[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for atum0:AAK87067.1

[Show Plain Result]


## Summary of Sequence Search
    1::396
    1::396       0.0 100%  396 aa  NUOD_AGRT5 RecName: Full=NADH-quinone oxidoreductase subunit D;    
    1::396       0.0  88%  396 aa  NUOD1_SINMW RecName: Full=NADH-quinone oxidoreductase subunit D 1; 
    1::396       0.0  88%  396 aa  NUOD1_RHIME RecName: Full=NADH-quinone oxidoreductase subunit D 1; 
    1::396       0.0  88%  396 aa  NUOD_RHILW RecName: Full=NADH-quinone oxidoreductase subunit D;    
    1::396       0.0  88%  396 aa  NUOD1_RHIE6 RecName: Full=NADH-quinone oxidoreductase subunit D 1; 
    1::396       0.0  88%  396 aa  NUOD1_RHIEC RecName: Full=NADH-quinone oxidoreductase subunit D 1; 
    1::396       0.0  87%  396 aa  NUOD_RHIL3 RecName: Full=NADH-quinone oxidoreductase subunit D;    
    1::396       0.0  84%  396 aa  NUOD_BRUME RecName: Full=NADH-quinone oxidoreductase subunit D;    
    1::396       0.0  84%  396 aa  NUOD_BRUSI RecName: Full=NADH-quinone oxidoreductase subunit D;    
    1::396       0.0  84%  396 aa  NUOD_BRUO2 RecName: Full=NADH-quinone oxidoreductase subunit D;    
    1::396       0.0  84%  396 aa  NUOD_BRUC2 RecName: Full=NADH-quinone oxidoreductase subunit D;    
    1::396       0.0  83%  396 aa  NUOD_OCHA4 RecName: Full=NADH-quinone oxidoreductase subunit D;    
    1::396       0.0  83%  396 aa  NUOD_MESSB RecName: Full=NADH-quinone oxidoreductase subunit D;    
    1::396       0.0  84%  396 aa  NUOD_BRUSU RecName: Full=NADH-quinone oxidoreductase subunit D;    
    1::396       0.0  84%  396 aa  NUOD_BRUAB RecName: Full=NADH-quinone oxidoreductase subunit D;    
    1::396       0.0  84%  396 aa  NUOD_BRUA2 RecName: Full=NADH-quinone oxidoreductase subunit D;    
    1::396       0.0  84%  396 aa  NUOD_BRUA1 RecName: Full=NADH-quinone oxidoreductase subunit D;    
    1::396       0.0  82%  396 aa  NUOD_RHILO RecName: Full=NADH-quinone oxidoreductase subunit D;    
   14::402       0.0  83%  402 aa  NUOD_XANP2 RecName: Full=NADH-quinone oxidoreductase subunit D;    
    7::398       0.0  81%  398 aa  NUOD_BRAJA RecName: Full=NADH-quinone oxidoreductase subunit D;    
   12::402       0.0  80%  402 aa  NUOD_NITWN RecName: Full=NADH-quinone oxidoreductase subunit D;    
    8::398       0.0  81%  398 aa  NUOD_BRASO RecName: Full=NADH-quinone oxidoreductase subunit D;    
    8::398       0.0  80%  398 aa  NUOD_BRASB RecName: Full=NADH-quinone oxidoreductase subunit D;    
   11::402       0.0  80%  402 aa  NUOD_RHOPA RecName: Full=NADH-quinone oxidoreductase subunit D;    
   12::402       0.0  79%  402 aa  NUOD2_NITHX RecName: Full=NADH-quinone oxidoreductase subunit D 2; 
   11::402       0.0  79%  402 aa  NUOD_RHOPT RecName: Full=NADH-quinone oxidoreductase subunit D;    
    1::392       0.0  80%  392 aa  NUOD_PARL1 RecName: Full=NADH-quinone oxidoreductase subunit D;    
   16::405       0.0  79%  405 aa  NUOD_OLICO RecName: Full=NADH-quinone oxidoreductase subunit D;    
    1::396       0.0  78%  396 aa  NUOD_BARBK RecName: Full=NADH-quinone oxidoreductase subunit D;    
   26::416       0.0  79%  416 aa  NUOD_RHOPS RecName: Full=NADH-quinone oxidoreductase subunit D;    
   11::401       0.0  78%  401 aa  NUOD_RHOP2 RecName: Full=NADH-quinone oxidoreductase subunit D;    
   14::402       0.0  80%  402 aa  NUOD_AZOC5 RecName: Full=NADH-quinone oxidoreductase subunit D;    
    1::396       0.0  78%  396 aa  NUOD_RHOP5 RecName: Full=NADH-quinone oxidoreductase subunit D;    
    1::396       0.0  77%  396 aa  NUOD_METEP RecName: Full=NADH-quinone oxidoreductase subunit D;    
    1::396       0.0  77%  396 aa  NUOD_BARQU RecName: Full=NADH-quinone oxidoreductase subunit D;    
    1::396       0.0  77%  396 aa  NUOD_METS4 RecName: Full=NADH-quinone oxidoreductase subunit D;    
    1::396       0.0  77%  396 aa  NUOD_METRJ RecName: Full=NADH-quinone oxidoreductase subunit D;    
    1::396       0.0  77%  396 aa  NUOD_METPB RecName: Full=NADH-quinone oxidoreductase subunit D;    
    1::396       0.0  78%  396 aa  NUOD_RHOPB RecName: Full=NADH-quinone oxidoreductase subunit D;    
    1::396       0.0  76%  396 aa  NUOD_BART1 RecName: Full=NADH-quinone oxidoreductase subunit D;    
    1::396       0.0  77%  396 aa  NUOD_BARHE RecName: Full=NADH-quinone oxidoreductase subunit D;    
    7::398       0.0  79%  398 aa  NUOD_CAUCR RecName: Full=NADH-quinone oxidoreductase subunit D;    
    1::396       0.0  77%  396 aa  NUOD1_BEII9 RecName: Full=NADH-quinone oxidoreductase subunit D 1; 
    1::396       0.0  77%  396 aa  NUOD1_NITHX RecName: Full=NADH-quinone oxidoreductase subunit D 1; 
   25::416       0.0  77%  416 aa  NUOD_CAUSK RecName: Full=NADH-quinone oxidoreductase subunit D;    
   18::411       0.0  76%  411 aa  NUOD_PHEZH RecName: Full=NADH-quinone oxidoreductase subunit D;    
    1::396       0.0  74%  396 aa  NUOD2_BEII9 RecName: Full=NADH-quinone oxidoreductase subunit D 2; 
   13::402       0.0  75%  402 aa  NUOD_MARMM RecName: Full=NADH-quinone oxidoreductase subunit D;    
   15::405       0.0  75%  405 aa  NUOD_SILPO RecName: Full=NADH-quinone oxidoreductase subunit D;    
   22::412     e-180  74%  412 aa  NUOD_JANSC RecName: Full=NADH-quinone oxidoreductase subunit D;    
   14::404     e-180  74%  404 aa  NUOD_DINSH RecName: Full=NADH-quinone oxidoreductase subunit D;    
   12::402     e-180  74%  402 aa  NUOD_RHOS5 RecName: Full=NADH-quinone oxidoreductase subunit D;    
   14::404     e-179  73%  404 aa  NUOD_RHOS4 RecName: Full=NADH-quinone oxidoreductase subunit D;    
   12::402     e-179  73%  402 aa  NUOD_RHOS1 RecName: Full=NADH-quinone oxidoreductase subunit D;    
   15::407     e-177  72%  407 aa  NUOD_ROSDO RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::392     e-176  74%  392 aa  NUOD_HYPNA RecName: Full=NADH-quinone oxidoreductase subunit D;    
