------------------------------------------------
MTGA_NEIGO      ----------------------------------------------------------------------
MTGA_NEIG1      ----------------------------------------------------------------------
MTGA_MARMS      ----------------------------------------------------------------------
MTGA_ECOLC      ----------------------------------------------------------------------
MTGA_NEIG2      ----------------------------------------------------------------------
MTGA_AZOSE      ----------------------------------------------------------------------
MGT_STAA9       ----------------------------------------------------------------------
MGT_STAA2       ----------------------------------------------------------------------
MGT_STAHJ       ----------------------------------------------------------------------
MTGA_AZOSB      ----------------------------------------------------------------------
MTGA_SHEDO      ----------------------------------------------------------------------
MGT_STAS1       ----------------------------------------------------------------------
MTGA_NITEU      ----------------------------------------------------------------------
MTGA_METFK      ----------------------------------------------------------------------
MTGA_PECCP      ----------------------------------------------------------------------
MTGA_PHOLL      ----------------------------------------------------------------------
MTGA_RHOCS      ----------------------------------------------------------------------
MTGA_HERAR      ----------------------------------------------------------------------
MTGA_JANMA      ----------------------------------------------------------------------
MTGA_ECO55      ----------------------------------------------------------------------
MTGA_SHISS      ----------------------------------------------------------------------
MTGA_BURXL      ----------------------------------------------------------------------
MTGA_NITEC      ----------------------------------------------------------------------
MTGA_BORA1      ----------------------------------------------------------------------
MTGA_SHIDS      ----------------------------------------------------------------------
MTGA_PSEAE      ----------------------------------------------------------------------
MTGA_ECOSE      ----------------------------------------------------------------------
MTGA_ECOLI      ----------------------------------------------------------------------
MTGA_ECOHS      ----------------------------------------------------------------------
MTGA_ECODH      ----------------------------------------------------------------------
MTGA_ECOBW      ----------------------------------------------------------------------
MTGA_ECO8A      ----------------------------------------------------------------------
MTGA_ECO24      ----------------------------------------------------------------------
MTGA_PASMU      ----------------------------------------------------------------------
MTGA_ECOUT      ----------------------------------------------------------------------
MTGA_ECOSM      ----------------------------------------------------------------------
MTGA_ECOLU      ----------------------------------------------------------------------
MTGA_ECOL6      ----------------------------------------------------------------------
MTGA_ECOL5      ----------------------------------------------------------------------
MTGA_ECOK1      ----------------------------------------------------------------------
MTGA_ECO81      ----------------------------------------------------------------------
MTGA_ECO7I      ----------------------------------------------------------------------
MTGA_ECO5E      ----------------------------------------------------------------------
MTGA_ECO57      ----------------------------------------------------------------------
MTGA_ECO45      ----------------------------------------------------------------------
MTGA_ECO27      ----------------------------------------------------------------------
MTGA_NITWN      ----------------------------------------------------------------------
MTGA_LARHH      ----------------------------------------------------------------------
MTGA_SHIBS      ----------------------------------------------------------------------
MTGA_NITHX      ----------------------------------------------------------------------
MTGA_AERHH      ----------------------------------------------------------------------
MTGA_YERP3      ----------------------------------------------------------------------
MTGA_SALAR      ----------------------------------------------------------------------
MTGA_RALSO      ----------------------------------------------------------------------
MTGA_PSEMY      ----------------------------------------------------------------------
MTGA_KLEOX      ----------------------------------------------------------------------
MTGA_BDEBA      ----------------------------------------------------------------------
MTGA_YERPS      ----------------------------------------------------------------------
MTGA_YERPP      ----------------------------------------------------------------------
MTGA_YERPN      ----------------------------------------------------------------------
MTGA_YERPG      ----------------------------------------------------------------------
MTGA_YERPE      ----------------------------------------------------------------------
MTGA_YERPB      ----------------------------------------------------------------------
MTGA_YERPA      ----------------------------------------------------------------------
MTGA_YERPY      ----------------------------------------------------------------------
MTGA_SALSV      ----------------------------------------------------------------------
MTGA_PSEU5      ----------------------------------------------------------------------
MTGA_BURTA      ----------------------------------------------------------------------
MTGA_BURPS      ----------------------------------------------------------------------
MTGA_BURPP      ----------------------------------------------------------------------
MTGA_BURP8      ----------------------------------------------------------------------
MTGA_BURMA      ----------------------------------------------------------------------
MTGA_YERE8      ----------------------------------------------------------------------
MTGA_NEIM0      ----------------------------------------------------------------------
MTGA_SHEAM      ----------------------------------------------------------------------
MTGA_SALA4      ----------------------------------------------------------------------
MTGA_PSE14      ----------------------------------------------------------------------
MTGA_XANCP      ----------------------------------------------------------------------
MTGA_XANCB      ----------------------------------------------------------------------
MTGA_XANC8      ----------------------------------------------------------------------
MTGA_HAEIE      ----------------------------------------------------------------------
MTGA_ERWCT      ----------------------------------------------------------------------
MTGA_CITK8      ----------------------------------------------------------------------
MTGA_SALTY      ----------------------------------------------------------------------
MTGA_SALTI      ----------------------------------------------------------------------
MTGA_SALPB      ----------------------------------------------------------------------
MTGA_SALNS      ----------------------------------------------------------------------
MTGA_PSEU2      ----------------------------------------------------------------------
MTGA_NEIME      ----------------------------------------------------------------------
MTGA_NEIMB      ----------------------------------------------------------------------
MTGA_NEIMA      ----------------------------------------------------------------------
MTGA_SHEFN      ----------------------------------------------------------------------
MTGA_SALPC      ----------------------------------------------------------------------
MTGA_SALHS      ----------------------------------------------------------------------
MTGA_SALG2      ----------------------------------------------------------------------
MTGA_SALEP      ----------------------------------------------------------------------
MTGA_SALCH      ----------------------------------------------------------------------
MTGA_RHOP2      ----------------------------------------------------------------------
MTGA_PSEP1      ----------------------------------------------------------------------
MTGA_PSEPK      ----------------------------------------------------------------------
MTGA_PSEE4      ----------------------------------------------------------------------
MTGA_NEIMF      ----------------------------------------------------------------------
MTGA_HAEIN      ----------------------------------------------------------------------
MTGA_BURVG      ----------------------------------------------------------------------
MTGA_BURS3      ----------------------------------------------------------------------
MTGA_BURCH      ----------------------------------------------------------------------
MTGA_BURCC      ----------------------------------------------------------------------
MTGA_BURCA      ----------------------------------------------------------------------
MTGA_PSEPG      ----------------------------------------------------------------------
MTGA_BURCM      ----------------------------------------------------------------------
MTGA_BURA4      ----------------------------------------------------------------------
MTGA_BRAJA      ----------------------------------------------------------------------
MTGA_SALPK      ----------------------------------------------------------------------
MTGA_SALPA      ----------------------------------------------------------------------
MTGA_PSEPW      ----------------------------------------------------------------------
MTGA_BURM1      ----------------------------------------------------------------------
MTGA_BORPE      ----------------------------------------------------------------------
MTGA_BORPA      ----------------------------------------------------------------------
MTGA_BORBR      ----------------------------------------------------------------------
MTGA_RHOPS      ----------------------------------------------------------------------
MTGA_ENTS8      ----------------------------------------------------------------------
MTGA_CAUCR      ----------------------------------------------------------------------
MTGA_CAUCN      ----------------------------------------------------------------------
MTGA_XANC5      ----------------------------------------------------------------------
MTGA_XANAC      ----------------------------------------------------------------------
MTGA_RHOPT      ----------------------------------------------------------------------
MTGA_RHOPA      ----------------------------------------------------------------------
MTGA_SALDC      ----------------------------------------------------------------------
MTGA_PSEFS      ----------------------------------------------------------------------
MTGA_PSESM      ----------------------------------------------------------------------
MTGA_RALME      ----------------------------------------------------------------------
MTGA_XANOR      ----------------------------------------------------------------------
