[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for atum0:AAK86987.1

[Show Plain Result]


## Summary of Sequence Search
    1::863
   35::883     e-137  40%  883 aa  RPOL_BPT7 RecName: Full=DNA-directed RNA polymerase;       
   35::884     e-136  40%  884 aa  RPOL_BPT3 RecName: Full=DNA-directed RNA polymerase;       
   31::906     e-124  37%  906 aa  RPOL_BPK11 RecName: Full=DNA-directed RNA polymerase;       
    8::874     e-120  34%  874 aa  RPOL_BPSP6 RecName: Full=DNA-directed RNA polymerase;       
  170::992     6e-90  33%  993 aa  RPOT3_ARATH RecName: Full=DNA-directed RNA polymerase 3,
  238::975     7e-88  33%  976 aa  RPOT1_ARATH RecName: Full=DNA-directed RNA polymerase 1,
  330::1020    6e-87  35% 1021 aa  RPO2B_TOBAC RecName: Full=DNA-directed RNA polymerase 2B,
  329::1019    2e-86  34% 1020 aa  RPOT2_NICSY RecName: Full=DNA-directed RNA polymerase 2,
  350::1001    3e-85  35% 1002 aa  RPO1B_TOBAC RecName: Full=DNA-directed RNA polymerase 1B,
  295::976     1e-84  33%  977 aa  RPOT3_NICSY RecName: Full=DNA-directed RNA polymerase 3,
  295::976     1e-84  33%  977 aa  RPO3A_TOBAC RecName: Full=DNA-directed RNA polymerase 3A,
  245::976     2e-83  32%  977 aa  RPO3B_TOBAC RecName: Full=DNA-directed RNA polymerase 3B,
  350::1001    2e-78  34% 1002 aa  RPOT1_NICSY RecName: Full=DNA-directed RNA polymerase 1,
  178::1010    3e-77  31% 1011 aa  RPOT2_ARATH RecName: Full=DNA-directed RNA polymerase 2,
  510::1120    6e-77  35% 1120 aa  RPOM_SCHPO RecName: Full=DNA-directed RNA polymerase, mitochondrial; 
  592::1246    2e-76  35% 1351 aa  RPOM_YEAST RecName: Full=DNA-directed RNA polymerase, mitochondrial; 
  644::1230    2e-68  33% 1230 aa  RPOM_HUMAN RecName: Full=DNA-directed RNA polymerase, mitochondrial; 
  599::1207    5e-67  33% 1207 aa  RPOM_MOUSE RecName: Full=DNA-directed RNA polymerase, mitochondrial; 
  627::1218    7e-56  36% 1423 aa  RPOM_NEUCR RecName: Full=DNA-directed RNA polymerase, mitochondrial; 
  406::831     2e-46  33%  896 aa  RPOP_NEUCR RecName: Full=Probable DNA-directed RNA polymerase;     
    2::331     2e-44  35%  332 aa  RPO2A_TOBAC RecName: Full=DNA-directed RNA polymerase 2A;       
  263::876     3e-38  27%  936 aa  RPOP_CLAPU RecName: Full=Probable DNA-directed RNA polymerase;     
  348::748     3e-34  29%  811 aa  RPOP_NEUIN RecName: Full=Probable DNA-directed RNA polymerase;     
  368::822     6e-32  30%  831 aa  RPOP_GELSP RecName: Full=Probable DNA-directed RNA polymerase;     
  466::1004    4e-31  27% 1102 aa  RPOP_AGABT RecName: Full=Probable DNA-directed RNA polymerase;       
  450::870     6e-28  26%  948 aa  RPOP_PODAN RecName: Full=Probable DNA-directed RNA polymerase;     
    1::154     2e-27  42%  155 aa  RPO1A_TOBAC RecName: Full=DNA-directed RNA polymerase 1A;       
    1::863

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxEHEAWEKQIALEEEMRSAGIARFEKGLEKNREKNAEASNLSSRRMIIHAH
RPOL_BPT7       --------------------------EQLALEHESYEMGEARFRKMFERQLKAGEVADNAAAKPLITTLL
RPOL_BPT3       -------------------------KEQLALEHESYELGERRFLKMLERQAKAGEIADNXXXXXXXXXXX
RPOL_BPK11      ----------------------QAAREQLALEHEAYELGRQRFLKMLERQVKAGEFADNAAAKPLVLTLH
RPOL_BPSP6      ---------------------------QLQLEEEMFNGGIRRFEADQQRQIAAGSESDTAWNRRLLSELI
RPOT3_ARATH     --------------------ETEAWERMV---DEYRD---------LEKEMCEKNLAPNLPYVKHMFLGW
RPOT1_ARATH     ----------------------------------------------------------------------
RPO2B_TOBAC     ----------------------------------------------------------------------
RPOT2_NICSY     ----------------------------------------------------------------------
RPO1B_TOBAC     ----------------------------------------------------------------------
RPOT3_NICSY     ----------------------------------------------------------------------
RPO3A_TOBAC     ----------------------------------------------------------------------
RPO3B_TOBAC     ----------------------------------------------------------------------
RPOT1_NICSY     ----------------------------------------------------------------------
RPOT2_ARATH     ------------------------WRRQVKIETEEWERAAAEYMELLTDMCEQKL-APNLPYVKSLFLGW