   13::403     e-176  72%  403 aa  NUOD_SILST RecName: Full=NADH-quinone oxidoreductase subunit D;    
    5::391     e-174  71%  391 aa  NUOD_PELUB RecName: Full=NADH-quinone oxidoreductase subunit D;    
   21::413     e-170  70%  413 aa  NUOD_RHOCA RecName: Full=NADH-quinone oxidoreductase subunit D;    
   21::412     e-169  71%  412 aa  NQO4_PARDP RecName: Full=NADH-quinone oxidoreductase subunit 4;    
   21::412     e-168  70%  412 aa  NQO4_PARDE RecName: Full=NADH-quinone oxidoreductase subunit 4;    
    1::392     e-168  70%  392 aa  NUOD_MAGSA RecName: Full=NADH-quinone oxidoreductase subunit D;    
   11::393     e-166  69%  393 aa  NUOD_EHRCJ RecName: Full=NADH-quinone oxidoreductase subunit D;    
    5::398     e-166  67%  398 aa  NUOD_RHOCS RecName: Full=NADH-quinone oxidoreductase subunit D;    
    3::390     e-164  66%  390 aa  NUOD_WOLTR RecName: Full=NADH-quinone oxidoreductase subunit D;    
    1::393     e-163  66%  393 aa  NUOD_EHRRW RecName: Full=NADH-quinone oxidoreductase subunit D;    
    1::393     e-163  66%  393 aa  NUOD_EHRRG RecName: Full=NADH-quinone oxidoreductase subunit D;    
    3::390     e-163  65%  390 aa  NUOD_WOLPM RecName: Full=NADH-quinone oxidoreductase subunit D;    
   16::403     e-163  66%  403 aa  NUOD_NOVAD RecName: Full=NADH-quinone oxidoreductase subunit D;    
    3::390     e-162  65%  390 aa  NUOD_WOLPP RecName: Full=NADH-quinone oxidoreductase subunit D;    
    1::392     e-161  64%  392 aa  NUOD_RHORT RecName: Full=NADH-quinone oxidoreductase subunit D;    
   16::406     e-161  66%  406 aa  NUOD_SPHWW RecName: Full=NADH-quinone oxidoreductase subunit D;    
   10::396     e-161  68%  396 aa  NDUS2_RECAM RecName: Full=NADH-ubiquinone oxidoreductase 49 kDa
   18::405     e-160  66%  405 aa  NUOD_SPHAL RecName: Full=NADH-quinone oxidoreductase subunit D;    
   11::393     e-158  66%  393 aa  NUOD_EHRCR RecName: Full=NADH-quinone oxidoreductase subunit D;    
    3::391     e-158  65%  391 aa  NUOD_RICBR RecName: Full=NADH-quinone oxidoreductase subunit D;    
    3::391     e-158  65%  391 aa  NUOD_RICB8 RecName: Full=NADH-quinone oxidoreductase subunit D;    
   12::398     e-158  64%  398 aa  NUOD_ANAMM RecName: Full=NADH-quinone oxidoreductase subunit D;    
   14::400     e-157  66%  400 aa  NUOD_GRABC RecName: Full=NADH-quinone oxidoreductase subunit D;    
    3::391     e-156  64%  391 aa  NUOD_RICFE RecName: Full=NADH-quinone oxidoreductase subunit D;    
   16::403     e-156  65%  403 aa  NUOD_ERYLH RecName: Full=NADH-quinone oxidoreductase subunit D;    
   12::398     e-156  65%  398 aa  NDUS2_NEPOL RecName: Full=NADH-ubiquinone oxidoreductase 49 kDa
    4::389     e-155  64%  389 aa  NUOD_RICPR RecName: Full=NADH-quinone oxidoreductase subunit D;    
    3::391     e-155  64%  391 aa  NUOD_RICAH RecName: Full=NADH-quinone oxidoreductase subunit D;    
    3::391     e-155  63%  391 aa  NUOD_RICCK RecName: Full=NADH-quinone oxidoreductase subunit D;    
   13::395     e-155  64%  395 aa  NUOD_ANAPZ RecName: Full=NADH-quinone oxidoreductase subunit D;    
    7::400     e-155  66%  400 aa  NDUS2_PROWI RecName: Full=NADH-ubiquinone oxidoreductase 49 kDa
   72::463     e-155  65%  463 aa  NDUS2_RAT RecName: Full=NADH dehydrogenase [ubiquinone] iron-sulfur
    3::391     e-154  63%  391 aa  NUOD_RICCN RecName: Full=NADH-quinone oxidoreductase subunit D;    
   72::463     e-154  64%  463 aa  NDUS2_MOUSE RecName: Full=NADH dehydrogenase [ubiquinone]
   15::401     e-154  65%  401 aa  NDUS2_ACACA RecName: Full=NADH-ubiquinone oxidoreductase 49 kDa
    3::391     e-154  63%  391 aa  NUOD_RICRO RecName: Full=NADH-quinone oxidoreductase subunit D;    
   77::463     e-154  65%  463 aa  NDUS2_BOVIN RecName: Full=NADH dehydrogenase [ubiquinone]
    4::389     e-153  63%  389 aa  NUOD_RICTY RecName: Full=NADH-quinone oxidoreductase subunit D;    
    3::391     e-153  63%  391 aa  NUOD_RICRS RecName: Full=NADH-quinone oxidoreductase subunit D;    
    3::391     e-153  63%  391 aa  NUOD_RICM5 RecName: Full=NADH-quinone oxidoreductase subunit D;    
   77::463     e-153  65%  463 aa  NDUS2_PONAB RecName: Full=NADH dehydrogenase [ubiquinone]
   77::463     e-153  65%  463 aa  NDUS2_PANTR RecName: Full=NADH dehydrogenase [ubiquinone]
   77::463     e-153  65%  463 aa  NDUS2_HUMAN RecName: Full=NADH dehydrogenase [ubiquinone]
   77::463     e-153  65%  463 aa  NDUS2_GORGO RecName: Full=NADH dehydrogenase [ubiquinone]
   15::396     e-153  64%  396 aa  NUOD_ORITI RecName: Full=NADH-quinone oxidoreductase subunit D;    
   15::396     e-153  64%  396 aa  NUOD_ORITB RecName: Full=NADH-quinone oxidoreductase subunit D;    
    7::388     e-153  67%  388 aa  NUOD_NEOSM RecName: Full=NADH-quinone oxidoreductase subunit D;    
    5::394     e-151  63%  394 aa  NDUS2_ARATH RecName: Full=NADH-ubiquinone oxidoreductase 49 kDa
   30::416     e-150  64%  416 aa  NUOD_GLUDA RecName: Full=NADH-quinone oxidoreductase subunit D;    
   14::398     e-150  65%  398 aa  NDUS2_PYLLI RecName: Full=NADH-ubiquinone oxidoreductase 49 kDa
    4::417     e-149  64%  417 aa  NUOD_AZOSB RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-149  65%  417 aa  NUOD_AZOSE RecName: Full=NADH-quinone oxidoreductase subunit D;    
   92::478     e-148  64%  478 aa  NDUS2_NEUCR RecName: Full=NADH-ubiquinone oxidoreductase 49 kDa
   24::406     e-148  64%  406 aa  NUOD_ACICJ RecName: Full=NADH-quinone oxidoreductase subunit D;    
    7::398     e-148  62%  398 aa  NDUS2_CAFRO RecName: Full=NADH-ubiquinone oxidoreductase 49 kDa
    3::418     e-147  64%  418 aa  NUOD_NEIG2 RecName: Full=NADH-quinone oxidoreductase subunit D;    
    3::418     e-147  64%  418 aa  NUOD_NEIG1 RecName: Full=NADH-quinone oxidoreductase subunit D;    