MTGA_XANOM      ----------------------------------------------------------------------
MTGA_PSEF5      ----------------------------------------------------------------------
MTGA_PSEPF      ----------------------------------------------------------------------
MTGA_BACTN      ----------------------------------------------------------------------
MTGA_VIBPA      ----------------------------------------------------------------------
MTGA_SHEON      ----------------------------------------------------------------------
MTGA_MESSB      ----------------------------------------------------------------------
MTGA_CYTH3      ----------------------------------------------------------------------
PBPA_MYCS2      NRAISETYPPGSTFKVITTAAALQAGARPQTQLTSAPRTPLPDSTENFGGAPCGTVSLQEAFAKSCNTAF
MTGA_MANSM      ----------------------------------------------------------------------
MTGA_BACFR      ----------------------------------------------------------------------
MTGA_BACFN      ----------------------------------------------------------------------
MTGA_RHIE6      ----------------------------------------------------------------------
MTGA_RHILW      ----------------------------------------------------------------------
MTGA_RHIEC      ----------------------------------------------------------------------
MTGA_RHORT      ----------------------------------------------------------------------
MTGA_CHRSD      ----------------------------------------------------------------------
MTGA_RALEJ      ----------------------------------------------------------------------
MTGA_RHIL3      ----------------------------------------------------------------------
MTGA_AGRT5      ----------------------------------------------------------------------
MTGA_RHILO      ----------------------------------------------------------------------
MTGA_RHIME      ----------------------------------------------------------------------
MTGA_XYLFA      ----------------------------------------------------------------------
MTGA_XYLFT      ----------------------------------------------------------------------
MTGA_XYLF2      ----------------------------------------------------------------------
MTGA_XYLFM      ----------------------------------------------------------------------
MTGA_BRUSU      ----------------------------------------------------------------------
MTGA_BRUME      ----------------------------------------------------------------------
MTGA_JANSC      ----------------------------------------------------------------------
SP5D_BACSU      NLPVWSTYEPGSTFKIITLAAALEENLKRDQFYDKGHAEVDGARLRCWKRGGHGLQTYLEVVQNSCNPGF
FTSI_MESVI      NWPVIDLYEPGSTFKPINMAIALEKAIKKNDFISDTIITNNNYYNKQFACDKNSHLNITDVLSNSSNVGM


                         *         .         .         .         .         +         .:560
query           VRLAKDVLGTQVIVDTAKAMGVATPLRSDKTIPLGTSEVTVLDQATAYAVFPADGMQSRRHGIEQVMDYE
PBPF_BACSU      AVWTLNEIGVETGKSYLKANGIDIPXXXXXXXXXXXXXVSPLQLAGAFHTFAANGTYTEPFFISSIIDED
PBPB_VIBCH      VALGMK-LGIDQVSATLGKLGVRDEIRPVPSMLLGSFSLTPYQVAQMYQTLTNSGKKAPLSALRSVLDLE
PBPD_BACSU      IRML-DRVGIQKAFSYIEPYHFAKLVDSDYLLPAATNGMTPLEMTKAYTTFGNSGSYTPSHAITKVTDLK
PBPG_BACSU      VK-THLFLGTNKLVKTAKEFGITAHLQALPSLALGTEPVRPIEMVNAYAMLANGGKKIEPTFISRVTDAA
PBPA_BACSU      ALKAFQAVGKDTAVDFANGLGLG--LTKDNVTEAGNDGVSPLTMAGAYSAFGNNGTYNEPHFVKSIEFND
PBPB_HAEIN      VNIGMKV-GLSKVIDTQKAMGDNVEIPKVPAMLLGSYTISPYDVTKLYQTLANQGGRIALTTVDSIADRQ
PBPB_ECOLI      VNLGM-ALGLPAVTETWIKLGVKDQLHPVPAMLLGALNLTPIEVAQAFQTIASGGNRAPLSALRSVIAED
PBPB_BUCAI      VNLSINI-GLKKLVDSWLLLGISTPLPS---ISLGAINLTPFEIAQVFQIIGSGGYKXXXXXXXXXXXDD
PBPB_BUCBP      IVHLSMKLGLKKIVQTWIQLGLSSHIFKYPSIALGSINLTSMEVAKIFQVISSGGNKANIISIRSVLSEN
PBPA_CLOTE      VRIEHE-LGLKTGAEYGKKFGLTIDDSMDGTAKTGVSGTNTLGMAAAYGVFGNKGALSKPVVYKKVVDRT
PBPA_CLOPS      IKVANEVGVSNSIAYGEKSRGISTQFQNDPNNPDGGNTYTL---ASAFGVFGNNGVKTNAKLYTKVLDSH
PBPA_CLOPE      IKVANEVGVSNSIAYGEKSRGISTQFQNDPNNPDGGNTYTL---ASAFGVFGNNGVKTNAKLYTKVLDSH
PBPA_CLOP1      IKVANEVGVSNSIAYGEKSRGISTQFQNDPNNPDGGNTYTL---ASAFGVFGNNGVKTNAKLYTKVLDSH
PBPA_AQUAE      VNLL-DKVGFELVLEVGKKVGLDN-LKPYYSLALGTVEVTPLQLTAAYQVFANLGTECKPFFIKKIVDEN
PBPA_CLOAB      IKL-EDKLGLSTGAAYAQKFGL-TLNNDDKSAALSLGEINTTTMAAAYGVFGNNGLYSEPRLYRKVVDKT
PBPA_NEIFL      IRILMSI-GIGYAQQYIQRFGFPSEIPASLSMALGAGETTPLRIAEGYSVFANGGYKVSAHVIDKIYDSQ
PBPA_CLOBH      VKLV-DKIGLNTSIQYAEKFGIPIDQHDRSSISLSLGELNPLIMAQAYGVFGNNGTYTEAKLYTKVVDRT
PBPA_CLOB1      VKLV-DKIGLNTSIQYAEKFGIPIDQHDRSSISLSLGELNPLIMAQAYGVFGNNGTYTEAKLYTKVVDRT
PBPC_ECOLI      VQVL-EAYGPKRFA--AKLRNVGLPLAPNLSLILGGAGAKLEDMAAAYTAFARHGKAGKLR---------
PBPA_CLOBL      VKLV-DKIGLNTSIQYAEKFGIPIDQHDRSSISLSLGELNPLIMAQAYGVFGNNGTYTEAKLYTKVVDRT
PBPA_CLONN      VKL-EDKIGLNTGVKYGEKFGLTVDKNSMAAIALGELNTNTFTMANAYGVFGNNGMYSNPRLYTKVLDRN
PBPA_NEILA      ----------------------------------------------------------------------
PBPA_PSEAE      IRVLQGLGIERAISYITKFGFQRDELPRNFSLALGTATVTPMEIAGAWSVFANGGYKVNPYVIERIESRD
PBPA_ECOLI      ----------------------------------------------------------------------
PBPA_HAEIN      ----------------------------------------------------------------------
PBPA_STRPN      AVETLNKVGLNRAKTFLNGLGIDYPIHYSNAISSNTTESDKKYGASSEKMXXXXXXXXNGGTYYKPMYIH
PBPA_XYLFA      VRLL-DAIGVDFARNYITQFGFENEIPPNLSMSLGTASLTPLSIARGYAVFANGGFRIDPWLIDEIHDRE
PBPA_NEICI      IRILMSI-GVGYAHEYIQRFGFPSELPASLSMALGTGETTPLKIAEAYSVFANGGYRVSSHVIDKIYGSD
PBPA_STRR6      AVETLNKVGLNRAKTFLNGLGIDYPIHYSNAISSNTTESDKKYGASSEKMXXXXXXXXNGGTYYKPMYIH
PBPA_XYLFT      VRLL-DAIGIDFARNYITQFGFENEIPPNLSMSLGTASLTPLSIARGYAVFANGGFRIDPWLIDEIHDRE
PBPA_VIBCH      VRVLREV-GLDETREYLTRFGFLDQLPRSETIALGAGSLTPVQMAQGFSVFANNGYFVEPFYISRVENPF
PBPA_NEIMB      IRILMSI-GVGYAQQYIRRFGFSSELPASLSMALGTGETTPLKVAEAYSVFANGGYRVSSHVIDKIYDRD
PBPA_NEIMA      IRILMSI-GVGYAQQYIRRFGFSSELPASLSMALGTGETTPLKVAEAYSVFANGGYRVSSHVIDKIYDRD
PBPA_STROR      AVETLEKVGLDRAKTFLNGLGIDYPIHYANAISSNTTESDKKYGASSEKMXXXXXXXXNGGIYPKPMYIN
PBPA_RICFE      ----------------------------------------------------------------------
PBPA_NEIGO      IRILMSI-GVGYAQQYIRRFGFPSELPASLSMALGTGETTPLKVAEAYSVFANGGYRVSSHVIDKIYDRD
PBPA_NEIG1      IRILMSI-GVGYAQQYIRRFGFPSELPASLSMALGTGETTPLKVAEAYSVFANGGYRVSSHVIDKIYDRD
PBPA_RICPR      ----------------------------------------------------------------------
PBPA_RICCN      ----------------------------------------------------------------------
PBPA_RICBR      VRVATAV-GLTKIVDIIKRFGINDNPQKVYSMVLGSIETTLERITNAYGIIANGGKRIKPHFVELIKDRN
PBPA_RICTY      VRVATAV-GLTKIVDIIKRFGINNEPKKVYSMVLGSIETTLSRITNAYAIIANGGKKVEPHFIELIKDRN
TRG_RALEH       ----------------------------------------------------------------------
MTGA_NITMU      ----------------------------------------------------------------------
MTGA_ACIAD      ----------------------------------------------------------------------
MTGA_THIDA      ----------------------------------------------------------------------
MTGA_ALCBS      ----------------------------------------------------------------------
MTGA_ACIBT      ----------------------------------------------------------------------
MTGA_DECAR      ----------------------------------------------------------------------
MTGA_ACIBY      ----------------------------------------------------------------------
MTGA_ACIBS      ----------------------------------------------------------------------
MTGA_ACIBC      ----------------------------------------------------------------------
MTGA_ACIB5      ----------------------------------------------------------------------
MTGA_ACIB3      ----------------------------------------------------------------------
MGT_STAAW       ----------------------------------------------------------------------
MGT_STAAT       ----------------------------------------------------------------------
MGT_STAAS       ----------------------------------------------------------------------
MGT_STAAR       ----------------------------------------------------------------------
MGT_STAAN       ----------------------------------------------------------------------
MGT_STAAM       ----------------------------------------------------------------------
MGT_STAAE       ----------------------------------------------------------------------
MGT_STAAC       ----------------------------------------------------------------------
MGT_STAAB       ----------------------------------------------------------------------
MGT_STAA8       ----------------------------------------------------------------------
MGT_STAA3       ----------------------------------------------------------------------
MGT_STAA1       ----------------------------------------------------------------------
MTGA_CHRVO      ----------------------------------------------------------------------
MGT_STAES       ----------------------------------------------------------------------
MGT_STAEQ       ----------------------------------------------------------------------
MTGA_NEIGO      ----------------------------------------------------------------------
MTGA_NEIG1      ----------------------------------------------------------------------
MTGA_MARMS      ----------------------------------------------------------------------
MTGA_ECOLC      ----------------------------------------------------------------------
MTGA_NEIG2      ----------------------------------------------------------------------
MTGA_AZOSE      ----------------------------------------------------------------------
MGT_STAA9       ----------------------------------------------------------------------
MGT_STAA2       ----------------------------------------------------------------------
MGT_STAHJ       ----------------------------------------------------------------------
MTGA_AZOSB      ----------------------------------------------------------------------
MTGA_SHEDO      ----------------------------------------------------------------------
MGT_STAS1       ----------------------------------------------------------------------
MTGA_NITEU      ----------------------------------------------------------------------
MTGA_METFK      ----------------------------------------------------------------------
MTGA_PECCP      ----------------------------------------------------------------------
MTGA_PHOLL      ----------------------------------------------------------------------
MTGA_RHOCS      ----------------------------------------------------------------------
MTGA_HERAR      ----------------------------------------------------------------------
MTGA_JANMA      ----------------------------------------------------------------------
MTGA_ECO55      ----------------------------------------------------------------------
MTGA_SHISS      ----------------------------------------------------------------------
MTGA_BURXL      ----------------------------------------------------------------------
MTGA_NITEC      ----------------------------------------------------------------------
MTGA_BORA1      ----------------------------------------------------------------------
MTGA_SHIDS      ----------------------------------------------------------------------
MTGA_PSEAE      ----------------------------------------------------------------------
MTGA_ECOSE      ----------------------------------------------------------------------
MTGA_ECOLI      ----------------------------------------------------------------------
MTGA_ECOHS      ----------------------------------------------------------------------
MTGA_ECODH      ----------------------------------------------------------------------
MTGA_ECOBW      ----------------------------------------------------------------------