RPOM_SCHPO      ----------------------------------------------------------------------
RPOM_YEAST      ----------------------------------------------------------------------
RPOM_HUMAN      ----------------------------------------------------------------------
RPOM_MOUSE      ----------------------------------------------------------------------
RPOM_NEUCR      ----------------------------------------------------------------------
RPOP_NEUCR      ----------------------------------------------------------------------
RPO2A_TOBAC     ----------------------------------------------------------------------
RPOP_CLAPU      ----------------------------------------------------------------------
RPOP_NEUIN      ----------------------------------------------------------------------
RPOP_GELSP      ----------------------------------------------------------------------
RPOP_AGABT      ----------------------------------------------------------------------
RPOP_PODAN      ----------------------------------------------------------------------
RPO1A_TOBAC     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           AQVIAGLEAFLAEASSGKAGKKHTAVAYLKDADLDVVAHLTLRNLFDYVSMRMKLTPLSIRLAAMVEDEL
RPOL_BPT7       PKMIARINDWFEEVKA-KRGKRPTAFQFLQEIKPEAVAYITIKTTLACLTSADNTTVQAVASAIAIEDEA
RPOL_BPT3       XXXXXRIVEWLEEYAS-KKGRKPSAYAPLQLLKPEASAFITLKVILASLTSTNMTTIQAAALGKAIEDEA
RPOL_BPK11      PQLTKRIDDWKEEQANARGKKKHGVASELRGVSSEAIALLTIKVVLGNAHRPLKNPAVSSQLGKALEDEA
RPOL_BPSP6      APMAEGIQAY-KEEYEGKKGRAPRALAFLQCVENEVAAYITMKVVMDMLNTDATLQAIAMSVAERIEDQV
RPOT3_ARATH     FQPLKDVIEREQKLQKNKSKKVRAAYAHIELLPADKMAVIVMHKMMGLVMSGIQVVQAAVSIGIAIEQEV
RPOT1_ARATH     ----------------------------------------------------VKLVNAATQIGEAVEQEV
RPO2B_TOBAC     ----------------------------------------------------------------------
RPOT2_NICSY     ----------------------------------------------------------------------
RPO1B_TOBAC     ----------------------------------------------------------------------
RPOT3_NICSY     ----------------------------------------------------------------------
RPO3A_TOBAC     ----------------------------------------------------------------------
RPO3B_TOBAC     ----------------------------------------------------VQVVQAAVQIGMAVENEV
RPOT1_NICSY     ----------------------------------------------------------------------
RPOT2_ARATH     FEPLR--DAIAKDQELYRLGKKATYAHYLDQLPADKISVITMHKLMGHLMTGVKVVHAACTVGDAIEQEI
RPOM_SCHPO      ----------------------------------------------------------------------
RPOM_YEAST      ----------------------------------------------------------------------
RPOM_HUMAN      ----------------------------------------------------------------------
RPOM_MOUSE      ----------------------------------------------------------------------
RPOM_NEUCR      ----------------------------------------------------------------------
RPOP_NEUCR      ----------------------------------------------------------------------
RPO2A_TOBAC     ----------------------------------------------------------------------
RPOP_CLAPU      ----------------------------------------------------------------------
RPOP_NEUIN      ----------------------------------------------------------------------
RPOP_GELSP      ----------------------------------------------------------------------
RPOP_AGABT      ----------------------------------------------------------------------
RPOP_PODAN      ----------------------------------------------------------------------
RPO1A_TOBAC     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           FFNAFKGHDKDAYEYARKKISEQTHNAVHQKRAMTKHAKHKGAEWQDWSQDVKAKVGLKLIEIAVEQTGL
RPOL_BPT7       RFGRIR--DLEAKHF-KKNVEEQLNKRVGHKKAMLSKGLLGGEAWSSWHKEDSIHVGVRCIEMLIESTGM
RPOL_BPT3       RFGRIR--DLEAKHF-KKHVEEQLHGQVYKKAFMQVVEADMGEAWSSWDKETTMHVGIRLIEMLIESTGL
RPOL_BPK11      RFGRIREQEA---AYFKKNVADQLDKRVGHKKAMISKGMLGGDNWASWKTDEQMHVGTKLLELLIEGTGL
RPOL_BPSP6      RFSKLEGHAAKYFEKVKKSLKRHAHNXXXXXXXXXXXXXXDFDRWEAWPKETQLQIGTTLLEISVFYNGE
RPOT3_ARATH     RIHNFKNNAGDSQEELKEKLRKRVNSLIRRKRIIDALKVVKSEGTKPWGRATQAKLGSRLLELLIEQSGR
RPOT1_ARATH     RINSFKTINTEAENVSEEIVAKETEKARKQKLRQVKALVRKHDSFKPWGQEAQVKVGARLIQLLMENAYI