    3::418     e-147  64%  418 aa  NUOD_NEIMB RecName: Full=NADH-quinone oxidoreductase subunit D;    
    3::418     e-147  64%  418 aa  NUOD_NEIMA RecName: Full=NADH-quinone oxidoreductase subunit D;    
    3::418     e-146  63%  418 aa  NUOD_NEIMF RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-146  64%  417 aa  NUOD_METFK RecName: Full=NADH-quinone oxidoreductase subunit D;    
    3::418     e-146  63%  418 aa  NUOD_NEIM0 RecName: Full=NADH-quinone oxidoreductase subunit D;    
    5::397     e-144  60%  397 aa  NUOD_MAGSM RecName: Full=NADH-quinone oxidoreductase subunit D;    
   93::482     e-144  61%  482 aa  NDUS2_CAEEL RecName: Full=Probable NADH dehydrogenase [ubiquinone]
    4::417     e-143  64%  417 aa  NUOD_ACIF5 RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-143  63%  417 aa  NUOD_THIDA RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-143  62%  417 aa  NUOD_JANMA RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-143  62%  417 aa  NUOD_POLNA RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-142  62%  417 aa  NUOD_NITMU RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-142  62%  417 aa  NUOD_HERAR RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::418     e-142  61%  418 aa  NUOD_BORA1 RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-142  62%  417 aa  NUOD_NITEU RecName: Full=NADH-quinone oxidoreductase subunit D;    
    3::417     e-141  61%  417 aa  NUOD_CUPTR RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-141  62%  417 aa  NUOD_BURTA RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-141  62%  417 aa  NUOD_BURPS RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-141  62%  417 aa  NUOD_BURP6 RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-141  62%  417 aa  NUOD_BURP1 RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-141  62%  417 aa  NUOD_BURP0 RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-141  62%  417 aa  NUOD_BURMS RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-141  62%  417 aa  NUOD_BURMA RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-141  62%  417 aa  NUOD_BURM9 RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-141  62%  417 aa  NUOD_BURM7 RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::418     e-141  61%  418 aa  NUOD_BORPE RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-141  61%  417 aa  NUOD_BURP8 RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-141  61%  417 aa  NUOD_BURPP RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-141  62%  417 aa  NUOD_DELAS RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-141  61%  417 aa  NUOD_BURXL RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::418     e-141  61%  418 aa  NUOD_BORPD RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::418     e-141  61%  418 aa  NUOD_BORPA RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::418     e-141  61%  418 aa  NUOD_BORBR RecName: Full=NADH-quinone oxidoreductase subunit D;    
    3::417     e-141  61%  417 aa  NUOD_RALME RecName: Full=NADH-quinone oxidoreductase subunit D;    
    3::417     e-141  61%  417 aa  NUOD_NITEC RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-141  63%  417 aa  NUOD_THICR RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-141  61%  417 aa  NUOD_CHRVO RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-140  61%  417 aa  NUOD_BURCJ RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-140  61%  417 aa  NUOD_BURCH RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-140  61%  417 aa  NUOD_BURCA RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-140  61%  417 aa  NUOD_BURS3 RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-140  61%  417 aa  NUOD_BURCC RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-140  61%  417 aa  NUOD_BURVG RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-140  61%  417 aa  NUOD_BURM1 RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-140  60%  417 aa  NUOD_BURCM RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-140  61%  417 aa  NUOD_ACIAC RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-140  60%  417 aa  NUOD_BURA4 RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-139  60%  417 aa  NUOD_POLSJ RecName: Full=NADH-quinone oxidoreductase subunit D;    
    3::417     e-139  60%  417 aa  NUOD_RALEH RecName: Full=NADH-quinone oxidoreductase subunit D;    
    3::417     e-139  60%  417 aa  NUOD_RALPJ RecName: Full=NADH-quinone oxidoreductase subunit D;    
    3::417     e-139  60%  417 aa  NUOD_RALEJ RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-139  60%  417 aa  NUOD_METPP RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-139  60%  417 aa  NUOD_LEPCP RecName: Full=NADH-quinone oxidoreductase subunit D;    
    5::417     e-139  61%  417 aa  NUOD_ALHEH RecName: Full=NADH-quinone oxidoreductase subunit D;    
    3::417     e-138  61%  417 aa  NUOD_DECAR RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-138  60%  417 aa  NUOD_RHOFD RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-137  60%  417 aa  NUOD_POLSQ RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-137  61%  417 aa  NUOD_NITOC RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-137  60%  417 aa  NUOD_VEREI RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-137  60%  417 aa  NUOD_COXB2 RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-137  60%  417 aa  NUOD_COXB1 RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-137  60%  417 aa  NUOD_COXBN RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-136  59%  417 aa  NUOD_POLNS RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-136  60%  417 aa  NUOD_COXBU RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-136  60%  417 aa  NUOD_COXBR RecName: Full=NADH-quinone oxidoreductase subunit D;    