MTGA_ECO8A      ----------------------------------------------------------------------
MTGA_ECO24      ----------------------------------------------------------------------
MTGA_PASMU      ----------------------------------------------------------------------
MTGA_ECOUT      ----------------------------------------------------------------------
MTGA_ECOSM      ----------------------------------------------------------------------
MTGA_ECOLU      ----------------------------------------------------------------------
MTGA_ECOL6      ----------------------------------------------------------------------
MTGA_ECOL5      ----------------------------------------------------------------------
MTGA_ECOK1      ----------------------------------------------------------------------
MTGA_ECO81      ----------------------------------------------------------------------
MTGA_ECO7I      ----------------------------------------------------------------------
MTGA_ECO5E      ----------------------------------------------------------------------
MTGA_ECO57      ----------------------------------------------------------------------
MTGA_ECO45      ----------------------------------------------------------------------
MTGA_ECO27      ----------------------------------------------------------------------
MTGA_NITWN      ----------------------------------------------------------------------
MTGA_LARHH      ----------------------------------------------------------------------
MTGA_SHIBS      ----------------------------------------------------------------------
MTGA_NITHX      ----------------------------------------------------------------------
MTGA_AERHH      ----------------------------------------------------------------------
MTGA_YERP3      ----------------------------------------------------------------------
MTGA_SALAR      ----------------------------------------------------------------------
MTGA_RALSO      ----------------------------------------------------------------------
MTGA_PSEMY      ----------------------------------------------------------------------
MTGA_KLEOX      ----------------------------------------------------------------------
MTGA_BDEBA      ----------------------------------------------------------------------
MTGA_YERPS      ----------------------------------------------------------------------
MTGA_YERPP      ----------------------------------------------------------------------
MTGA_YERPN      ----------------------------------------------------------------------
MTGA_YERPG      ----------------------------------------------------------------------
MTGA_YERPE      ----------------------------------------------------------------------
MTGA_YERPB      ----------------------------------------------------------------------
MTGA_YERPA      ----------------------------------------------------------------------
MTGA_YERPY      ----------------------------------------------------------------------
MTGA_SALSV      ----------------------------------------------------------------------
MTGA_PSEU5      ----------------------------------------------------------------------
MTGA_BURTA      ----------------------------------------------------------------------
MTGA_BURPS      ----------------------------------------------------------------------
MTGA_BURPP      ----------------------------------------------------------------------
MTGA_BURP8      ----------------------------------------------------------------------
MTGA_BURMA      ----------------------------------------------------------------------
MTGA_YERE8      ----------------------------------------------------------------------
MTGA_NEIM0      ----------------------------------------------------------------------
MTGA_SHEAM      ----------------------------------------------------------------------
MTGA_SALA4      ----------------------------------------------------------------------
MTGA_PSE14      ----------------------------------------------------------------------
MTGA_XANCP      ----------------------------------------------------------------------
MTGA_XANCB      ----------------------------------------------------------------------
MTGA_XANC8      ----------------------------------------------------------------------
MTGA_HAEIE      ----------------------------------------------------------------------
MTGA_ERWCT      ----------------------------------------------------------------------
MTGA_CITK8      ----------------------------------------------------------------------
MTGA_SALTY      ----------------------------------------------------------------------
MTGA_SALTI      ----------------------------------------------------------------------
MTGA_SALPB      ----------------------------------------------------------------------
MTGA_SALNS      ----------------------------------------------------------------------
MTGA_PSEU2      ----------------------------------------------------------------------
MTGA_NEIME      ----------------------------------------------------------------------
MTGA_NEIMB      ----------------------------------------------------------------------
MTGA_NEIMA      ----------------------------------------------------------------------
MTGA_SHEFN      ----------------------------------------------------------------------
MTGA_SALPC      ----------------------------------------------------------------------
MTGA_SALHS      ----------------------------------------------------------------------
MTGA_SALG2      ----------------------------------------------------------------------
MTGA_SALEP      ----------------------------------------------------------------------
MTGA_SALCH      ----------------------------------------------------------------------
MTGA_RHOP2      ----------------------------------------------------------------------
MTGA_PSEP1      ----------------------------------------------------------------------
MTGA_PSEPK      ----------------------------------------------------------------------
MTGA_PSEE4      ----------------------------------------------------------------------
MTGA_NEIMF      ----------------------------------------------------------------------
MTGA_HAEIN      ----------------------------------------------------------------------
MTGA_BURVG      ----------------------------------------------------------------------
MTGA_BURS3      ----------------------------------------------------------------------
MTGA_BURCH      ----------------------------------------------------------------------
MTGA_BURCC      ----------------------------------------------------------------------
MTGA_BURCA      ----------------------------------------------------------------------
MTGA_PSEPG      ----------------------------------------------------------------------
MTGA_BURCM      ----------------------------------------------------------------------
MTGA_BURA4      ----------------------------------------------------------------------
MTGA_BRAJA      ----------------------------------------------------------------------
MTGA_SALPK      ----------------------------------------------------------------------
MTGA_SALPA      ----------------------------------------------------------------------
MTGA_PSEPW      ----------------------------------------------------------------------
MTGA_BURM1      ----------------------------------------------------------------------
MTGA_BORPE      ----------------------------------------------------------------------
MTGA_BORPA      ----------------------------------------------------------------------
MTGA_BORBR      ----------------------------------------------------------------------
MTGA_RHOPS      ----------------------------------------------------------------------
MTGA_ENTS8      ----------------------------------------------------------------------
MTGA_CAUCR      ----------------------------------------------------------------------
MTGA_CAUCN      ----------------------------------------------------------------------
MTGA_XANC5      ----------------------------------------------------------------------
MTGA_XANAC      ----------------------------------------------------------------------
MTGA_RHOPT      ----------------------------------------------------------------------
MTGA_RHOPA      ----------------------------------------------------------------------
MTGA_SALDC      ----------------------------------------------------------------------
MTGA_PSEFS      ----------------------------------------------------------------------
MTGA_PSESM      ----------------------------------------------------------------------
MTGA_RALME      ----------------------------------------------------------------------
MTGA_XANOR      ----------------------------------------------------------------------
MTGA_XANOM      ----------------------------------------------------------------------
MTGA_PSEF5      ----------------------------------------------------------------------
MTGA_PSEPF      ----------------------------------------------------------------------
MTGA_BACTN      ----------------------------------------------------------------------
MTGA_VIBPA      ----------------------------------------------------------------------
MTGA_SHEON      ----------------------------------------------------------------------
MTGA_MESSB      ----------------------------------------------------------------------
MTGA_CYTH3      ----------------------------------------------------------------------
PBPA_MYCS2      VELGLST-GTDKLKAMAQAFGLDTP---PPAIPLQVAELTPLQNAQVAATIANDGIAMRPYLVESL---K
MTGA_MANSM      ----------------------------------------------------------------------
MTGA_BACFR      ----------------------------------------------------------------------
MTGA_BACFN      ----------------------------------------------------------------------
MTGA_RHIE6      ----------------------------------------------------------------------
MTGA_RHILW      ----------------------------------------------------------------------
MTGA_RHIEC      ----------------------------------------------------------------------
MTGA_RHORT      ----------------------------------------------------------------------
MTGA_CHRSD      ----------------------------------------------------------------------
MTGA_RALEJ      ----------------------------------------------------------------------
MTGA_RHIL3      ----------------------------------------------------------------------
MTGA_AGRT5      ----------------------------------------------------------------------
MTGA_RHILO      ----------------------------------------------------------------------
MTGA_RHIME      ----------------------------------------------------------------------
MTGA_XYLFA      ----------------------------------------------------------------------
MTGA_XYLFT      ----------------------------------------------------------------------
MTGA_XYLF2      ----------------------------------------------------------------------
MTGA_XYLFM      ----------------------------------------------------------------------
MTGA_BRUSU      ----------------------------------------------------------------------
MTGA_BRUME      ----------------------------------------------------------------------
MTGA_JANSC      ----------------------------------------------------------------------
SP5D_BACSU      VRLGKEKLGQKTGIDLGEGTGILFPLERVGPVEQATTSVTPIQQVAAVSAAVNGGTLYTPYIAKEWIDPV
FTSI_MESVI      VRLAPEILGNNVFLETDFPLSSYSSLKNEFTSYNIESAVTSFGQGLAYACLSNGGNIIRPYIVDGLFDIQ


                         .         .         .         *         .         .         .:630