RPO2B_TOBAC     -------HVTQEQEKLRKKV---TNLMKKQKLRAVGQIVRRQDDSKPWGQDAKAKVGSRLIELLLQTAYI
RPOT2_NICSY     -------HVTQEQEKLRKKV---TNLMKKQKLRAVGQIVRRQDDSKPWGQDARAKVGSRLIDLLLQTAYI
RPO1B_TOBAC     -----------------------------------------------WGQDNLVKVGCRLIQILMETAYI
RPOT3_NICSY     -------------------LRKRVKSLIKRNRVVEVRKLMKSEEPESWGRDTQAKLGCRLLELLTETAHV
RPO3A_TOBAC     -------------------LRKRVKSLIKRNRVVEVRKLMKSEEPESWGRDTQAKLGCRLLELLTETAHV
RPO3B_TOBAC     RIHNFLEKTKKLQKHSQEDMSKETKSLIKRNRVVEVRKLMKSEEPESWGRDTQAKLGCRLLELLTETAHV
RPOT1_NICSY     -----------------------------------------------WGQDNLVKVGCRLIQILMERPAF
RPOT2_ARATH     RICTFKGDDNEEQDKLRKKVNELIKK---QKLSAVRKILQSHDYTKPWIADVRAKVGSRLIELLVRTAYI
RPOM_SCHPO      ----------------------------------------------------------------------
RPOM_YEAST      -----------------------------------------------WPQSIRARIGSVLISMLIQVAGV
RPOM_HUMAN      ----------------------------------------------------------------------
RPOM_MOUSE      ----------------------------------------------------------------------
RPOM_NEUCR      ----------------------------------------------------------------------
RPOP_NEUCR      ----------------------------------------------------------------------
RPO2A_TOBAC     ----------------------------------------------------------------------
RPOP_CLAPU      -------------------------------------------------------LGAKLIEILIESDLL
RPOP_NEUIN      ----------------------------------------------------------------------
RPOP_GELSP      ----------------------------------------------------------------------
RPOP_AGABT      ----------------------------------------------------------------------
RPOP_PODAN      ----------------------------------------------------------------------
RPO1A_TOBAC     ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           FEIVRQSEGAHNTNIYVVATKETLDWLATENSRLAPLSPVYLPTLVPPRPWTSPFRGGYWSGRVRNLRLI
RPOL_BPT7       VSLHRQNAGVVGQDSETIEAPEYAEAIATRAGALAGISPMFQPCVVPPKPWTGITGGGYWANGRRPLALV
RPOL_BPT3       VELQRHNAGAGSDHEALQLAQEYVDVLAKRAGALAGISPMFQPCVVPPKPWVAITGGGYWANGRRPLALV
RPOL_BPK11      VEMTKNADGSDDTSMQMVQLAPAVELLSKRAGALAGISPMHQPCVVPPKPWVETVGGGYWSVGRRPLALV
RPOL_BPSP6      PVFMRAMRTYGGKTIYYLQTSESVQWISAFKEHVAQLSPAYAPCVIPPRPWRTPFNGGFHTEKVASIRLV
RPOT3_ARATH     FKTVTKYPGSKLVRRYGVIECDSLLLAGLDKSAKHMLIP-YVPMLVPPKRWKGYDKGGYLFLPSYIMRTH
RPOT1_ARATH     QPPAEQFDDAFKQNFRTVTLENTLVLKGLDKSARHMVIP-YLPMLIPPQNWTGYDQGAHFFLPSYVMRTH
RPO2B_TOBAC     QPPANQKETKSASRRYGIIQCDELVFKGLERTARHMVIP-YMPMLVPPVKWTGYDKGGHLHGARQQREAV
RPOT2_NICSY     QPPANQKETKSASRRYGIIQCDELVFKGLERTARHMVIP-YMPMLVPPVKWTGYDKGGHLHGARQQREAV
RPO1B_TOBAC     QPPNDQDDGPPDIRPAFVHTLKTVETMGSRRYGVIQCDPLYMPMLVPPQSWLGYDKGGYLFLPSYIMRTH
RPOT3_NICSY     FRIATRDPGKSIVKKYGVIECDPLVVAGVDRTVKQMMIP-YVPMLVPPKKWRGYDKGGYLF--LPSYLMR
RPO3A_TOBAC     FRIATRDPGKSIVKKYGVIECDPLVVAGVDRTVKQMMIP-YVPMLVPPKKWRGYDKGGYLF--LPSYLMR
RPO3B_TOBAC     FKIATRDPGKNIVKKYGVIECDPLVVAGVDRTVKQMMIP-YVPMLVPPKKWRGYDKGGYLFLPSYLMRTH
RPOT1_NICSY     VHTLKTVETMKGSRRYGVIQCDPLVRKGLDKTARHMVIP-YMPMLVPPQSWLGYDKGAYLFLPSYIMRTH
RPOT2_ARATH     QSPADQQDNVHTFKVAKGSMNSGRKYGVIECDPLVRKGLEKSGRYAXXXXXXXXXXXXKWSGYDKGAYLF
RPOM_SCHPO      ------------------------------------LHPQLLPMLVTPKPWTSWIDGGYYYSRQPLVRLK
RPOM_YEAST      DPVTKAKVHGHNSKLGVLKIHKTLIRQLNGERLIASVQPQLLPMLVEPKPWVNWRSGGYHYTQSTLLRTK
RPOM_HUMAN      ---------------------------------------VDVPMLCPPLPWTSPHSGAFLLSPTKLMRTV
RPOM_MOUSE      ------------THLLETAAEPTLTFETTE-----------VPMLCPPLPWTSLHSGAYLLSSTKLMRAT
RPOM_NEUCR      ----------------------------------------HLPMVTPPDPWVSFEKGAYLETKTPVLRL-
RPOP_NEUCR      ----------------------------------------------------------------------
RPO2A_TOBAC     ----------------------------------------------------------------------
RPOP_CLAPU      LTLVKFKDESHSV---LTLTEEVAKAIPTNKVVLAPLK---LPMIVAPKPYSKEEHGGYLLNDFDYLDSL
RPOP_NEUIN      ----------------------------------------------------------------------
RPOP_GELSP      ----------------------------------------------------------------------
RPOP_AGABT      ------------------------------NLTVSGINIVQLPMLTEPRKISSDLYFPYINSDTTNLHLF
RPOP_PODAN      ----------------------------------------------------------------------