   23::436     e-136  60%  436 aa  NUOD1_STRM5 RecName: Full=NADH-quinone oxidoreductase subunit D 1; 
    4::417     e-136  59%  417 aa  NUOD_ACISJ RecName: Full=NADH-quinone oxidoreductase subunit D;    
   18::435     e-136  60%  435 aa  NUOD2_STRM5 RecName: Full=NADH-quinone oxidoreductase subunit D 2; 
   18::435     e-135  59%  435 aa  NUOD_XANC5 RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-135  60%  417 aa  NUOD_RUTMC RecName: Full=NADH-quinone oxidoreductase subunit D;    
   18::435     e-135  59%  435 aa  NUOD_XANCP RecName: Full=NADH-quinone oxidoreductase subunit D;    
   18::435     e-135  59%  435 aa  NUOD_XANCB RecName: Full=NADH-quinone oxidoreductase subunit D;    
   18::435     e-135  59%  435 aa  NUOD_XANC8 RecName: Full=NADH-quinone oxidoreductase subunit D;    
   18::435     e-135  59%  435 aa  NUOD_STRMK RecName: Full=NADH-quinone oxidoreductase subunit D;    
   18::435     e-135  59%  435 aa  NUOD_XANOR RecName: Full=NADH-quinone oxidoreductase subunit D;    
   18::435     e-135  59%  435 aa  NUOD_XANOP RecName: Full=NADH-quinone oxidoreductase subunit D;    
   18::435     e-135  59%  435 aa  NUOD_XANOM RecName: Full=NADH-quinone oxidoreductase subunit D;    
   18::435     e-135  59%  435 aa  NUOD_XANAC RecName: Full=NADH-quinone oxidoreductase subunit D;    
    5::417     e-134  60%  417 aa  NUOD_FRATN RecName: Full=NADH-quinone oxidoreductase subunit D;    
    1::394     e-134  59%  394 aa  NDUS2_NICSY RecName: Full=NADH-ubiquinone oxidoreductase 49 kDa
    5::417     e-134  60%  417 aa  NUOD_HALHL RecName: Full=NADH-quinone oxidoreductase subunit D;    
    5::417     e-133  60%  417 aa  NUOD_FRATT RecName: Full=NADH-quinone oxidoreductase subunit D;    
    5::417     e-133  60%  417 aa  NUOD_FRAT1 RecName: Full=NADH-quinone oxidoreductase subunit D;    
    5::417     e-133  60%  417 aa  NUOD_FRAP2 RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-133  59%  417 aa  NUOD_VESOH RecName: Full=NADH-quinone oxidoreductase subunit D;    
    5::417     e-133  60%  417 aa  NUOD_FRATW RecName: Full=NADH-quinone oxidoreductase subunit D;    
    5::417     e-133  60%  417 aa  NUOD_FRATM RecName: Full=NADH-quinone oxidoreductase subunit D;    
   18::435     e-133  59%  435 aa  NUOD_XYLFA RecName: Full=NADH-quinone oxidoreductase subunit D;    
   18::435     e-133  59%  435 aa  NUOD_XYLFT RecName: Full=NADH-quinone oxidoreductase subunit D;    
   18::435     e-133  59%  435 aa  NUOD_XYLF2 RecName: Full=NADH-quinone oxidoreductase subunit D;    
   18::435     e-133  59%  435 aa  NUOD_XYLFM RecName: Full=NADH-quinone oxidoreductase subunit D;    
    5::417     e-132  60%  417 aa  NUOD_FRATO RecName: Full=NADH-quinone oxidoreductase subunit D;    
    5::417     e-132  60%  417 aa  NUOD_FRATH RecName: Full=NADH-quinone oxidoreductase subunit D;    
    5::417     e-132  60%  417 aa  NUOD_FRATF RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-129  58%  417 aa  NUOD_LEGPL RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-129  58%  417 aa  NUOD_LEGPH RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-129  57%  417 aa  NUOD_LEGPC RecName: Full=NADH-quinone oxidoreductase subunit D;    
    4::417     e-129  57%  417 aa  NUOD_LEGPA RecName: Full=NADH-quinone oxidoreductase subunit D;    
   14::406     e-124  56%  406 aa  NDUS2_DICDI RecName: Full=NADH-ubiquinone oxidoreductase 49 kDa
   14::406     e-124  56%  406 aa  NDUS2_DICCI RecName: Full=NADH-ubiquinone oxidoreductase 49 kDa
    8::390     e-115  51%  390 aa  NUOD_GEOUR RecName: Full=NADH-quinone oxidoreductase subunit D;    
    8::390     e-112  51%  390 aa  NUOD_GEOMG RecName: Full=NADH-quinone oxidoreductase subunit D;    
    8::390     e-112  51%  390 aa  NUOD_GEOSL RecName: Full=NADH-quinone oxidoreductase subunit D;    
    7::389     e-111  50%  389 aa  NUOD_GEOBB RecName: Full=NADH-quinone oxidoreductase subunit D;    
    8::390     e-110  51%  390 aa  NUOD_GEOLS RecName: Full=NADH-quinone oxidoreductase subunit D;    
   16::404     e-109  51%  404 aa  NUOD2_RHIE6 RecName: Full=NADH-quinone oxidoreductase subunit D 2; 
   16::404     e-108  51%  404 aa  NUOD2_RHIEC RecName: Full=NADH-quinone oxidoreductase subunit D 2; 
    6::400     e-108  51%  400 aa  NDUS2_PARTE RecName: Full=NADH-ubiquinone oxidoreductase 49 kDa
   16::404     e-108  49%  404 aa  NUOD2_RHIME RecName: Full=NADH-quinone oxidoreductase subunit D 2; 
   16::404     e-108  49%  404 aa  NUOD2_SINMW RecName: Full=NADH-quinone oxidoreductase subunit D 2; 
   27::411     e-106  48%  411 aa  NUOD2_CHLAA RecName: Full=NADH-quinone oxidoreductase subunit D 2; 
   43::426     e-106  49%  426 aa  NUOD1_OPITP RecName: Full=NADH-quinone oxidoreductase subunit D 1; 
   33::417     e-104  49%  417 aa  NUOD1_ROSCS RecName: Full=NADH-quinone oxidoreductase subunit D 1; 
   33::417     e-103  49%  417 aa  NUOD2_ROSS1 RecName: Full=NADH-quinone oxidoreductase subunit D 2; 
   32::414     e-102  48%  414 aa  NUOD_AKKM8 RecName: Full=NADH-quinone oxidoreductase subunit D;    
   37::418     e-102  47%  418 aa  NUOD_METI4 RecName: Full=NADH-quinone oxidoreductase subunit D;    
   14::401     e-101  47%  401 aa  NUOD2_THEYD RecName: Full=NADH-quinone oxidoreductase subunit D 2; 
   18::409     e-100  46%  409 aa  NUOD_CAMC1 RecName: Full=NADH-quinone oxidoreductase subunit D;    
   16::401     5e-99  48%  401 aa  NUOD2_ACIBL RecName: Full=NADH-quinone oxidoreductase subunit D 2; 
   52::449     2e-98  47%  449 aa  NUOD_SACEN RecName: Full=NADH-quinone oxidoreductase subunit D;    
   50::457     5e-98  47%  457 aa  NUOD_FRASN RecName: Full=NADH-quinone oxidoreductase subunit D;    
   27::409     5e-98  45%  409 aa  NQO4_THET2 RecName: Full=NADH-quinone oxidoreductase subunit 4;    