query           GNVLYDFSHDEPPAKRVLSEEANSKMNQMLVTIPVMGTARRGALDNGIVSGGKTGTSQAYRDAWYVGFTG
PBPF_BACSU      GETIADHKEE---GKRVFSKQTSWNMTRMLQQVVKKGTATSGTYHGDLASTSYTGVSGATKDAWFAGYTP
PBPB_VIBCH      GNVLYE---SLPRVSQAVDQQAAWLTTYAMKQGVQEGTGRLNAQFSSAALAGKTGTTNDNRDSWFVGVDG
PBPD_BACSU      GKTLYKWN---DKATQIFSVRTNMQLKKLMSSVVKSGTGKK-AYFNAPYIGGKTGTSNDYHDMWFVGLTD
PBPG_BACSU      GHVLYENPNQH---KQVLDEKATASMMTGMFDIDLNGTGRTIANRLTRTYAGKSGTTSA--DSWMIGFNP
PBPA_BACSU      GTKL-DLT---PKSKSAMSDYTAFMITDMLKTAVKTGTGQLAQVP-GVEVAGKTGTSGGARDSWFVGYTP
PBPB_HAEIN      GNLI--FQHDK-SAKQVVPQEAAFQTLFAMQQTVERGTARSLQKDYALHLAGKTGTTNESRDTWFVGIDG
PBPB_ECOLI      GKVLY---QSFPQAERAVPAQAAYLTLWTMQQVVQRGTGRQGAKYPNLHLAGKTGTTNNNVDTWFAGIDG
PBPB_BUCAI      GKVLY---QNLPQSIHIESSEASYLTLYGMQQVVKSGTAKSGTIFKEFSLAGKTGTTNNLVDNWFVGIDG
PBPB_BUCBP      NKLIY---HSFPQSKQVISAQASYLTLYAMQSVVSSGTAKHGKFFKNMHLAGKTGTTNNLVDSWFVGIDG
PBPA_CLOTE      GKVLLENKY---ASSKVMSPEAAYILYDLLKGPVSYTPGATGMKANGPMARGKTGTSNQSSDLWFAGLSP
PBPA_CLOPS      GNVLLDTS--TPEEIKIFSPQTSYIVYDMLKDQVESGSAKPAKFGN-IPVAXXXXXXXXXXXYLFAGLTP
PBPA_CLOPE      GNVILDTS--TPEETKIFSPQASYIVYDMLKDQVESGSAKSAKFGN-IPVAXXXXXXXXXXXYLFAGLTP
PBPA_CLOP1      GNVILDTS--TPEETKIFSPQASYIVYDMLKDQVESGSAKPAKFGN-IPVAXXXXXXXXXXXYLFAGLTP
PBPA_AQUAE      GXXXXXXXXXXKPETRVPVD--------MLRAVVLEGTARRASVLDRIVA-GKTGTTDDFQDAWFVGFSP
PBPA_CLOAB      GKVLLENNYS---TRKVISPQSAYIMYDLLKGPVSAGGTGSYARFGDMPVAGKTGTASDSKNLWFCGLTP
PBPA_NEIFL      GRLRAQMQPAGENAPQAIDPRNAYIMYKIMQDVVRVGTARGAATLGRSDIAGKTGTTNDNKDAWFVGFNP
PBPA_CLOBH      GKVLLE---PKTNTKKVLSPEAAFITYDMLQPVSESGTGPQANFGNMEVR-GKTGTSSDMKNLWFCGLTP
PBPA_CLOB1      GKVLLE---PKTNTKKVLSPEAAFITYDMLQPVSESGTGPQANFGNMEVR-GKTGTSSDMKNLWFCGLTP
PBPC_ECOLI      ------LQPDDPLLERPLMSSGAAWIIRRIMADEAQPLPD-SALPRVAPLAWKTGTSYGYRDAWAIGVNA
PBPA_CLOBL      GKVLLE---PKTNTKKVLSPEAAFITYDMLQPVSESGTGPQANFGNMEVR-GKTGTSSDMKNLWFCGLTP
PBPA_CLONN      GNVLLE---TKTQATQVISPEAAYIMYDLLKGPVKEGTATRHTYHSDIPIAGKTGSSTKFKNLWFCGLTP
PBPA_NEILA      ----------------------------------------------------------------------
PBPA_PSEAE      GQVLYDPEHPETPAERIIDARTAYIMTSMLQDVIKRGTGRRALALKRTDLAGKTGTTNDSKDGWFSGYNS
PBPA_ECOLI      --------------------------------------------------GGKTGTTNSSKDAWFSGYGP
PBPA_HAEIN      --------------------------------------------------GGKTGTTNSSKVAWYAGFGA
PBPA_STRPN      KVVFSDGSEKENVGTRAMKETTAYMMTDMMKTVLTYGTGRNAYL-AWLPQAGKTGTSNVAPDELFAGYTR
PBPA_XYLFA      HKLIFKKNNNEPPAPRAIDERVVFQLVSMMRDVVLRGTATAARSLNRQDIAGKTGSTNEHRDAWFSGFGG
PBPA_NEICI      GRLRAQMQPAGQNAPQAIDPRNAYIMYKIMQDXXXXXXXXXXXXXXXSDIAGKTGTTNDNKDAWFVGFNP
PBPA_STRR6      KVVFSDGSEKENVGTRAMKETTAYMMTDMMKTVLSYGTGRNAYL-AWLPQAGKTGTSNVAPDELFAGYTR
PBPA_XYLFT      TNVTQSTSHNTPMAPRAIDERVVFQLVSMMRDVVLRGTATAARSLNRQDIAGKTGSTNEHRDAWFSGFGG
PBPA_VIBCH      GNILDEFAEQDPYAPKVISEQNAFLTREMLYSTGWNGTGWRAQALKRRDIGGKTGTTNDSKDAWYNGYAP
PBPA_NEIMB      GRLRAQMQPAGQNAPQAIDPRNAYIMYKIMQDXXXXXXXXXXXXXXXXDIAGKTGTTNDNKDAWFVGFNP
PBPA_NEIMA      GRLRAQMQPAGQNAPQAIDPRNAYIMYKIMQDXXXXXXXXXXXXXXXXDIAGKTGTTNDNKDAWFVGFNP
PBPA_STROR      KIVFSDGSSKEDSGTRAMKETTAYMMTDMMKTVLAYGTGR-GAYLPWLPQAGKTGTSNVAPDEMFVGYTR
PBPA_RICFE      ----------------------------------------------------------------------
PBPA_NEIGO      GRLRAQMQPAGQNAPQAIDPRNAYIMYKIMQDXXXXXXXXXXXXXXXXDIAGKTGTTNDNKDAWFVGFNP
PBPA_NEIG1      GRLRAQMQPAGQNAPQAIDPRNAYIMYKIMQDXXXXXXXXXXXXXXXXDIAGKTGTTNDNKDAWFVGFNP
PBPA_RICPR      ----------------------------------------------------------------------
PBPA_RICCN      ----------------------------------------------------------------------
PBPA_RICBR      GKVIYDNAILEIPAENVTDAASDYQITSLLTGVVDRGTA-YSAKKLGKVIGGKTGTSNDSKDTWFIGFTP
PBPA_RICTY      GKIIYRRDNRECFSCNIL----DSDLDTAILEIPKEDIYRTGAIDSGTIIAGKTGTSNDSKDTWFIGFTP
TRG_RALEH       ----------------------------------------------------------------------
MTGA_NITMU      ----------------------------------------------------------------------
MTGA_ACIAD      ----------------------------------------------------------------------
MTGA_THIDA      ----------------------------------------------------------------------
MTGA_ALCBS      ----------------------------------------------------------------------
MTGA_ACIBT      ----------------------------------------------------------------------
MTGA_DECAR      ----------------------------------------------------------------------
MTGA_ACIBY      ----------------------------------------------------------------------
MTGA_ACIBS      ----------------------------------------------------------------------
MTGA_ACIBC      ----------------------------------------------------------------------
MTGA_ACIB5      ----------------------------------------------------------------------
MTGA_ACIB3      ----------------------------------------------------------------------
MGT_STAAW       ----------------------------------------------------------------------
MGT_STAAT       ----------------------------------------------------------------------
MGT_STAAS       ----------------------------------------------------------------------
MGT_STAAR       ----------------------------------------------------------------------
MGT_STAAN       ----------------------------------------------------------------------
MGT_STAAM       ----------------------------------------------------------------------
MGT_STAAE       ----------------------------------------------------------------------
MGT_STAAC       ----------------------------------------------------------------------
MGT_STAAB       ----------------------------------------------------------------------
MGT_STAA8       ----------------------------------------------------------------------
MGT_STAA3       ----------------------------------------------------------------------
MGT_STAA1       ----------------------------------------------------------------------
MTGA_CHRVO      ----------------------------------------------------------------------
MGT_STAES       ----------------------------------------------------------------------
MGT_STAEQ       ----------------------------------------------------------------------
MTGA_NEIGO      ----------------------------------------------------------------------
MTGA_NEIG1      ----------------------------------------------------------------------
MTGA_MARMS      ----------------------------------------------------------------------
MTGA_ECOLC      ----------------------------------------------------------------------
MTGA_NEIG2      ----------------------------------------------------------------------
MTGA_AZOSE      ----------------------------------------------------------------------
MGT_STAA9       ----------------------------------------------------------------------
MGT_STAA2       ----------------------------------------------------------------------
MGT_STAHJ       ----------------------------------------------------------------------
MTGA_AZOSB      ----------------------------------------------------------------------
MTGA_SHEDO      ----------------------------------------------------------------------
MGT_STAS1       ----------------------------------------------------------------------
MTGA_NITEU      ----------------------------------------------------------------------
MTGA_METFK      ----------------------------------------------------------------------
MTGA_PECCP      ----------------------------------------------------------------------
MTGA_PHOLL      ----------------------------------------------------------------------
MTGA_RHOCS      ----------------------------------------------------------------------
MTGA_HERAR      ----------------------------------------------------------------------
MTGA_JANMA      ----------------------------------------------------------------------
MTGA_ECO55      ----------------------------------------------------------------------
MTGA_SHISS      ----------------------------------------------------------------------
MTGA_BURXL      ----------------------------------------------------------------------
MTGA_NITEC      ----------------------------------------------------------------------
MTGA_BORA1      ----------------------------------------------------------------------
MTGA_SHIDS      ----------------------------------------------------------------------
MTGA_PSEAE      ----------------------------------------------------------------------
MTGA_ECOSE      ----------------------------------------------------------------------
MTGA_ECOLI      ----------------------------------------------------------------------
MTGA_ECOHS      ----------------------------------------------------------------------
MTGA_ECODH      ----------------------------------------------------------------------
MTGA_ECOBW      ----------------------------------------------------------------------
MTGA_ECO8A      ----------------------------------------------------------------------
MTGA_ECO24      ----------------------------------------------------------------------
MTGA_PASMU      ----------------------------------------------------------------------
MTGA_ECOUT      ----------------------------------------------------------------------
MTGA_ECOSM      ----------------------------------------------------------------------
MTGA_ECOLU      ----------------------------------------------------------------------
MTGA_ECOL6      ----------------------------------------------------------------------
MTGA_ECOL5      ----------------------------------------------------------------------
MTGA_ECOK1      ----------------------------------------------------------------------
MTGA_ECO81      ----------------------------------------------------------------------
MTGA_ECO7I      ----------------------------------------------------------------------
MTGA_ECO5E      ----------------------------------------------------------------------
MTGA_ECO57      ----------------------------------------------------------------------
MTGA_ECO45      ----------------------------------------------------------------------
MTGA_ECO27      ----------------------------------------------------------------------
MTGA_NITWN      ----------------------------------------------------------------------
MTGA_LARHH      ----------------------------------------------------------------------
MTGA_SHIBS      ----------------------------------------------------------------------
MTGA_NITHX      ----------------------------------------------------------------------
MTGA_AERHH      ----------------------------------------------------------------------
MTGA_YERP3      ----------------------------------------------------------------------
MTGA_SALAR      ----------------------------------------------------------------------
MTGA_RALSO      ----------------------------------------------------------------------
MTGA_PSEMY      ----------------------------------------------------------------------
MTGA_KLEOX      ----------------------------------------------------------------------
MTGA_BDEBA      ----------------------------------------------------------------------
MTGA_YERPS      ----------------------------------------------------------------------
MTGA_YERPP      ----------------------------------------------------------------------
MTGA_YERPN      ----------------------------------------------------------------------
MTGA_YERPG      ----------------------------------------------------------------------
MTGA_YERPE      ----------------------------------------------------------------------
MTGA_YERPB      ----------------------------------------------------------------------