RPO1A_TOBAC     ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           KTGNRQYLMDLESVDMPKVYHSINAMQNTAWSINHRVYEVMASLWDNQSTLACIPQADDMPLPEKPMWLA
RPOL_BPT7       RTHSKKALMRYEDVYMPEVYKAINIAQNTAWKINKKVLAVVITKWKH-CPVEDIPAIEREELPMKPEDI-
RPOL_BPT3       RTHSKKGLMRYEDVYMPEVYKAVNLAQNTAWKINKKVLAVVNEIWKN-CPVADIPSLERQELPPKP----
RPOL_BPK11      RTHSKKALRRYADVHMPEVYKAVNLAQNTPWKVNKKVLAVVNEIVNKHCPVGDVPAIEREELPPRP----
RPOL_BPSP6      K-GNREHVRKLTQKQMPKVYKAINALQNTQWQINKDVLAVIEEVYGVPSFKPLIDKENKPPVPVEFQHLR
RPOT3_ARATH     GSKKQQALKDISHKTAHRVFEALDTLGNTKWRVNRNILDVVERLWADGGNIAGLVNREDVPIPEKP----
RPOT1_ARATH     GAKQQRTVMKRTPKELEPVYEALDTLGNTKWKINKKVLSLVDRIWANGGRIGGLVDREDVPIPEEP----
RPO2B_TOBAC     KRASRNQLQP--------VFEALDTLGSTKWRINKRVLSVIDRIWAGGGRLADLVDRDDAPLPEEP----
RPOT2_NICSY     KRASRNQLQP--------VFEALDTLGNTKWRINKRVLSVVDRIWAGGGRLADLVDRDDAPLPEEP----
RPO1B_TOBAC     GAKQREAVKRVPKKQLEPVFQALDTLGNTKWRVNRKVLGIVDRIWASGGRLADLVDREDVPLPEAP----
RPOT3_NICSY     THGSRRQQDAVRSVQMQQVYEALDTLGSTKWRVNKRILSVVESIWAGGGNIAGLVDRKDVPIPE------
RPO3A_TOBAC     THGSRRQQDAVRSVQMQQVYEALDTLGSTKWRVNKRILSVVESIWAGGGNIAGLVDRKDVPIPE------
RPO3B_TOBAC     GSRRQQAVRGVPTKQMQQVYEALDTLGSTKWRVNKRILNVVESIWAGGGNIAGLVDRKDVPIPELS----
RPOT1_NICSY     GAKQREAVKRVPKKQLEPVFQALDTLGNTKWRLNRKVLGIVDRIWASGGRLADLVDRXXXXXXXXXXXXX
RPOT2_ARATH     LTSQREALKSAPKGQLQPVFEALDTLGSTKWRVNKRVLTVVDRIWSSGGCVADMVDRSDVPLPEKP----
RPOM_SCHPO      GALEQDYLMKAENGQLDELFKAVSSLGKVSWRINQRLFNVLIRIWNSGEKFLSIP-------PREVKCDM
RPOM_YEAST      DSPEQVAYLKAASDDIDRVYDGLNVLGRTPWTVNRKVFDVVSQVWNKGEGFLDIPGADEMVLPPAPP---
RPOM_HUMAN      E-GATQHQELLETCPPTALHGALDALTNCAWRVNGRVLDLVLQLFQAKGCPQLGVXXXXXXXXXXXXXHL
RPOM_MOUSE      E-GTTQHQRLLEQCPPAQLHGPLDALTNCAWRVNGHLLDLVLQIFRDKGCMPLGVXXXXXXXXXXXXYQL
RPOM_NEUCR      KNGEREQRLYTEAADMDQVFKGLDVLGKTGWKINSPVFKVMLDVWNSGKQVA-----NXXXXXXXXXXXX
RPOP_NEUCR      ----------------------------------------------------------------------
RPO2A_TOBAC     ----------------------------------------------------------------------
RPOP_CLAPU      LT-KKLNMNDISRIQEKNIYESINKMMATAFQINKKLLKYLLEDYVFSKLLKL--EGDDLYKNITQIEID
RPOP_NEUIN      ----------------------------------------------------------------------
RPOP_GELSP      ----------------------------------------------------------------------
RPOP_AGABT      EKGKYNLRDHTEASEM--LYSSINYLNSIKFKINKAMLNFILAEWDNKDSKL------------------
RPOP_PODAN      ----------------------------------------------------------------------
RPO1A_TOBAC     ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           PEMKREDMSPEQLEEFSRWKSERTTIYEANARAVSKRLAFSRMLGVATRFKDEEEFYFPHQMDFRGRVYA
RPOL_BPT7       ------DMNPEAL---TAWKRAAAAVYRKDKARKSRRISLEFMLEQANKFANHKAIWFPYNMDWRGRVYA
RPOL_BPT3       ------DDIDTNXXXXXXXXXXXXGIYRLDKARVSRRISLEFMLEQANKFASKKAIWFPYNMDWRGRVYA
RPOL_BPK11      -----DDIDTNEVAR-KAWRKEAAAVYRKDKARQSRRCRCEFMVAQANKFANHKAIWFPYNMDWRGRVYA
RPOL_BPSP6      GRELKEMLSPEQWQQFINWKGECARLYTAETKRGSKSAAVVRMVGQARKYSAFESIYFVYAMDSRSRVYV
RPOT3_ARATH     --------SSEDPEELQSWKWSARKANKINRERHSLRCDVELKLSVARKMKDEEGFYYPHNLDFRGRAYP
RPOT1_ARATH     ---EREDQ-----EKFKNWRWESKKAIKQNNERHSQRCDIELKLEVARKMKDEEGFYYPHNVDFRGRAYP
RPO2B_TOBAC     ------DTEDEALRTKWRWKVK--SVKKENRERHSQRCDIELKLAVARKMKDEEGFFYPHNVDFRGRAYP
RPOT2_NICSY     ------DTEDEALRTKWRWKVK--SVKKENRERHSQRCDIELKLAVARKMKDEESFFYPHNVDFRGRAYP
RPO1B_TOBAC     --------DTEDEAEIRXXXXXXXXXXXENCERHSQRCDIELKLAVARKMKDEDGFYYPHNLDFRGRAYP
RPOT3_NICSY     -------LHSDDIMEXXXXXXXXXXXXXINQELHSQRCDTELKLSVARKLKDEEGFYYPHNLDFRGRAYP
RPO3A_TOBAC     -------LHSDDIMEXXXXXXXXXXXXXINQELHSQRCDTELKLSVARKLKDEEGFYYPHNLDFRGRAYP
RPO3B_TOBAC     --------NSDDIMEXXXXXXXXXXXXXINQELHSQRCDTELKLSVARKLKDEEGFYYPHNLDFRGRAYP
RPOT1_NICSY     XAQIRXXXXXXXXXXXE------------NCERHSQRCDIELKLAVARKMKDEDGFYYPHNLDFRGRAYP
RPOT2_ARATH     ------DTEDEGI--LXXXXXXXXXXXXXNSERHSQRCDTELKLSVARKMKDEEAFYYPHNMDFRGRAYP
RPOM_SCHPO      PPYPKNSINPR---DKVIWHTRRKELAALKTGAHSQRCDFNYKLEIARAFLNEK-FYFPHSLDFRGRAYP
RPOM_YEAST      -----KNSDPSILRA---WKLQVKTIANKFSSDRSNRCDTNYKLEIARAFLGEK-LYFPHNLDFRGRAYP
RPOM_HUMAN      PHSAAPARKAELRRELAHCQKVAREMHSLRAEALYR-------LSLAQHLRDRV-FWLPHNMDFRGRTYP
RPOM_MOUSE      PPGSTPVHKSELRKELARCLKVAREMHSLRSEALYR-------LSLAQHLR-HRVFWLPHNMDFRGRTYP