   17::409     6e-98  46%  409 aa  NUOD_SULNB RecName: Full=NADH-quinone oxidoreductase subunit D;    
   27::409     1e-97  45%  409 aa  NQO4_THET8 RecName: Full=NADH-quinone oxidoreductase subunit 4;    
   17::408     2e-97  44%  408 aa  NUOD_WOLSU RecName: Full=NADH-quinone oxidoreductase subunit D;    
   21::403     2e-97  45%  403 aa  NUOD_DEIGD RecName: Full=NADH-quinone oxidoreductase subunit D;    
   30::422     3e-97  44%  422 aa  NUOD1_HERA2 RecName: Full=NADH-quinone oxidoreductase subunit D 1; 
   18::409     1e-96  44%  409 aa  NUOD_CAMC5 RecName: Full=NADH-quinone oxidoreductase subunit D;    
   14::370     5e-95  48%  370 aa  NUOD2_SOLUE RecName: Full=NADH-quinone oxidoreductase subunit D 2; 
   33::432     8e-95  48%  432 aa  NUOD_MYCA9 RecName: Full=NADH-quinone oxidoreductase subunit D;    
   54::453     1e-94  48%  453 aa  NUOD_NOCFA RecName: Full=NADH-quinone oxidoreductase subunit D;    
   24::409     2e-94  45%  409 aa  NUOD1_SOLUE RecName: Full=NADH-quinone oxidoreductase subunit D 1; 
   42::441     2e-94  47%  441 aa  NUOD_MYCPA RecName: Full=NADH-quinone oxidoreductase subunit D;    
   42::441     2e-94  47%  441 aa  NUOD_MYCA1 RecName: Full=NADH-quinone oxidoreductase subunit D;    
   18::409     2e-94  43%  409 aa  NUOD_HELPY RecName: Full=NADH-quinone oxidoreductase subunit D;    
   18::409     3e-94  43%  409 aa  NUOD_HELPS RecName: Full=NADH-quinone oxidoreductase subunit D;    
   63::470     3e-94  46%  470 aa  NUOD_FRAAA RecName: Full=NADH-quinone oxidoreductase subunit D;    
   25::381     3e-94  46%  381 aa  NUOD1_ACIBL RecName: Full=NADH-quinone oxidoreductase subunit D 1; 
   18::409     4e-94  43%  409 aa  NUOD_HELPJ RecName: Full=NADH-quinone oxidoreductase subunit D;    
   18::409     4e-94  43%  409 aa  NUOD_HELPH RecName: Full=NADH-quinone oxidoreductase subunit D;    
   18::409     4e-94  43%  409 aa  NUOD_HELP2 RecName: Full=NADH-quinone oxidoreductase subunit D;    
   18::409     5e-94  43%  409 aa  NUOD_HELPG RecName: Full=NADH-quinone oxidoreductase subunit D;    
   55::440     5e-94  44%  440 aa  NUOD1_CHLT3 RecName: Full=NADH-quinone oxidoreductase subunit D 1; 
   41::440     7e-94  47%  440 aa  NUOD_MYCTU RecName: Full=NADH-quinone oxidoreductase subunit D;    
   41::440     7e-94  47%  440 aa  NUOD_MYCTA RecName: Full=NADH-quinone oxidoreductase subunit D;    
   41::440     7e-94  47%  440 aa  NUOD_MYCBP RecName: Full=NADH-quinone oxidoreductase subunit D;    
   41::440     7e-94  47%  440 aa  NUOD_MYCBO RecName: Full=NADH-quinone oxidoreductase subunit D;    
   33::432     9e-94  48%  432 aa  NUOD_MYCMM RecName: Full=NADH-quinone oxidoreductase subunit D;    
   76::482     1e-93  47%  482 aa  NUOD_FRASC RecName: Full=NADH-quinone oxidoreductase subunit D;    
   69::451     2e-93  44%  451 aa  NUOD_SALRD RecName: Full=NADH-quinone oxidoreductase subunit D;    
   26::409     2e-93  42%  409 aa  NUOD_HELHP RecName: Full=NADH-quinone oxidoreductase subunit D;    
    9::374     2e-93  48%  374 aa  NUOD2_ROSCS RecName: Full=NADH-quinone oxidoreductase subunit D 2; 
   44::443     2e-93  47%  443 aa  NUOD1_STRAW RecName: Full=NADH-quinone oxidoreductase subunit D 1; 
   17::410     3e-93  43%  410 aa  NUOD_NITSB RecName: Full=NADH-quinone oxidoreductase subunit D;    
   41::451     3e-93  46%  451 aa  NUOD_MYCGI RecName: Full=NADH-quinone oxidoreductase subunit D;    
   30::415     4e-93  42%  415 aa  NUOD_MYXXD RecName: Full=NADH-quinone oxidoreductase subunit D;    
   22::408     6e-93  42%  408 aa  NUOD_CAMHC RecName: Full=NADH-quinone oxidoreductase subunit D;    
    9::374     8e-93  47%  374 aa  NUOD1_ROSS1 RecName: Full=NADH-quinone oxidoreductase subunit D 1; 
   25::408     2e-92  43%  408 aa  NUOD_CAMJR RecName: Full=NADH-quinone oxidoreductase subunit D;    
   25::408     2e-92  43%  408 aa  NUOD_CAMJJ RecName: Full=NADH-quinone oxidoreductase subunit D;    
   25::408     2e-92  43%  408 aa  NUOD_CAMJE RecName: Full=NADH-quinone oxidoreductase subunit D;    
   19::401     4e-92  43%  401 aa  NUOD_DEIRA RecName: Full=NADH-quinone oxidoreductase subunit D;    
   25::408     4e-92  43%  408 aa  NUOD_CAMJD RecName: Full=NADH-quinone oxidoreductase subunit D;    
   25::408     4e-92  43%  408 aa  NUOD_CAMJ8 RecName: Full=NADH-quinone oxidoreductase subunit D;    
   25::412     5e-92  43%  412 aa  NUOD_SULDN RecName: Full=NADH-quinone oxidoreductase subunit D;    
   41::440     6e-92  46%  440 aa  NUOD2_STRCO RecName: Full=NADH-quinone oxidoreductase subunit D 2; 
    9::369     8e-92  46%  369 aa  NUOD1_CHLAA RecName: Full=NADH-quinone oxidoreductase subunit D 1; 
   41::440     4e-91  46%  440 aa  NUOD1_STRGG RecName: Full=NADH-quinone oxidoreductase subunit D 1; 
    1::384     7e-91  48%  384 aa  NUOD2_SYMTH RecName: Full=NADH-quinone oxidoreductase subunit D 2; 
   39::438     2e-90  45%  438 aa  NUOD_RHOSR RecName: Full=NADH-quinone oxidoreductase subunit D;    
   45::430     3e-90  45%  430 aa  NUOD1_ANADE RecName: Full=NADH-quinone oxidoreductase subunit D 1; 
   46::431     6e-90  45%  431 aa  NUOD2_ANASK RecName: Full=NADH-quinone oxidoreductase subunit D 2; 
   33::432     1e-89  47%  432 aa  NUOD_MYCUA RecName: Full=NADH-quinone oxidoreductase subunit D;    
  173::560     5e-89  43%  560 aa  NUOCD_BDEBA RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  211::592     9e-89  41%  592 aa  NUOCD_ACICJ RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
   11::391     9e-89  45%  391 aa  NDHH_CHAGL RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
    8::397     1e-88  42%  397 aa  NUOD1_THEYD RecName: Full=NADH-quinone oxidoreductase subunit D 1; 
  410::791     1e-88  42%  791 aa  NUBCD_GEOMG RecName: Full=NADH-quinone oxidoreductase subunit
   22::403     3e-88  41%  403 aa  NUOD_PELPD RecName: Full=NADH-quinone oxidoreductase subunit D;    