MTGA_YERPA      ----------------------------------------------------------------------
MTGA_YERPY      ----------------------------------------------------------------------
MTGA_SALSV      ----------------------------------------------------------------------
MTGA_PSEU5      ----------------------------------------------------------------------
MTGA_BURTA      ----------------------------------------------------------------------
MTGA_BURPS      ----------------------------------------------------------------------
MTGA_BURPP      ----------------------------------------------------------------------
MTGA_BURP8      ----------------------------------------------------------------------
MTGA_BURMA      ----------------------------------------------------------------------
MTGA_YERE8      ----------------------------------------------------------------------
MTGA_NEIM0      ----------------------------------------------------------------------
MTGA_SHEAM      ----------------------------------------------------------------------
MTGA_SALA4      ----------------------------------------------------------------------
MTGA_PSE14      ----------------------------------------------------------------------
MTGA_XANCP      ----------------------------------------------------------------------
MTGA_XANCB      ----------------------------------------------------------------------
MTGA_XANC8      ----------------------------------------------------------------------
MTGA_HAEIE      ----------------------------------------------------------------------
MTGA_ERWCT      ----------------------------------------------------------------------
MTGA_CITK8      ----------------------------------------------------------------------
MTGA_SALTY      ----------------------------------------------------------------------
MTGA_SALTI      ----------------------------------------------------------------------
MTGA_SALPB      ----------------------------------------------------------------------
MTGA_SALNS      ----------------------------------------------------------------------
MTGA_PSEU2      ----------------------------------------------------------------------
MTGA_NEIME      ----------------------------------------------------------------------
MTGA_NEIMB      ----------------------------------------------------------------------
MTGA_NEIMA      ----------------------------------------------------------------------
MTGA_SHEFN      ----------------------------------------------------------------------
MTGA_SALPC      ----------------------------------------------------------------------
MTGA_SALHS      ----------------------------------------------------------------------
MTGA_SALG2      ----------------------------------------------------------------------
MTGA_SALEP      ----------------------------------------------------------------------
MTGA_SALCH      ----------------------------------------------------------------------
MTGA_RHOP2      ----------------------------------------------------------------------
MTGA_PSEP1      ----------------------------------------------------------------------
MTGA_PSEPK      ----------------------------------------------------------------------
MTGA_PSEE4      ----------------------------------------------------------------------
MTGA_NEIMF      ----------------------------------------------------------------------
MTGA_HAEIN      ----------------------------------------------------------------------
MTGA_BURVG      ----------------------------------------------------------------------
MTGA_BURS3      ----------------------------------------------------------------------
MTGA_BURCH      ----------------------------------------------------------------------
MTGA_BURCC      ----------------------------------------------------------------------
MTGA_BURCA      ----------------------------------------------------------------------
MTGA_PSEPG      ----------------------------------------------------------------------
MTGA_BURCM      ----------------------------------------------------------------------
MTGA_BURA4      ----------------------------------------------------------------------
MTGA_BRAJA      ----------------------------------------------------------------------
MTGA_SALPK      ----------------------------------------------------------------------
MTGA_SALPA      ----------------------------------------------------------------------
MTGA_PSEPW      ----------------------------------------------------------------------
MTGA_BURM1      ----------------------------------------------------------------------
MTGA_BORPE      ----------------------------------------------------------------------
MTGA_BORPA      ----------------------------------------------------------------------
MTGA_BORBR      ----------------------------------------------------------------------
MTGA_RHOPS      ----------------------------------------------------------------------
MTGA_ENTS8      ----------------------------------------------------------------------
MTGA_CAUCR      ----------------------------------------------------------------------
MTGA_CAUCN      ----------------------------------------------------------------------
MTGA_XANC5      ----------------------------------------------------------------------
MTGA_XANAC      ----------------------------------------------------------------------
MTGA_RHOPT      ----------------------------------------------------------------------
MTGA_RHOPA      ----------------------------------------------------------------------
MTGA_SALDC      ----------------------------------------------------------------------
MTGA_PSEFS      ----------------------------------------------------------------------
MTGA_PSESM      ----------------------------------------------------------------------
MTGA_RALME      ----------------------------------------------------------------------
MTGA_XANOR      ----------------------------------------------------------------------
MTGA_XANOM      ----------------------------------------------------------------------
MTGA_PSEF5      ----------------------------------------------------------------------
MTGA_PSEPF      ----------------------------------------------------------------------
MTGA_BACTN      ----------------------------------------------------------------------
MTGA_VIBPA      ----------------------------------------------------------------------
MTGA_SHEON      ----------------------------------------------------------------------
MTGA_MESSB      ----------------------------------------------------------------------
MTGA_CYTH3      ----------------------------------------------------------------------
PBPA_MYCS2      GPDLATISTTTPQERRAVSPQVAATLTDLMVAAEQV-TQQKGAI-AGVQIASKTGTAEHGTDAWYIAF--
MTGA_MANSM      ----------------------------------------------------------------------
MTGA_BACFR      ----------------------------------------------------------------------
MTGA_BACFN      ----------------------------------------------------------------------
MTGA_RHIE6      ----------------------------------------------------------------------
MTGA_RHILW      ----------------------------------------------------------------------
MTGA_RHIEC      ----------------------------------------------------------------------
MTGA_RHORT      ----------------------------------------------------------------------
MTGA_CHRSD      ----------------------------------------------------------------------
MTGA_RALEJ      ----------------------------------------------------------------------
MTGA_RHIL3      ----------------------------------------------------------------------
MTGA_AGRT5      ----------------------------------------------------------------------
MTGA_RHILO      ----------------------------------------------------------------------
MTGA_RHIME      ----------------------------------------------------------------------
MTGA_XYLFA      ----------------------------------------------------------------------
MTGA_XYLFT      ----------------------------------------------------------------------
MTGA_XYLF2      ----------------------------------------------------------------------
MTGA_XYLFM      ----------------------------------------------------------------------
MTGA_BRUSU      ----------------------------------------------------------------------
MTGA_BRUME      ----------------------------------------------------------------------
MTGA_JANSC      ----------------------------------------------------------------------
SP5D_BACSU      TKKTV--KKQSPIAKKVISEETSKQIRYALESVVAEGTGRNAFVE-GYRVGGKTGTAQKVKDGKYL----
FTSI_MESVI      NEKLFTLNNNKLLKTKVFSPSTTEIVLDMLEEVIFNGTGSSCFLP-GYRIGGKTGTSQKHAE------QG


                         .         +         .         .         .         .         *:700
query           NYTTAVWFGNDEFTPMNNMTGGALPAMTYKRLMDYAHQGMELRPIPGIQNLLPTGxxxxxxxxxxxxxxx
PBPF_BACSU      KITGAVWMGYDK-TDQNHKAGSSYPTRLFKDILTQA----------------------------------
PBPB_VIBCH      REVTTIWLGRDDNQP-TKLTGASGALRVYAQYLKY-----------------------------------
PBPD_BACSU      TYTMGVWVGKD-----------------------------------------------------------
PBPG_BACSU      KLAAGVWTGYDKNSTIDSVEEKSYAKTIWADFMEDALKG-------------------------------
PBPA_BACSU      QYTAAVWTGMGE----------------------------------------------------------
PBPB_HAEIN      KNISTVWLGRDD-NGETKLTGASGALQIYK----------------------------------------
PBPB_ECOLI      STVTITWVGRDNNQP-TKLYGASGAMSIYQRYL-------------------------------------
PBPB_BUCAI      KQIVITWIGRDNHTTRLYSSSGAM--QIYKRYLQYQ------RPVP------------------------
PBPB_BUCBP      RQVVIVWIGRD-----------------------------------------------------------
PBPA_CLOTE      YYSAAVWIGKDDYSPFTNYIGSSDAALIWKLIMGEAHKNLEYKTI-------------------------
PBPA_CLOPS      YYSAAIWIGYDKPREMRT-SSGIVTSPIFGKIMGLAHKGLQYKEV-------------------------
PBPA_CLOPE      YYSAAIWIGYDKPREMRT-SSGTVTSPIFGKIMGLAHKDLQYKEVDNL----------------------
PBPA_CLOP1      YYSAAIWIGYDKPREMRT-SSGTVTSPIFGKIMGLAHKDLQYKEV-------------------------
PBPA_AQUAE      YIVTGVWVGYDVKKSLGKHMSGALPIIDYMKVVTYPNEDFELPPENIVVNINP-----------------
PBPA_CLOAB      YYSAAVWVGNDQPTKLS-----------------------------------------------------
PBPA_NEIFL      NVVTAVYIGFDKPRSMGRAYGGTIAVPVWVEYIGFALKGTSVKPMKAPEGVVTNG---------------
PBPA_CLOBH      YYSAAVWIGNDNSSTVDGV---------------------------------------------------
PBPA_CLOB1      YYSAAVWIGNDNSSTVDGV---------------------------------------------------
PBPC_ECOLI      RYVIGIWTGRPDGTPVVGQFGFA-----------------------------------------------
PBPA_CLOBL      YYSAAVWIGNDNSSTVDGV---------------------------------------------------
PBPA_CLONN      YYSGAVWIEN------------------------------------------------------------
PBPA_NEILA      ----------------------------------------------------------------------
PBPA_PSEAE      DYVTSVWVGFDQPETLGRREGGTVALPIWIRYMGFALKDKPMHTMPGIVSL-------------------
PBPA_ECOLI      GVVTSVWIGFDD----------------------------------------------------------
PBPA_HAEIN      NLVTTTYVGFDD----------------------------------------------------------
PBPA_STRPN      KYSMAVWTGSNRLTPLVG-NGLTVAAKVYRSMMTYLSEG-------------------------------
PBPA_XYLFA      PYVTTVWVGRDDFQSLGYREYGGKAALPI--WIEYMRTALKDKPI--ARNVPPQG---------------
PBPA_NEICI      DVVTAVYIGFDKPKSMGRAYGGTIAVPVWVDYMRFALKG-------------------------------
PBPA_STRR6      KYSMAVWTGSNRLTPLVG-NGLTVAAKVYRSMMTYLSEG-------------------------------
PBPA_XYLFT      PYVTTVWVGRDDFQSLGYREYGGKAALPI--WIEYMRTALKDKPI--ARNAPPQG---------------