RPOM_NEUCR      XXASTEDPTVKRA-----WLKEIKVIENERSGLHSQRCFMNFQLEIARAYRDQT-FYFPHNVDFRGRAYP
RPOP_NEUCR      ----------------------------------SKFLYHSSIISIAKLMKDVKEFYMTVFIDWRGRFYT
RPO2A_TOBAC     ----------------------------------------------------------------------
RPOP_CLAPU      NMDKRDNXXXXXXXXXXXXRDY--------------------IIDIATVFQNVPELYFPLKLDHRGRLYP
RPOP_NEUIN      -------------------------------------------------------FYLNVNIDWRGRIYT
RPOP_GELSP      -------------------------------------------------------FYLNVNIDWRGRIYT
RPOP_AGABT      --FKGYNMLKPILETDSK------EIKEEKVSSNSKYTLYSNIISLASLYKD-NEFYLPVYVDFRGRVYP
RPOP_PODAN      ---------------------------------LAKKELQENILGLAEIFRNIPEFFIPVNADFRGRVYC
RPO1A_TOBAC     ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           VPLFLNPQGDDASHGLLQFANSVPITNEEGADWLAIHGAGLWGVDKCSMNERVEWVMANQREILASAENP
RPOL_BPT7       VSMF-NPQGNDMTKGLLTLAKGKPI-GKEGYYWLKIHGANCAGVDKVPFPERIKFIEENHENIMACAKSP
RPOL_BPT3       VPMF-NPQGNDMTKGLLTLAKGKPI-GEEGFYWLKIHGANCAGVDKVPFPERIAFIEKHVDDILACAKDP
RPOL_BPK11      VSMF-NPQGNDMTKGSLTLAKGKPI-GLDGFYWLKIHGANCAGVDKVPFPERIKFIEENEGNILASAADP
RPOL_BPSP6      QSSTLSPQSNDLGKALLRFTEGRPVNGVEALKWFCINGANLWGWDKKTFDVRVSNVLDEEFQDMCRAADP
RPOT3_ARATH     MHPHLNHLSSDLCRGTLEFAEGRPL-GKSGLHWLKIHLANLYGVEKLSHDARLAFVENHLDDIMDSAENP
RPOT1_ARATH     IHPYLNHLGSDLCRGILEFCEGKPL-GKSGLRWLKIHIANLYGVDKLAYEDRIAFTESHLEDIFDSSDRP
RPO2B_TOBAC     MHPHLNHLGSDICRGVLVFAEGRPL-GESGLRWLKIHLANLFGVEKLSLEGRIAFTENHMDDIFDSADKP
RPOT2_NICSY     MHPHLNHLGSDICRGVLEFAEGRPL-GESGLRWLKIHLANLFGVEKLSLEGRIGFTENHMDDIFDSSDKP
RPO1B_TOBAC     MHPYLNHLGSDLCRGILEFAEGRPL-GTSGLRWLKIHLANVYGVDKLSYEGRVAFSENHLEDIFDSAERP
RPOT3_NICSY     MHPHLNHLSSDLCRGILEFAEGRPL-GKSGLRWLKIHLASLYGIEKLCYDARLAFVENHIDDILDSANNP
RPO3A_TOBAC     MHPHLNHLSSDLCRGILEFAEGRPL-GKSGLRWLKIHLASLYGIEKLCYDARLAFVENHIDDILDSANNP
RPO3B_TOBAC     MHPHLNHLSSDLCRGILEFAEGRPL-GKSGLRWLKIHLASLYGVEKLCYDARLAFVENHIHDILDSANNP
RPOT1_NICSY     MHPYLNHLGSDLCRGILEFAEGRPL-GKSGLRWLKIHLANVYGVDKLSYEGRVAFSENHVEDIFDSAERP
RPOT2_ARATH     MPPHLNHLGSDLCRGVLEFAEGRPM-GISGLRWLKIHLANLYGVDKLSLDGRLAFTENHLDDIFDSADRP
RPOM_SCHPO      LSSHLHHVSNDVCRGLLEFSTGKPL-GPKGLNWLKVHLANLFGISKKDFATRQAFVDDNMQEVFDSADRP
RPOM_YEAST      LSPHFNHLGNDMSRGLLIFWHGKKL-GPSGLKWLKIHLSNLFGFDKLPLKDRVAFTESHLQDIKDSAEKS
RPOM_HUMAN      CPPHFNHLGSDVARALLEFAQGRPL-GPHGLDWLKIHLVNLTGLKKRELRKRLAFAEEVMDDILDSADQP
RPOM_MOUSE      CPPHFNHLGSDLARALLEFAEGRPL-GPRGLDWLKIHLINLTGLKKGSLRMRLAFADEVMEEILDSADNP
RPOM_NEUCR      IPPYLNHMGADHVRGLMLFAKGKPL-GESGLRWLKVHLANVYGFDKASLQERQDFADENIENIRDSVNNP
RPOP_NEUCR      SSCALNIQGGELARSLLLFKEGQKL-NDIGLKALKIYTANAFGLDKRSKEERLDWVEQNLHKII-----D
RPO2A_TOBAC     ----------------------------------------------------------------------
RPOP_CLAPU      ITAYFHYQSSELAKALLLFADTIERSDSISIDYLKAYGATCFGLDKKSYDKRLQWVDANWENII----NY
RPOP_NEUIN      QSFYLDYQGSELSLALINLFEGKKL-DEKGLFFFYVYGANIYNFSKKSFQDRFNWVVENLDNIIAM----
RPOP_GELSP      QSFYLGYQGSELSLALINLFEGQKL-DEEGLFFFYVYGANIYNFSKKSFQDRFNWVVENLDNIIAM----
RPOP_AGABT      LSNYISYQGGDLARSLILFADTKCVLNNSGKECLNVYLANLAGYDKLPWSERLTKVDGIIKEYLES--NE
RPOP_PODAN      TPEYLNYQSTDLAKSLLLFSKPGRMYKKDALSYLKIYGGSSFGLDKLSANDRIKWVDKN----LNNIKNY
RPO1A_TOBAC     ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           YDNRFWLTAEKPWQALAFCFEWQGYVAEGFAFHSHLPVQMDGTCNGLQNFSAMLLDEIGGAAVNLVPSDK
RPOL_BPT7       LENTWWAEQDSPFCFLAFCFEYAGVQHHGLSYNCSLPLAFDGSCSGIQHFSAMLRDEVGGRAVNLLPSET
RPOL_BPT3       INNTWWAEQDSPFCFLAFCFEYAGVTHHGLSYNCSLPLAFDGSCSGIQHFSAMLRDEVGGRAVNLLPSET
RPOL_BPK11      LNNTWWTQQDSPFCFLAFCFEYAGVKHHGLNYNCSLPLAFDGSCSGIQHFSAMLRDSIGGRAVNLLPSDT
RPOL_BPSP6      LTFTQWAKADAPYEFLAWCFEYAQYVDEGRAFRTHLPVHQDGSCSGIQHYSAMLRDEVGAKAVNLKPSDA
RPOT3_ARATH     HGKRWWLKAEDPFQCLAACVILTQALPSPYSVISHLPIHQDGSCNGLQHYAALGRDSFEAAAVNLVAGEK
RPOT1_ARATH     LEKRWWLNAEDPFQCLAACINLSEALRSPFAAISHIPIHQDGSCNGLQHYAALGRDKLGADAVNLVTGEK
RPO2B_TOBAC     LEGRWWLNAEDPFQCLAVCINLSEAVRSSSTSISHIPVHQDGSCNGLQHYAALGRDELGAAAVNLVAGEK
RPOT2_NICSY     LERRWWLNAEDPFQCLAVCINLSEAVRSSSTSVSHIPVHQDGSCNGLQHYAALGRDKLGAAAVNLVAGEK
RPO1B_TOBAC     LEGRWWLGAEDPFQCLATCIN----IAEALRSPSYMPIHQDGSCNGLQHYAALGRDKLGAAAVNLVAGDK
RPOT3_NICSY     LNNRWWLNAEDPFQCLAACINLSEALKSSHTVFSHLPIHQDGSCNGLQHYAALGRDSMEAAAVNLVAGDK