  220::601     4e-88  40%  601 aa  NUOCD_GLUDA RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  412::793     1e-87  41%  793 aa  NUBCD_GEOUR RecName: Full=NADH-quinone oxidoreductase subunit
    4::363     1e-87  45%  364 aa  NUOD_HELMI RecName: Full=NADH-quinone oxidoreductase subunit D;    
   41::418     2e-87  46%  440 aa  NUOD_ACIC1 RecName: Full=NADH-quinone oxidoreductase subunit D;    
   44::446     2e-87  44%  446 aa  NUOD_NOCSJ RecName: Full=NADH-quinone oxidoreductase subunit D;    
  411::792     2e-87  41%  792 aa  NUBCD_GEOSL RecName: Full=NADH-quinone oxidoreductase subunit
    5::394     3e-87  44%  394 aa  NDHH_ANASP RecName: Full=NAD(P)H-quinone oxidoreductase subunit H; 
   33::434     4e-87  45%  434 aa  NUOD_THEFY RecName: Full=NADH-quinone oxidoreductase subunit D;    
  406::787     5e-87  42%  787 aa  NUBCD_SYNFM RecName: Full=NADH-quinone oxidoreductase subunit
  413::794     6e-87  42%  794 aa  NUBCD_PELCD RecName: Full=NADH-quinone oxidoreductase subunit
    5::394     6e-87  44%  394 aa  NDHH_NOSP7 RecName: Full=NAD(P)H-quinone oxidoreductase subunit H; 
    3::394     8e-87  43%  394 aa  NDHH_SYNJA RecName: Full=NAD(P)H-quinone oxidoreductase subunit H; 
    5::364     1e-86  43%  365 aa  NUOD_CARHZ RecName: Full=NADH-quinone oxidoreductase subunit D;    
    7::367     1e-86  45%  367 aa  NUOD_DEHE1 RecName: Full=NADH-quinone oxidoreductase subunit D;    
    9::370     2e-86  46%  370 aa  NUOD2_HERA2 RecName: Full=NADH-quinone oxidoreductase subunit D 2; 
    3::393     2e-86  44%  393 aa  NDHH_CHLAT RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
    7::367     2e-86  45%  367 aa  NUOD_DEHSB RecName: Full=NADH-quinone oxidoreductase subunit D;    
    1::392     2e-86  42%  392 aa  NDHH_SYNJB RecName: Full=NAD(P)H-quinone oxidoreductase subunit H; 
   49::431     3e-86  43%  431 aa  NUOD2_ANADF RecName: Full=NADH-quinone oxidoreductase subunit D 2; 
   23::433     4e-86  43%  433 aa  NUOD_PROAC RecName: Full=NADH-quinone oxidoreductase subunit D;    
   36::441     4e-86  44%  441 aa  NUOD1_SALAI RecName: Full=NADH-quinone oxidoreductase subunit D 1; 
   36::441     7e-86  44%  441 aa  NUOD1_SALTO RecName: Full=NADH-quinone oxidoreductase subunit D 1; 
    5::394     7e-86  44%  394 aa  NDHH_ANAVT RecName: Full=NAD(P)H-quinone oxidoreductase subunit H; 
    7::367     9e-86  45%  367 aa  NUOD_DEHSC RecName: Full=NADH-quinone oxidoreductase subunit D;    
  212::593     9e-86  41%  593 aa  NUOCD_NITOC RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  227::608     9e-86  40%  608 aa  NUOCD_NITMU RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
    5::394     9e-86  43%  394 aa  NDHH_THEEB RecName: Full=NAD(P)H-quinone oxidoreductase subunit H; 
    9::404     1e-85  42%  404 aa  NUOD1_SYMTH RecName: Full=NADH-quinone oxidoreductase subunit D 1; 
   30::395     2e-85  46%  395 aa  NUOD_PELLD RecName: Full=NADH-quinone oxidoreductase subunit D;    
    5::394     2e-85  43%  394 aa  NDHH_ACAM1 RecName: Full=NAD(P)H-quinone oxidoreductase subunit H; 
   21::402     3e-85  41%  402 aa  NUOD_PARUW RecName: Full=NADH-quinone oxidoreductase subunit D;    
   47::446     4e-85  45%  446 aa  NUOD_MYCSS RecName: Full=NADH-quinone oxidoreductase subunit D;    
   47::446     4e-85  45%  446 aa  NUOD_MYCSK RecName: Full=NADH-quinone oxidoreductase subunit D;    
   47::446     4e-85  45%  446 aa  NUOD_MYCSJ RecName: Full=NADH-quinone oxidoreductase subunit D;    
   18::409     4e-85  40%  409 aa  NUOD_HELAH RecName: Full=NADH-quinone oxidoreductase subunit D;    
  198::571     1e-84  42%  571 aa  NUOCD_HYDS0 RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  201::586     1e-84  40%  586 aa  NUCD2_AQUAE RecName: Full=NADH-quinone oxidoreductase subunit C/D
  221::593     1e-84  42%  593 aa  NUCD1_AQUAE RecName: Full=NADH-quinone oxidoreductase subunit C/D
   13::406     1e-84  45%  406 aa  NDHH_PAUCH RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   38::400     2e-84  46%  400 aa  NUOD_PELPB RecName: Full=NADH-quinone oxidoreductase subunit D;    
    3::393     2e-84  43%  393 aa  NDHH1_GLOVI RecName: Full=NAD(P)H-quinone oxidoreductase subunit H
    8::365     2e-84  43%  366 aa  NUOD_DESRM RecName: Full=NADH-quinone oxidoreductase subunit D;    
    9::365     2e-84  42%  366 aa  NUOD_BACAH RecName: Full=NADH-quinone oxidoreductase subunit D;    
   34::399     2e-84  46%  399 aa  NUOD2_CHLT3 RecName: Full=NADH-quinone oxidoreductase subunit D 2; 
  200::581     2e-84  41%  581 aa  NUOCD_RHOP5 RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
    9::365     3e-84  42%  366 aa  NUOD_BACAN RecName: Full=NADH-quinone oxidoreductase subunit D;    
  199::580     4e-84  41%  580 aa  NUOCD_RHOS4 RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
    9::365     5e-84  42%  366 aa  NUOD_BACCR RecName: Full=NADH-quinone oxidoreductase subunit D;    
    9::365     5e-84  42%  366 aa  NUOD_BACC1 RecName: Full=NADH-quinone oxidoreductase subunit D;    
   12::392     5e-84  43%  392 aa  NDHH_MARPO RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   30::400     6e-84  45%  400 aa  NUOD_CHLTE RecName: Full=NADH-quinone oxidoreductase subunit D;    
  206::587     6e-84  40%  587 aa  NUOCD_METCA RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
   13::393     6e-84  43%  393 aa  NDHH_EUCGG RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   22::403     8e-84  41%  404 aa  NUOD1_SORC5 RecName: Full=NADH-quinone oxidoreductase subunit D 1; 
  199::580     8e-84  41%  580 aa  NUOCD_RHOSK RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
   13::394     8e-84  43%  394 aa  NDHH_TRIEI RecName: Full=NAD(P)H-quinone oxidoreductase subunit H; 
   30::395     1e-83  46%  395 aa  NUOD_CHLL2 RecName: Full=NADH-quinone oxidoreductase subunit D;    