PBPA_VIBCH      GIVGVAWVGFDD----------------------------------------------------------
PBPA_NEIMB      DVVTAVYIGFDKPKSMGRVYGGTIAVPVWVDYMRFALKGKQ-----------------------------
PBPA_NEIMA      DVVTAVYIGFDKPKSMGRVYGGTIAVPVWVDYMRFALKGKQ-----------------------------
PBPA_STROR      KYSMAVWTGSNRLTPIVG-DGFYVAAKVYRSMMTY-----------------------------------
PBPA_RICFE      ----------------------------------------------------------------------
PBPA_NEIGO      DVVTAVYIGFDKPKSMGRAYGGTIAVPVWVDYMRFALKGKQ-----------------------------
PBPA_NEIG1      DVVTAVYIGFDKPKSMGRAYGGTIAVPVWVDYMRFALKGKQ-----------------------------
PBPA_RICPR      ----------------------------------------------------------------------
PBPA_RICCN      ----------------------------------------------------------------------
PBPA_RICBR      KIVVGSYVGYD-----------------------------------------------------------
PBPA_RICTY      KIVVGSYVGYD-----------------------------------------------------------
TRG_RALEH       ----------------------------------------------------------------------
MTGA_NITMU      ----------------------------------------------------------------------
MTGA_ACIAD      ----------------------------------------------------------------------
MTGA_THIDA      ----------------------------------------------------------------------
MTGA_ALCBS      ----------------------------------------------------------------------
MTGA_ACIBT      ----------------------------------------------------------------------
MTGA_DECAR      ----------------------------------------------------------------------
MTGA_ACIBY      ----------------------------------------------------------------------
MTGA_ACIBS      ----------------------------------------------------------------------
MTGA_ACIBC      ----------------------------------------------------------------------
MTGA_ACIB5      ----------------------------------------------------------------------
MTGA_ACIB3      ----------------------------------------------------------------------
MGT_STAAW       ----------------------------------------------------------------------
MGT_STAAT       ----------------------------------------------------------------------
MGT_STAAS       ----------------------------------------------------------------------
MGT_STAAR       ----------------------------------------------------------------------
MGT_STAAN       ----------------------------------------------------------------------
MGT_STAAM       ----------------------------------------------------------------------
MGT_STAAE       ----------------------------------------------------------------------
MGT_STAAC       ----------------------------------------------------------------------
MGT_STAAB       ----------------------------------------------------------------------
MGT_STAA8       ----------------------------------------------------------------------
MGT_STAA3       ----------------------------------------------------------------------
MGT_STAA1       ----------------------------------------------------------------------
MTGA_CHRVO      ----------------------------------------------------------------------
MGT_STAES       ----------------------------------------------------------------------
MGT_STAEQ       ----------------------------------------------------------------------
MTGA_NEIGO      ----------------------------------------------------------------------
MTGA_NEIG1      ----------------------------------------------------------------------
MTGA_MARMS      ----------------------------------------------------------------------
MTGA_ECOLC      ----------------------------------------------------------------------
MTGA_NEIG2      ----------------------------------------------------------------------
MTGA_AZOSE      ----------------------------------------------------------------------
MGT_STAA9       ----------------------------------------------------------------------
MGT_STAA2       ----------------------------------------------------------------------
MGT_STAHJ       ----------------------------------------------------------------------
MTGA_AZOSB      ----------------------------------------------------------------------
MTGA_SHEDO      ----------------------------------------------------------------------
MGT_STAS1       ----------------------------------------------------------------------
MTGA_NITEU      ----------------------------------------------------------------------
MTGA_METFK      ----------------------------------------------------------------------
MTGA_PECCP      ----------------------------------------------------------------------
MTGA_PHOLL      ----------------------------------------------------------------------
MTGA_RHOCS      ----------------------------------------------------------------------
MTGA_HERAR      ----------------------------------------------------------------------
MTGA_JANMA      ----------------------------------------------------------------------
MTGA_ECO55      ----------------------------------------------------------------------
MTGA_SHISS      ----------------------------------------------------------------------
MTGA_BURXL      ----------------------------------------------------------------------
MTGA_NITEC      ----------------------------------------------------------------------
MTGA_BORA1      ----------------------------------------------------------------------
MTGA_SHIDS      ----------------------------------------------------------------------
MTGA_PSEAE      ----------------------------------------------------------------------
MTGA_ECOSE      ----------------------------------------------------------------------
MTGA_ECOLI      ----------------------------------------------------------------------
MTGA_ECOHS      ----------------------------------------------------------------------
MTGA_ECODH      ----------------------------------------------------------------------
MTGA_ECOBW      ----------------------------------------------------------------------
MTGA_ECO8A      ----------------------------------------------------------------------
MTGA_ECO24      ----------------------------------------------------------------------
MTGA_PASMU      ----------------------------------------------------------------------
MTGA_ECOUT      ----------------------------------------------------------------------
MTGA_ECOSM      ----------------------------------------------------------------------
MTGA_ECOLU      ----------------------------------------------------------------------
MTGA_ECOL6      ----------------------------------------------------------------------
MTGA_ECOL5      ----------------------------------------------------------------------
MTGA_ECOK1      ----------------------------------------------------------------------
MTGA_ECO81      ----------------------------------------------------------------------
MTGA_ECO7I      ----------------------------------------------------------------------
MTGA_ECO5E      ----------------------------------------------------------------------
MTGA_ECO57      ----------------------------------------------------------------------
MTGA_ECO45      ----------------------------------------------------------------------
MTGA_ECO27      ----------------------------------------------------------------------
MTGA_NITWN      ----------------------------------------------------------------------
MTGA_LARHH      ----------------------------------------------------------------------
MTGA_SHIBS      ----------------------------------------------------------------------
MTGA_NITHX      ----------------------------------------------------------------------
MTGA_AERHH      ----------------------------------------------------------------------
MTGA_YERP3      ----------------------------------------------------------------------
MTGA_SALAR      ----------------------------------------------------------------------
MTGA_RALSO      ----------------------------------------------------------------------
MTGA_PSEMY      ----------------------------------------------------------------------
MTGA_KLEOX      ----------------------------------------------------------------------
MTGA_BDEBA      ----------------------------------------------------------------------
MTGA_YERPS      ----------------------------------------------------------------------
MTGA_YERPP      ----------------------------------------------------------------------
MTGA_YERPN      ----------------------------------------------------------------------
MTGA_YERPG      ----------------------------------------------------------------------
MTGA_YERPE      ----------------------------------------------------------------------
MTGA_YERPB      ----------------------------------------------------------------------
MTGA_YERPA      ----------------------------------------------------------------------
MTGA_YERPY      ----------------------------------------------------------------------
MTGA_SALSV      ----------------------------------------------------------------------
MTGA_PSEU5      ----------------------------------------------------------------------
MTGA_BURTA      ----------------------------------------------------------------------
MTGA_BURPS      ----------------------------------------------------------------------
MTGA_BURPP      ----------------------------------------------------------------------
MTGA_BURP8      ----------------------------------------------------------------------
MTGA_BURMA      ----------------------------------------------------------------------
MTGA_YERE8      ----------------------------------------------------------------------
MTGA_NEIM0      ----------------------------------------------------------------------
MTGA_SHEAM      ----------------------------------------------------------------------
MTGA_SALA4      ----------------------------------------------------------------------
MTGA_PSE14      ----------------------------------------------------------------------
MTGA_XANCP      ----------------------------------------------------------------------
MTGA_XANCB      ----------------------------------------------------------------------
MTGA_XANC8      ----------------------------------------------------------------------
MTGA_HAEIE      ----------------------------------------------------------------------
MTGA_ERWCT      ----------------------------------------------------------------------
MTGA_CITK8      ----------------------------------------------------------------------
MTGA_SALTY      ----------------------------------------------------------------------
MTGA_SALTI      ----------------------------------------------------------------------
MTGA_SALPB      ----------------------------------------------------------------------
MTGA_SALNS      ----------------------------------------------------------------------
MTGA_PSEU2      ----------------------------------------------------------------------
MTGA_NEIME      ----------------------------------------------------------------------
MTGA_NEIMB      ----------------------------------------------------------------------
MTGA_NEIMA      ----------------------------------------------------------------------
MTGA_SHEFN      ----------------------------------------------------------------------
MTGA_SALPC      ----------------------------------------------------------------------
MTGA_SALHS      ----------------------------------------------------------------------
MTGA_SALG2      ----------------------------------------------------------------------