RPO3A_TOBAC     LNNRWWLNAEDPFQCLAACINLSEALKSSHTVFSHLPIHQDGSCNGLQHYAALGRDSMEAAAVNLVAGDK
RPO3B_TOBAC     LNNRWWLNAEDPFQCLAACINLSEALKSSHTVISHLPIHQDGSCNGLQHYAALGRDSMEAAAVNLVAGEK
RPOT1_NICSY     LEGRWWLGAEDPFQCLATCIN----IAEALRSPSYMPIHQDGSCNGLQHYAALGRDTLGAAAVNLVAGDK
RPOT2_ARATH     LESRWWLQAEDPFQCLAVCISLTEALRSPSTVLSHIPIHQDGSCNGLQHYAALGRDTLGAEAVNLVAGEK
RPOM_SCHPO      LDNKWWSKADDPFQALAACFEIAEAVRSGDSYISHIPIQQDGTCNGLQHYAALGGDIEGAKQVNLWPSDH
RPOM_YEAST      LTDRWWTTADKPWQALATCFELNEVMKNPEEFISHQPVHQDGTCNGLQHYAALGGDVEGATQVNLVPSDK
RPOM_HUMAN      LTGRWWMGAEEPWQTLACCMEVANAVSDPAAYVSHLPVHQDGSCNGLQHYAALGRDSVGAASVNLEPSDV
RPOM_MOUSE      LTGRWWMEADEPWQTLACCMEVAHAVRDPAAYISHLPVHQDGSCNGLQHYAALGRDSVGAASVNLTPSDL
RPOM_NEUCR      LNNQWWLQAEDPWQCLATCFELAAALEDPTKYVSHLPIHQDGTCNGLQHYAALGGDTWGAQQVNLVPGDR
RPOP_NEUCR      IDNEIWREADEPLLFLACALELKGY-NEDPNFISHLPILMDATCNGLQHLSAMVNDFVLAEKVNLLKSDN
RPO2A_TOBAC     -----------PFQCLAVCINLSEAVRSSSTSVSHIPVHQDGSCNGLQHYAALGRDKLGAAAVNLVAGEK
RPOP_CLAPU      RNNVLLELAENKFMFLAYCLEIEQFLNDDSIFKTYLPLQLDGTCNGFQHIVLLSNEVKLYSQLNLDGKSK
RPOP_NEUIN      -DKEFILKAESPTLFAAFCLTMRK-LKENPDYPVFNPIFLDATCSGVQHFAAMLLDLELGKYVNLINSES
RPOP_GELSP      -DKDFILKAESPTLFAAFCLTMRK-LKENPDHPVFNPIFLDATCSGVQHFAAMLLDLELGKYVNLINSES
RPOP_AGABT      ISNTKYIKISEPFQFISIMYAKLLSISNPKANISN-PILFDASCSGIQHIAALTLEKELASNVNLYKEDY
RPOP_PODAN      RNGKLIKEAKNKFLFLAFCIEYNRYLHDVSWFDTYLPIQMDATCNGFQHXXXXXXXXXXXXXXXXXXDDV
RPO1A_TOBAC     ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           PNDIYATVASVLIAKLRDIAAACPXXXXXXXXXXXXXXXXXXIVVESDGSMARKWLAYGITRKVTKRPVM
RPOL_BPT7       VQDIYGIVAK----KVNEILQADAINGTDNEVVTVTDENTGEIVKLGTKALAGQWLAYGVTRSVTKRSVM
RPOL_BPT3       VQDIYGIVAQKVNEILKQDAINGTPNEMITVTDKDTGEISEKLKL-GTSTLAQQWLAYGVTRSVTKRSVM
RPOL_BPK11      VQDIYKIVADKVNEVLHQHAVNGSQTVVEQIADKETGEFHEKVTL-GESVLAAQWLQYGVTRKVTKRSVM
RPOL_BPSP6      PQDIYGAVAQVVIKKNALYMDADDATTFTSGSVTLSGTELR--------AMASAWDSIGITRSLTKKPVM
RPOT3_ARATH     PADVYSEISRRVHEIMKKDSSKDP---------------------ESNPTAAAKILITQVDRKLVKQTVM
RPOT1_ARATH     PADVYTEIAARVLKIMQQDAEEDPETF--------------------PNATYAKLMLDQVDRKLVKQTVM
RPO2B_TOBAC     PADVYSGIAARVLDIMKRDAQRDP--------------------AEFPDAVRARALVNQVDRKLVKQTVM
RPOT2_NICSY     PADVYSGIAARVLDIMKRDAQRDP--------------------AEFPDAVRARVLVNQVDRKLVKQTVM
RPO1B_TOBAC     PADVYSGIAARVLDIMKRDAAKDP--------------------ANDPNVMRARLLINQVDRKLVKQTVM
RPOT3_NICSY     PADVYTEIALRVDHIIRGDSIKDP--------------------ATDPNALLAKLLIDQVDRKLVKQTVM
RPO3A_TOBAC     PADVYTEIALRVDHIIRGDSIKDP--------------------ATDPNALLAKLLIDQVDRKLVKQTVM
RPO3B_TOBAC     PADVYTEIALRVDHIIRGDSIKDPAI--------------------DPNALLAKLLIDQVDRKLVKQTVM
RPOT1_NICSY     PADVYSGIAARVLDIMKRDAAKDP--------------------ANDPNVMRARLLINQVDRKLVKQTVM
RPOT2_ARATH     PADVYSGIATRVLDIMRRDADRDPE-------------------VFPEALRARK-LLNQVDRKLVKQTVM
RPOM_SCHPO      PSDVYEAVAEIVRGFLKKDAEA--------------------------GDEMANFLKDKVTRSVVKPTVM
RPOM_YEAST      PQDVYAHVAR-LVQKRLEIAA-------------------------EKGDENAKILKDKITRKVVKQTVM
RPOM_HUMAN      PQDVYSGVAAQVEVFRRQDA--------------------------QRGMRVAQVLEGFITRKVVKQTVM
RPOM_MOUSE      PQDVYREVAT-QVEEFRQQDA-------------------------KEGLRVAQVLEGFISRKVVKQTVM
RPOM_NEUCR      PADVYSAVAKLVIKGIEDDLA-------------------------KDNEFA-KAMHGKITRKVVKQTVM
RPOP_NEUCR      PRDLYSEVIPHIKQE----------------------------ILEASKSYEHTNLRINVERCLVKRGLM
RPO2A_TOBAC     PADVYSGIAARVLDIMKRDAQRDP--------------------AEFPDAVRARVLVNQVDRKLVKQTVM
RPOP_CLAPU      PSDFYSFMINQLLLNKKDVSTD-----------------------KEDIESYDRLINLGLSRANIKQAIM
RPOP_NEUIN      VNDFYSQLIPAINKAINESA--------------------------EKKFKNLKFSDISLNRSLLKKVIM
RPOP_GELSP      VNDFYSQLIPAINKAINESA--------------------------EKKLKNVKFSDISLNRSLLKKVIM
RPOP_AGABT      PQDFY----TYALEKIRD------------------------KLINSDITELRD---IKLNRKIIKRSVM
RPOP_PODAN      PKDFYTFLVVCFIDYLK------------------TELLENKNLTPKESESYNRLINMKIIREIIKKGIM
RPO1A_TOBAC     ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           TLAYGASEFGFREQVFTDTVTPWKQAAGEAFPFEGTGFAAASFLGLLIWDCXXXXXXXXXXXMDWLQKVA
RPOL_BPT7       TLAYGSKEFGFRQQVLEDTIQP-AIDSGKGLMFTQPN-QAAGYMAKLIWXXXXXXXXXXXXXMNWLKSAA
RPOL_BPT3       TLAYGSKEFGFRQQVLDDTIQP-AIDSGKGLMFTQPN-QAAGYMAKLIWDXXXXXXXXXXXXMNWLKSAA
RPOL_BPK11      TLAYGSKESLVRQQVLEDTIQP-AIDNGEGLMFTHPN-QAAGYMAKLIWDXXXXXXXXXXEAMNWLKSAA