    9::365     1e-83  41%  366 aa  NUOD_BACWK RecName: Full=NADH-quinone oxidoreductase subunit D;    
    9::365     1e-83  42%  366 aa  NUOD_BACCZ RecName: Full=NADH-quinone oxidoreductase subunit D;    
   11::391     1e-83  43%  391 aa  NDHH_MESVI RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
    5::394     1e-83  41%  394 aa  NDHH_SYNSC RecName: Full=NAD(P)H-quinone oxidoreductase subunit H; 
    1::391     1e-83  41%  391 aa  NDHH_CHAVU RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   32::442     2e-83  43%  442 aa  NUOD_MYCVP RecName: Full=NADH-quinone oxidoreductase subunit D;    
    9::365     2e-83  42%  366 aa  NUOD_BACHK RecName: Full=NADH-quinone oxidoreductase subunit D;    
    5::394     2e-83  41%  394 aa  NDHH_SYNS9 RecName: Full=NAD(P)H-quinone oxidoreductase subunit H; 
    5::394     2e-83  41%  394 aa  NDHH_SYNPX RecName: Full=NAD(P)H-quinone oxidoreductase subunit H; 
   30::400     2e-83  46%  400 aa  NUOD_CHLP8 RecName: Full=NADH-quinone oxidoreductase subunit D;    
  199::580     2e-83  41%  580 aa  NUOCD_RHOS1 RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  200::581     2e-83  40%  581 aa  NUOCD_RHOPS RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
   13::393     2e-83  43%  393 aa  NDHH_POPTR RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   13::393     2e-83  43%  393 aa  NDHH_POPAL RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   38::400     3e-83  45%  400 aa  NUOD_CHLCH RecName: Full=NADH-quinone oxidoreductase subunit D;    
   13::393     4e-83  43%  393 aa  NDHH_AGRST RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
    9::365     5e-83  40%  366 aa  NUOD_BACCN RecName: Full=NADH-quinone oxidoreductase subunit D;    
   12::393     5e-83  43%  393 aa  NDHH_ANTFO RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   13::393     5e-83  42%  393 aa  NDHH_ANGEV RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
    5::394     7e-83  42%  394 aa  NDHH_SYNS3 RecName: Full=NAD(P)H-quinone oxidoreductase subunit H; 
   29::400     9e-83  44%  400 aa  NUOD_PROVI RecName: Full=NADH-quinone oxidoreductase subunit D;    
   10::366     9e-83  42%  367 aa  NUOD_GEOKA RecName: Full=NADH-quinone oxidoreductase subunit D;    
    5::394     9e-83  41%  394 aa  NDHH_SYNPW RecName: Full=NAD(P)H-quinone oxidoreductase subunit H; 
   13::395     9e-83  42%  395 aa  NDHH_STAPU RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
    9::365     1e-82  42%  366 aa  NUOD_GEOTN RecName: Full=NADH-quinone oxidoreductase subunit D;    
    6::370     2e-82  41%  370 aa  NUOD_CLOB8 RecName: Full=NADH-quinone oxidoreductase subunit D;    
  218::598     2e-82  41%  598 aa  NUOCD_SHEWM RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
   11::393     2e-82  42%  393 aa  NDHH_ZYGCR RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   43::442     5e-82  43%  442 aa  NUOD_MYCS2 RecName: Full=NADH-quinone oxidoreductase subunit D;    
    3::394     5e-82  42%  394 aa  NDHH_SYNP6 RecName: Full=NAD(P)H-quinone oxidoreductase subunit H; 
    3::394     5e-82  42%  394 aa  NDHH_SYNE7 RecName: Full=NAD(P)H-quinone oxidoreductase subunit H; 
    5::395     6e-82  41%  395 aa  NDHH_PROMP RecName: Full=NAD(P)H-quinone oxidoreductase subunit H; 
   13::393     6e-82  42%  393 aa  NDHH_ACOCL RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   13::393     6e-82  42%  393 aa  NDHH_ACOAM RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
  199::580     8e-82  41%  580 aa  NUOCD_RHOS5 RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
    5::394     8e-82  41%  394 aa  NDHH_PROMT RecName: Full=NAD(P)H-quinone oxidoreductase subunit H; 
    5::394     8e-82  41%  394 aa  NDHH_PROM1 RecName: Full=NAD(P)H-quinone oxidoreductase subunit H; 
   13::393     8e-82  42%  393 aa  NDHH_NANDO RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   13::393     8e-82  42%  393 aa  NDHH_MANES RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   24::388     1e-81  43%  388 aa  NUOD2_SORC5 RecName: Full=NADH-quinone oxidoreductase subunit D 2; 
  217::598     1e-81  39%  598 aa  NUOCD_EDWI9 RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  413::794     1e-81  40%  794 aa  NUBCD_GEOBB RecName: Full=NADH-quinone oxidoreductase subunit
  204::576     1e-81  42%  576 aa  NUOCD_SULSY RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  218::599     1e-81  40%  599 aa  NUOCD_PHOLL RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
    5::394     1e-81  42%  394 aa  NDHH2_GLOVI RecName: Full=NAD(P)H-quinone oxidoreductase subunit H
  217::598     2e-81  39%  598 aa  NUOCD_PROMH RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
    1::391     2e-81  40%  391 aa  NDHH_NEPOL RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   13::393     2e-81  42%  393 aa  NDHH_WHEAT RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
    5::394     2e-81  42%  394 aa  NDHH_MICAN RecName: Full=NAD(P)H-quinone oxidoreductase subunit H; 
   35::400     3e-81  44%  400 aa  NUOD_PROA2 RecName: Full=NADH-quinone oxidoreductase subunit D;    
    5::394     3e-81  42%  394 aa  NDHH_SYNR3 RecName: Full=NAD(P)H-quinone oxidoreductase subunit H; 
   13::393     3e-81  42%  393 aa  NDHH_SACOF RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   13::393     3e-81  42%  393 aa  NDHH_SACHY RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
  200::581     4e-81  39%  581 aa  NUOCD_RHOPA RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  200::581     4e-81  39%  581 aa  NUOCD_RHOP2 RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  200::581     5e-81  39%  581 aa  NUOCD_RHOPT RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