MTGA_SALEP      ----------------------------------------------------------------------
MTGA_SALCH      ----------------------------------------------------------------------
MTGA_RHOP2      ----------------------------------------------------------------------
MTGA_PSEP1      ----------------------------------------------------------------------
MTGA_PSEPK      ----------------------------------------------------------------------
MTGA_PSEE4      ----------------------------------------------------------------------
MTGA_NEIMF      ----------------------------------------------------------------------
MTGA_HAEIN      ----------------------------------------------------------------------
MTGA_BURVG      ----------------------------------------------------------------------
MTGA_BURS3      ----------------------------------------------------------------------
MTGA_BURCH      ----------------------------------------------------------------------
MTGA_BURCC      ----------------------------------------------------------------------
MTGA_BURCA      ----------------------------------------------------------------------
MTGA_PSEPG      ----------------------------------------------------------------------
MTGA_BURCM      ----------------------------------------------------------------------
MTGA_BURA4      ----------------------------------------------------------------------
MTGA_BRAJA      ----------------------------------------------------------------------
MTGA_SALPK      ----------------------------------------------------------------------
MTGA_SALPA      ----------------------------------------------------------------------
MTGA_PSEPW      ----------------------------------------------------------------------
MTGA_BURM1      ----------------------------------------------------------------------
MTGA_BORPE      ----------------------------------------------------------------------
MTGA_BORPA      ----------------------------------------------------------------------
MTGA_BORBR      ----------------------------------------------------------------------
MTGA_RHOPS      ----------------------------------------------------------------------
MTGA_ENTS8      ----------------------------------------------------------------------
MTGA_CAUCR      ----------------------------------------------------------------------
MTGA_CAUCN      ----------------------------------------------------------------------
MTGA_XANC5      ----------------------------------------------------------------------
MTGA_XANAC      ----------------------------------------------------------------------
MTGA_RHOPT      ----------------------------------------------------------------------
MTGA_RHOPA      ----------------------------------------------------------------------
MTGA_SALDC      ----------------------------------------------------------------------
MTGA_PSEFS      ----------------------------------------------------------------------
MTGA_PSESM      ----------------------------------------------------------------------
MTGA_RALME      ----------------------------------------------------------------------
MTGA_XANOR      ----------------------------------------------------------------------
MTGA_XANOM      ----------------------------------------------------------------------
MTGA_PSEF5      ----------------------------------------------------------------------
MTGA_PSEPF      ----------------------------------------------------------------------
MTGA_BACTN      ----------------------------------------------------------------------
MTGA_VIBPA      ----------------------------------------------------------------------
MTGA_SHEON      ----------------------------------------------------------------------
MTGA_MESSB      ----------------------------------------------------------------------
MTGA_CYTH3      ----------------------------------------------------------------------
PBPA_MYCS2      ----------------------------------------------------------------------
MTGA_MANSM      ----------------------------------------------------------------------
MTGA_BACFR      ----------------------------------------------------------------------
MTGA_BACFN      ----------------------------------------------------------------------
MTGA_RHIE6      ----------------------------------------------------------------------
MTGA_RHILW      ----------------------------------------------------------------------
MTGA_RHIEC      ----------------------------------------------------------------------
MTGA_RHORT      ----------------------------------------------------------------------
MTGA_CHRSD      ----------------------------------------------------------------------
MTGA_RALEJ      ----------------------------------------------------------------------
MTGA_RHIL3      ----------------------------------------------------------------------
MTGA_AGRT5      ----------------------------------------------------------------------
MTGA_RHILO      ----------------------------------------------------------------------
MTGA_RHIME      ----------------------------------------------------------------------
MTGA_XYLFA      ----------------------------------------------------------------------
MTGA_XYLFT      ----------------------------------------------------------------------
MTGA_XYLF2      ----------------------------------------------------------------------
MTGA_XYLFM      ----------------------------------------------------------------------
MTGA_BRUSU      ----------------------------------------------------------------------
MTGA_BRUME      ----------------------------------------------------------------------
MTGA_JANSC      ----------------------------------------------------------------------
SP5D_BACSU      ----------------------------------------------------------------------
FTSI_MESVI      GYST------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PBPF_BACSU      ---------------------------------------------------------
PBPB_VIBCH      ---------------------------------------------------------
PBPD_BACSU      ---------------------------------------------------------
PBPG_BACSU      ---------------------------------------------------------
PBPA_BACSU      ---------------------------------------------------------
PBPB_HAEIN      ---------------------------------------------------------
PBPB_ECOLI      ---------------------------------------------------------
PBPB_BUCAI      ---------------------------------------------------------
PBPB_BUCBP      ---------------------------------------------------------
PBPA_CLOTE      ---------------------------------------------------------
PBPA_CLOPS      ---------------------------------------------------------
PBPA_CLOPE      ---------------------------------------------------------
PBPA_CLOP1      ---------------------------------------------------------
PBPA_AQUAE      ---------------------------------------------------------
PBPA_CLOAB      ---------------------------------------------------------
PBPA_NEIFL      ---------------------------------------------------------
PBPA_CLOBH      ---------------------------------------------------------
PBPA_CLOB1      ---------------------------------------------------------
PBPC_ECOLI      ---------------------------------------------------------
PBPA_CLOBL      ---------------------------------------------------------
PBPA_CLONN      ---------------------------------------------------------
PBPA_NEILA      ---------------------------------------------------------
PBPA_PSEAE      ---------------------------------------------------------
PBPA_ECOLI      ---------------------------------------------------------
PBPA_HAEIN      ---------------------------------------------------------
PBPA_STRPN      ---------------------------------------------------------
PBPA_XYLFA      ---------------------------------------------------------
PBPA_NEICI      ---------------------------------------------------------
PBPA_STRR6      ---------------------------------------------------------
PBPA_XYLFT      ---------------------------------------------------------
PBPA_VIBCH      ---------------------------------------------------------
PBPA_NEIMB      ---------------------------------------------------------
PBPA_NEIMA      ---------------------------------------------------------
PBPA_STROR      ---------------------------------------------------------
PBPA_RICFE      ---------------------------------------------------------
PBPA_NEIGO      ---------------------------------------------------------
PBPA_NEIG1      ---------------------------------------------------------
PBPA_RICPR      ---------------------------------------------------------
PBPA_RICCN      ---------------------------------------------------------
PBPA_RICBR      ---------------------------------------------------------
PBPA_RICTY      ---------------------------------------------------------
TRG_RALEH       ---------------------------------------------------------
MTGA_NITMU      ---------------------------------------------------------
MTGA_ACIAD      ---------------------------------------------------------
MTGA_THIDA      ---------------------------------------------------------
MTGA_ALCBS      ---------------------------------------------------------
MTGA_ACIBT      ---------------------------------------------------------
MTGA_DECAR      ---------------------------------------------------------
MTGA_ACIBY      ---------------------------------------------------------
MTGA_ACIBS      ---------------------------------------------------------
MTGA_ACIBC      ---------------------------------------------------------
MTGA_ACIB5      ---------------------------------------------------------
MTGA_ACIB3      ---------------------------------------------------------
MGT_STAAW       ---------------------------------------------------------
MGT_STAAT       ---------------------------------------------------------
MGT_STAAS       ---------------------------------------------------------
MGT_STAAR       ---------------------------------------------------------
MGT_STAAN       ---------------------------------------------------------
MGT_STAAM       ---------------------------------------------------------
MGT_STAAE       ---------------------------------------------------------
MGT_STAAC       ---------------------------------------------------------
MGT_STAAB       ---------------------------------------------------------
MGT_STAA8       ---------------------------------------------------------
MGT_STAA3       ---------------------------------------------------------
MGT_STAA1       ---------------------------------------------------------
MTGA_CHRVO      ---------------------------------------------------------
MGT_STAES       ---------------------------------------------------------
MGT_STAEQ       ---------------------------------------------------------
MTGA_NEIGO      ---------------------------------------------------------
MTGA_NEIG1      ---------------------------------------------------------
MTGA_MARMS      ---------------------------------------------------------
MTGA_ECOLC      ---------------------------------------------------------
MTGA_NEIG2      ---------------------------------------------------------
MTGA_AZOSE      ---------------------------------------------------------
MGT_STAA9       ---------------------------------------------------------