RPOL_BPSP6      TLPYGSTRLTCRESVIDYIVDLEEKEAQKAHPFEDTPGAAYNYMTALIWPSISEVVKAPIVAMKMIRQLA
RPOT3_ARATH     TSVYGVTYVGAREQI--------KRRLEEVITDERMLFAAACYSAKVTLAALGEIFEAARAIMSWLGDCA
RPOT1_ARATH     TSVYGVTYSGARDQI--------KKRLKERGTFEDDSFHASCYAAKITLKALEEMFEAARAIKSWFGDCA
RPO2B_TOBAC     TSVYGVTYIGARDQI--------KRRLKEAIADDSELFGAACYAAKVTLTALGEMFEAARSIMTWLGECA
RPOT2_NICSY     TSVYGVTYIGARDQI--------KRRLKEAIADDSELFGAACYAAKVTLTALGEMFEAARSIMTWLGECA
RPO1B_TOBAC     TSVYGVTYIGARDQI--------KKRLKERGVIEDDNFAAACYAAKTTLTALGEMFEAARSIMSWLGDCA
RPOT3_NICSY     TSVYGVTYVGAREQI--------KRRLEEKGLIDDDRFTASCYAAKVTLAALGELFQAARGTMTWLGDCA
RPO3A_TOBAC     TSVYGVTYVGAREQI--------KRRLEEKGLIDDDRFTASCYAAKVTLAALGELFQAARGTMTWLGDCA
RPO3B_TOBAC     TSVYGVTYVGAREQI--------KRRLEEKGLIDDDRFTASCYAAKVTLAALGELFQAARGTMTWLGDCA
RPOT1_NICSY     TSVYGVTYIGARDQI--------KRRLKERGVIEDDNFAAACYAAKTTLTALGEMFEAARSIMSWLGDCA
RPOT2_ARATH     TSVYGVTYIGARDQI--------KRRLKERSDFEKEVFGAACYAAKVTLAAIDEMFQAARAIMRWFGECA
RPOM_SCHPO      TNVYGVTYVGARKQISEDGMEKLKVAD------------YANYLTKKVFEALRSLFTQAHEIQDWLSACC
RPOM_YEAST      TNVYGVTYVGATFQI-AKQLSPIFDDRKESLDF-------SKYLTKHVFSAIRELFHSAHLIQDWLGESA
RPOM_HUMAN      TVVYGVTRYGGRLQI------EKRLRELSDFPQEFV-WEASHYLVRQVFKSLQEMFSGTRAIQHWLTESA
RPOM_MOUSE      TVVYGVTRYGGRLQI------EKRLRELSDFPQEFV-WEASHYLVRQVFKSLQEMFTSTRAIQHWLTESA
RPOM_NEUCR      TNVYGVTYVGARKQVLKQIEAAYPNITAES----------------------------------------
RPOP_NEUCR      TITYGATERGIYDQIVSKQKDEWNKTVGLHFVCIDSDIAPKDLLSKIIYNSLFKIHPNLNTLMVYFNSIV
RPO2A_TOBAC     TSVYGVTYIGARDQI--------KRRLKEAIADDSELFGAACYAAKVTLTALGEMFEAARSIMTWLGECA
RPOP_CLAPU      TKPYNAKDFTVAKYIIETLLIASEDKYIDEKGITRTEFRDIYLLAKCINEILFLNYPQIKSLLEYLNSIS
RPOP_NEUIN      TKSYNVTTYGITEQLKSKLEKVEKIVISKGVPTKNGDFVVVETLASIINDNIFNQFPKLHSIYDYLTRLA
RPOP_GELSP      TKSYNVTTYGITEQLKSDYLVPTKNG-----KFVVLDTFEVETLASIINDNIFNQFPKLHSIYEYLTRLT
RPOP_AGABT      TIPYNISMAGIGEHLMVKTVLKYRYVVGSATISSKDVYLDYSKYGQLIYFVLTKELPSLRLLSNYFESMI
RPOP_PODAN      TIPYNVSNFSLINYILEDNSLEWYIYKNESIRLKSLDF---TVLGKGLRKVLHEKFHKLDLLLKYLDQVA
RPO1A_TOBAC     ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           KIAAKESLPVIWNTPAGLKVMQEYTTSEQKRLELTFQKVRLQLSIDVASKKIDKRKQGSGISPNWVHSMD
RPOL_BPT7       KLLAAERCAVHWVTPDGFPVWQEYKKPIQTRLNLMFGQFRLQPTINTKDSEIDAHKQESGIAPNFVHSQD
RPOL_BPT3       KLLAAERCAVHWTTPDGFPVWQEYRKPLQKRLDMIFGQFRLQPTINLKDSGIDAHKQESGIAPNFVHSQD
RPOL_BPK11      KLLAAERCAIHWVTPDGFPVWQEYRKQNQARLKLVFGQANVKMTYNTGDSEIDAHKQESGIAPNFVHSQD
RPOL_BPSP6      RFAAKRNEGLMYTLPTGFILEQKIMATEMLRVR-TCLMGDIKMSLQVETDIVDEAAMMGAAAPNFVHGHD
RPOT3_ARATH     KIIASDNHPVRWITPLGLPVVQPYCRSERHLIRTSLQVLALQRE----GNTVDVRKQRTAFPPNFVHSLD
RPOT1_ARATH     KIIASENNAVCWTTPLGLPVVQPYRKPGRHLVKTTLQVLTLSRETD----KVMARRQMTAFAPNFIHSLD
RPO2B_TOBAC     KIIASENEPVRWTTPLGLPVVQPYRKIGRHLIKTSLQILTLQQE----TEKVMVKRQRTAFPPNFIHSLD
RPOT2_NICSY     KIIASENEPVRWTTPLGLPVVQPYRKIGRHLIKTSLQILTLQRE----TEKVMVKRQRTAFPPNFIHSLD
RPO1B_TOBAC     KIIAMENHPVRWTTPLGLPVVQPYRKLGRHLIKTSLQILTLQRETD----KVMVKRQRTAFPPNFVHSLD
RPOT3_NICSY     KVIASENQPVRWTTPLGLPVVQPYFKTQRHVIRTSLQVLALQREGDT----VEVRKQRTAFPPNFVHSLD
RPO3A_TOBAC     KVIASENQPVRWTTPLGLPVVQPYFKTQRHVIRTSLQVLALQREGDT----VEVRKQRTAFPPNFVHSLD
RPO3B_TOBAC     KVIALENQPVRWTTPLGLPVVQPYFKTQRHVIRTSLQILALQREGDA----VEVRKQRTAFPPNFVHSLD
RPOT1_NICSY     KIIAMENHPVRWTTPLGLPVVQPYRKLGRHLIKTSLQILTLQRETD----KVMVKRQRTAFPPNFVHSLD
RPOT2_ARATH     KIIASENETVRWTTPLGLPVVQPYHQMGTKLVKTSLQTLSLQHETD----QVIVRRQRTAFPPNFIHSLD
RPOM_SCHPO      NLITHELTPVVWTTLLNLPIVQPYRNYKSRQIRTNLQTVFIEERDRTAT--VQPHKQATAFPPNFIHSLD
RPOM_YEAST      KRISKSMSSVIWTTPLGLPIVQPYREESKKQVETNLQTV--FISDPFAVNPVNARRQKAGLPPNFIHSLD
RPOM_HUMAN      RLISHMGSVVEWVTPLGVPVIQPYLDSKVKQIGGGIQSITYTHNGDI-SRKPNTRKQKNGFPPNFIHSLD
RPOM_MOUSE      NLISHAGWPVEWVTPLGIPIIQPYHRESKVQVKGGLQSITLTSSVD-ESQKPNTLKQKNGFPPNFIHSLD
RPOM_NEUCR      ---------IIWTTPLRMPVVQPYRKHGTKTVSTCMQD--LVMTIPERSDPVNRRKQLQAFPPNFIHSLD
RPOP_NEUCR      KVLCELDLPVNWVTPYGLVIQQKYNKFTKYNETTYVASKRYKLVLRKATTSISKQKQIQAFIPNFVHSMD
RPO2A_TOBAC     KIIASENEPVRWTTPLGLPVVQPYRKIGRHLIKTSLQILTLQRE----TEKVMVKRQRTAFPPNFIHSLD
RPOP_CLAPU      EIMLKLNLPITWSLPTGLEVHQQYMRSKLKKTK-PYTYLDTSLTLKITDKKMDKVKQQIALMPNLIHSLD
RPOP_NEUIN      KIYLKLDIPLSWSTPDGLELTQRYNLSKVKKLTINFLGKNRTAVLRSWVNEKDSRREVQAIIPNIIHSLD
RPOP_GELSP      KIYLKLDIPISCSTPDGLELTQRYNLSKVQKLTINFGKNRTAVLRSWVSDK-DSRREVPAIIPNIIHSLD
RPOP_AGABT      DIFVKLNIPITWVTPSGLKIKYTNIKFKPQKVKTSVLNTSKITTIKLPTDSLDVLSTKRSFMPNFIHSLD
RPOP_PODAN      RVCTLLEIPIIWTLPTGLVVRQSYMIRDEVRIK-PFNHSNKKFSMKVLNKQFNNSKQITAFMPNLVHXXX
RPO1A_TOBAC     -IIAMENHPVRWTTPLGLPVVQPYRKLGRHLIKTSLQILTLQRETD----KVMVKRQRTAFPPNFVHSLD


                         .         .         *         .         .         .         .:840
query           AAHMQLTVSRCHDEGIRSFSLIHDSYGTHAGNAWAMAQFLREEFVKMYGDHDVLAEFGREITAMLPEGTQ
RPOL_BPT7       GSHLRKTVVWAHEKGIESFALIHDSFGTIPADAANLFKAVRETMVDTYESCDVLADFYDQFADQLHESDK
RPOL_BPT3       GSHLRMTVVYAHEKGIESFALIHDSFGTIPADAGKLFKAVRETMVITYENNDVLADFYSQFADQLHE-TQ
RPOL_BPK11      GSHLRMTVVHANEYGIDSFALIHDSSGTIPADAGNLFKAVRETMVKTYEDNDVIADFYDQFADQLHESDK
RPOL_BPSP6      ASHLILTVCELVDKGVTSIAVIHDSFGTHADNTLTLRVALKGQMVAMYIDGNALQKLEHEVRWMVDTGIE
RPOT3_ARATH     GTHMMMTAVACREAGL-NFAGVHDSYWTHACDVDTMNRILREKFVELYNTEDLLQSFQESYPNLV-----
RPOT1_ARATH     GSHMMMTAVACNRAGL-SFAGVHDSFWTHACDVDVMNTILREKFVELY-EKPILENLLESFQKSFPD-IS
RPO2B_TOBAC     GSHMMMTAVACRRAGL-NFAGVHDSYWTHACDVDKLNRILREKFVELY-ETPILEKLLESFQTSYPT-LL
RPOT2_NICSY     GSHMMMTAVACRRAGL-NFAGVHDSYWTHACDVDKLNRILREKFVELY-EAPILEKLLESFQTSYPT-LL
RPO1B_TOBAC     GSHMMMTAIACKESGL-SFAGVHDSYWTHACDVDQMNKILREKFVELY-DAPILENLLESFQQSFPD-LQ
RPOT3_NICSY     GSHMMMTAVACRDAGLQ-FAGVHDSFWTHACDVDQMNRILREKFVELYSMEDLLESFQNSYPAL-----T
RPO3A_TOBAC     GSHMMMTAVACRDAGLQ-FAGVHDSFWTHACDVDQMNRILREKFVELYSMEDLLESFQNSYPAL-----T
RPO3B_TOBAC     GSHMMMTAVACRDAGLQ-FAGVHDSFWTHACDVDQMNRILREKFVELYSLEDLLENFQKSYPAL-----T
RPOT1_NICSY     GSHMMMTAIACKESGL-SFAGVHDSYWTHASDVDQMNKILREKFVELY-DAPILENLLESFQQSFPD-LQ
RPOT2_ARATH     GSHMMMTAVACKRAGV-CFAGVHDSFWTHACDVDKLNIILREKFVELY-SQPILENLLESFEQSFPH-LD
RPOM_SCHPO      ATHMFMTCLKCSEQNI-NFAAVHDSYWTHACDVDQMNSLLREAFVLLHSDEDLKAKFGNKSYIPL----E
RPOM_YEAST      ASHMLLSAAECGKQGL-DFASVHDSYWTHASDIDTMNVVLREQFIKLH-EVDLVLRLKEEFDQRYKNYVK
RPOM_HUMAN      SSHMMLTALHCYRKGL-TFVSVHDCYWTHAADVSVMNQVCREQFVRLHSE-PILQDLSRFLVKRFCSEPQ
RPOM_MOUSE      SSHMMLTALHCYRKGL-IFVSVHDCFWTHAADIPTMNEVCREQFVRLHSQPEDLAKFERALVTKLQE--T
RPOM_NEUCR      ASHMILSALHCDELGL-TFAAVHDSFWTHASDIDSMNAVLRDAFIRIHSE-DVIGRLAAEFQA-------
RPOP_NEUCR      GSNIVLLINTIRDEGRKNFASIHDCFATHANDTAWLSWYVKQSFIRIYSDSSFLRRF-------------
RPO2A_TOBAC     GSHMMMTAVACRRAGL-NFAGVHDSYWTHACDVDKLNRILREKFVELY-EAPILEKLLESFQTSYPT-LL
RPOP_CLAPU      AASLYFAFNKSIGSGVVNFYSVHDCYGVTAKYIDLLISQLRAVYIELYSKDGYIAHFDVDI---------
RPOP_NEUIN      ASHLTMII----DSWDSYILPIHECFGTHPNDMYKLAEQVRECFILLYSKNDFL----------------
RPOP_GELSP      AAHLPMLI----DSWDSYILPIHDCFGTHPNDMFKLAEQVRECFILLYSKNDFLSKIDSKFRENLKDGTP
RPOP_AGABT      ASNVHLLLNSVSYKNLPVYT-VHDCFASTANNMFKLEKLVKNAFINIY----------------------
RPOP_PODAN      XXXXXXXXXFYFKESIKNIYTIHDCFAVPANKMECLISLLK-----------------------------
RPO1A_TOBAC     GSHMMMTAIACKESGL-SFAGVHDSYWTHASDVDQMNKILREKFVELY-DAPILENLLESFQQSFPD-LQ


                         +         .         .         .         .         *         .:910
query           LPPLPEKGSLDLSQVLESAFFFA
RPOL_BPT7       MPALPAKGNLNLRDILESDFAFA
RPOL_BPT3       LPPLPKKGNLNLQDILKSDFAFA
RPOL_BPK11      MPAVPAKGDLNLRDILESDFAFA
RPOL_BPSP6      ---VPEQGEFDLNEIMDSEYVFA
RPOT3_ARATH     FPPVPKRGDFDLKEVLKSQYFF-
RPOT1_ARATH     FPPLPERGDFDLRKVLESTYFF-
RPO2B_TOBAC     FPPLPERGDFDLRDVLESPYFF-
RPOT2_NICSY     FPPLPERGDFDMRDVLESPYFF-
RPO1B_TOBAC     FPPLPERGDFDLREVLESPYFF-
RPOT3_NICSY     FPPLPKRGDFDLVEVLESPYFF-
RPO3A_TOBAC     FPPLPKRGDFDLVEVLESPYFF-
RPO3B_TOBAC     FPPLPKRGDFNLREVLESPYFF-
RPOT1_NICSY     FPPLPERGDFDLREVLESPYFF-
RPOT2_ARATH     FPPLPERGDLDLKVVLDSPYFF-
RPOM_SCHPO      FPPLPARGALDLKKVLESKYFFS
RPOM_YEAST      IGKL--KRSTDLAQ---------
RPOM_HUMAN      LQAVPKPGAFDLEQVKRSTYFFS
RPOM_MOUSE      LQSLPKTGTFDLGQVIRSTYFFS
RPOM_NEUCR      -----------------------
RPOP_NEUCR      -----------------------
RPO2A_TOBAC     FPPLPERGDFDMRDVLESPYFF-
RPOP_CLAPU      -----------------------
RPOP_NEUIN      -----------------------
RPOP_GELSP      LPVLPQMGELNVEDI--------
RPOP_AGABT      -----------------------
RPOP_PODAN      -----------------------
RPO1A_TOBAC     FPPLPERGDFDLREVLESPYFF-