MGT_STAA2       ---------------------------------------------------------
MGT_STAHJ       ---------------------------------------------------------
MTGA_AZOSB      ---------------------------------------------------------
MTGA_SHEDO      ---------------------------------------------------------
MGT_STAS1       ---------------------------------------------------------
MTGA_NITEU      ---------------------------------------------------------
MTGA_METFK      ---------------------------------------------------------
MTGA_PECCP      ---------------------------------------------------------
MTGA_PHOLL      ---------------------------------------------------------
MTGA_RHOCS      ---------------------------------------------------------
MTGA_HERAR      ---------------------------------------------------------
MTGA_JANMA      ---------------------------------------------------------
MTGA_ECO55      ---------------------------------------------------------
MTGA_SHISS      ---------------------------------------------------------
MTGA_BURXL      ---------------------------------------------------------
MTGA_NITEC      ---------------------------------------------------------
MTGA_BORA1      ---------------------------------------------------------
MTGA_SHIDS      ---------------------------------------------------------
MTGA_PSEAE      ---------------------------------------------------------
MTGA_ECOSE      ---------------------------------------------------------
MTGA_ECOLI      ---------------------------------------------------------
MTGA_ECOHS      ---------------------------------------------------------
MTGA_ECODH      ---------------------------------------------------------
MTGA_ECOBW      ---------------------------------------------------------
MTGA_ECO8A      ---------------------------------------------------------
MTGA_ECO24      ---------------------------------------------------------
MTGA_PASMU      ---------------------------------------------------------
MTGA_ECOUT      ---------------------------------------------------------
MTGA_ECOSM      ---------------------------------------------------------
MTGA_ECOLU      ---------------------------------------------------------
MTGA_ECOL6      ---------------------------------------------------------
MTGA_ECOL5      ---------------------------------------------------------
MTGA_ECOK1      ---------------------------------------------------------
MTGA_ECO81      ---------------------------------------------------------
MTGA_ECO7I      ---------------------------------------------------------
MTGA_ECO5E      ---------------------------------------------------------
MTGA_ECO57      ---------------------------------------------------------
MTGA_ECO45      ---------------------------------------------------------
MTGA_ECO27      ---------------------------------------------------------
MTGA_NITWN      ---------------------------------------------------------
MTGA_LARHH      ---------------------------------------------------------
MTGA_SHIBS      ---------------------------------------------------------
MTGA_NITHX      ---------------------------------------------------------
MTGA_AERHH      ---------------------------------------------------------
MTGA_YERP3      ---------------------------------------------------------
MTGA_SALAR      ---------------------------------------------------------
MTGA_RALSO      ---------------------------------------------------------
MTGA_PSEMY      ---------------------------------------------------------
MTGA_KLEOX      ---------------------------------------------------------
MTGA_BDEBA      ---------------------------------------------------------
MTGA_YERPS      ---------------------------------------------------------
MTGA_YERPP      ---------------------------------------------------------
MTGA_YERPN      ---------------------------------------------------------
MTGA_YERPG      ---------------------------------------------------------
MTGA_YERPE      ---------------------------------------------------------
MTGA_YERPB      ---------------------------------------------------------
MTGA_YERPA      ---------------------------------------------------------
MTGA_YERPY      ---------------------------------------------------------
MTGA_SALSV      ---------------------------------------------------------
MTGA_PSEU5      ---------------------------------------------------------
MTGA_BURTA      ---------------------------------------------------------
MTGA_BURPS      ---------------------------------------------------------
MTGA_BURPP      ---------------------------------------------------------
MTGA_BURP8      ---------------------------------------------------------
MTGA_BURMA      ---------------------------------------------------------
MTGA_YERE8      ---------------------------------------------------------
MTGA_NEIM0      ---------------------------------------------------------
MTGA_SHEAM      ---------------------------------------------------------
MTGA_SALA4      ---------------------------------------------------------
MTGA_PSE14      ---------------------------------------------------------
MTGA_XANCP      ---------------------------------------------------------
MTGA_XANCB      ---------------------------------------------------------
MTGA_XANC8      ---------------------------------------------------------
MTGA_HAEIE      ---------------------------------------------------------
MTGA_ERWCT      ---------------------------------------------------------
MTGA_CITK8      ---------------------------------------------------------
MTGA_SALTY      ---------------------------------------------------------
MTGA_SALTI      ---------------------------------------------------------
MTGA_SALPB      ---------------------------------------------------------
MTGA_SALNS      ---------------------------------------------------------
MTGA_PSEU2      ---------------------------------------------------------
MTGA_NEIME      ---------------------------------------------------------
MTGA_NEIMB      ---------------------------------------------------------
MTGA_NEIMA      ---------------------------------------------------------
MTGA_SHEFN      ---------------------------------------------------------
MTGA_SALPC      ---------------------------------------------------------
MTGA_SALHS      ---------------------------------------------------------
MTGA_SALG2      ---------------------------------------------------------
MTGA_SALEP      ---------------------------------------------------------
MTGA_SALCH      ---------------------------------------------------------
MTGA_RHOP2      ---------------------------------------------------------
MTGA_PSEP1      ---------------------------------------------------------
MTGA_PSEPK      ---------------------------------------------------------
MTGA_PSEE4      ---------------------------------------------------------
MTGA_NEIMF      ---------------------------------------------------------
MTGA_HAEIN      ---------------------------------------------------------
MTGA_BURVG      ---------------------------------------------------------
MTGA_BURS3      ---------------------------------------------------------
MTGA_BURCH      ---------------------------------------------------------
MTGA_BURCC      ---------------------------------------------------------
MTGA_BURCA      ---------------------------------------------------------
MTGA_PSEPG      ---------------------------------------------------------
MTGA_BURCM      ---------------------------------------------------------
MTGA_BURA4      ---------------------------------------------------------
MTGA_BRAJA      ---------------------------------------------------------
MTGA_SALPK      ---------------------------------------------------------
MTGA_SALPA      ---------------------------------------------------------
MTGA_PSEPW      ---------------------------------------------------------
MTGA_BURM1      ---------------------------------------------------------
MTGA_BORPE      ---------------------------------------------------------
MTGA_BORPA      ---------------------------------------------------------
MTGA_BORBR      ---------------------------------------------------------
MTGA_RHOPS      ---------------------------------------------------------
MTGA_ENTS8      ---------------------------------------------------------
MTGA_CAUCR      ---------------------------------------------------------
MTGA_CAUCN      ---------------------------------------------------------
MTGA_XANC5      ---------------------------------------------------------
MTGA_XANAC      ---------------------------------------------------------
MTGA_RHOPT      ---------------------------------------------------------
MTGA_RHOPA      ---------------------------------------------------------
MTGA_SALDC      ---------------------------------------------------------
MTGA_PSEFS      ---------------------------------------------------------
MTGA_PSESM      ---------------------------------------------------------
MTGA_RALME      ---------------------------------------------------------
MTGA_XANOR      ---------------------------------------------------------
MTGA_XANOM      ---------------------------------------------------------
MTGA_PSEF5      ---------------------------------------------------------
MTGA_PSEPF      ---------------------------------------------------------
MTGA_BACTN      ---------------------------------------------------------
MTGA_VIBPA      ---------------------------------------------------------
MTGA_SHEON      ---------------------------------------------------------
MTGA_MESSB      ---------------------------------------------------------
MTGA_CYTH3      ---------------------------------------------------------
PBPA_MYCS2      ---------------------------------------------------------
MTGA_MANSM      ---------------------------------------------------------
MTGA_BACFR      ---------------------------------------------------------
MTGA_BACFN      ---------------------------------------------------------
MTGA_RHIE6      ---------------------------------------------------------
MTGA_RHILW      ---------------------------------------------------------
MTGA_RHIEC      ---------------------------------------------------------
MTGA_RHORT      ---------------------------------------------------------
MTGA_CHRSD      ---------------------------------------------------------
MTGA_RALEJ      ---------------------------------------------------------
MTGA_RHIL3      ---------------------------------------------------------
MTGA_AGRT5      ---------------------------------------------------------
MTGA_RHILO      ---------------------------------------------------------
MTGA_RHIME      ---------------------------------------------------------
MTGA_XYLFA      ---------------------------------------------------------
MTGA_XYLFT      ---------------------------------------------------------
MTGA_XYLF2      ---------------------------------------------------------
MTGA_XYLFM      ---------------------------------------------------------
MTGA_BRUSU      ---------------------------------------------------------
MTGA_BRUME      ---------------------------------------------------------
MTGA_JANSC      ---------------------------------------------------------
SP5D_BACSU      ---------------------------------------------------------
FTSI_MESVI      ---------------------------------------------------------