   13::393     5e-81  42%  393 aa  NDHH_SORBI RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   13::393     5e-81  43%  393 aa  NDHH_ORYSJ RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   13::393     5e-81  43%  393 aa  NDHH_ORYSI RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   13::393     5e-81  43%  393 aa  NDHH_ORYSA RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   13::393     5e-81  43%  393 aa  NDHH_ORYNI RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   15::395     5e-81  42%  395 aa  NDHH_LEMMI RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   13::393     5e-81  42%  393 aa  NDHH_HORVU RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   15::371     7e-81  43%  371 aa  NUOD_MOOTA RecName: Full=NADH-quinone oxidoreductase subunit D;    
  212::593     7e-81  39%  593 aa  NUOCD_PSEMY RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
   13::393     7e-81  42%  393 aa  NDHH_NYMAL RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   13::393     7e-81  42%  393 aa  NDHH_NUPAD RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
  217::598     9e-81  39%  598 aa  NUOCD_YERE8 RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  212::593     9e-81  40%  593 aa  NUOCD_PSEPW RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  213::594     9e-81  40%  594 aa  NUOCD_PSEPF RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  212::593     9e-81  40%  593 aa  NUOCD_PSEE4 RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
    5::394     9e-81  42%  394 aa  NDHH_PROMM RecName: Full=NAD(P)H-quinone oxidoreductase subunit H; 
    5::395     9e-81  40%  395 aa  NDHH_PROM5 RecName: Full=NAD(P)H-quinone oxidoreductase subunit H; 
  212::593     1e-80  40%  593 aa  NUOCD_PSEPK RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  212::593     1e-80  40%  593 aa  NUOCD_PSEPG RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  212::593     1e-80  40%  593 aa  NUOCD_PSEP1 RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  212::593     1e-80  40%  593 aa  NUOCD_PSE14 RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
   13::393     1e-80  41%  393 aa  NDHH_SOYBN RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   13::393     1e-80  42%  393 aa  NDHH_MAIZE RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   13::393     1e-80  41%  393 aa  NDHH_CUCSA RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
  200::581     1e-80  40%  581 aa  NUOCD_RHOPB RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  212::593     1e-80  40%  593 aa  NUOCD_PSEU2 RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  213::594     1e-80  38%  594 aa  NUOCD_PSEFS RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
   21::392     2e-80  43%  392 aa  NUOD1_CYTH3 RecName: Full=NADH-quinone oxidoreductase subunit D 1; 
   13::393     2e-80  41%  393 aa  NDHH_VITVI RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   13::393     2e-80  42%  393 aa  NDHH_DRANE RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   38::400     3e-80  45%  400 aa  NUOD_CHLPD RecName: Full=NADH-quinone oxidoreductase subunit D;    
  217::598     3e-80  39%  598 aa  NUOCD_YERPY RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  217::598     3e-80  39%  598 aa  NUOCD_YERPS RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  217::598     3e-80  39%  598 aa  NUOCD_YERPP RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  217::598     3e-80  39%  598 aa  NUOCD_YERPN RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  217::598     3e-80  39%  598 aa  NUOCD_YERPG RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  217::598     3e-80  39%  598 aa  NUOCD_YERPE RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  217::598     3e-80  39%  598 aa  NUOCD_YERPB RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  217::598     3e-80  39%  598 aa  NUOCD_YERPA RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  217::598     3e-80  39%  598 aa  NUOCD_YERP3 RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
   13::393     3e-80  42%  393 aa  NDHH_FESAR RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
    1::393     3e-80  42%  393 aa  NDHH_AMBTC RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
  212::593     3e-80  39%  593 aa  NUOCD_PSEF5 RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  212::593     3e-80  38%  593 aa  NUOCD_PSEAE RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  212::593     3e-80  38%  593 aa  NUOCD_PSEAB RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  212::593     3e-80  38%  593 aa  NUOCD_PSEA7 RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  212::593     3e-80  40%  593 aa  NUOCD_AZOVD RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
    5::394     3e-80  40%  394 aa  NDHH_PROMA RecName: Full=NAD(P)H-quinone oxidoreductase subunit H; 
    5::394     3e-80  40%  394 aa  NDHH_PROM3 RecName: Full=NAD(P)H-quinone oxidoreductase subunit H; 
   13::393     6e-80  42%  393 aa  NDHH_LOLPR RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   13::393     6e-80  40%  393 aa  NDHH_CICAR RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   10::381     7e-80  41%  381 aa  NUOD1_ANADF RecName: Full=NADH-quinone oxidoreductase subunit D 1; 
    5::394     7e-80  41%  394 aa  NDHH_SYNY3 RecName: Full=NAD(P)H-quinone oxidoreductase subunit H; 
   13::393     7e-80  41%  393 aa  NDHH_JASNU RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
  212::593     1e-79  39%  593 aa  NUOCD_PSESM RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
   13::393     1e-79  41%  393 aa  NDHH_SPIOL RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
    5::394     1e-79  40%  394 aa  NDHH_PROM4 RecName: Full=NAD(P)H-quinone oxidoreductase subunit H; 
   11::391     1e-79  42%  391 aa  NDHH_PHYPA RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
    5::394     2e-79  41%  394 aa  NDHH_SYNP2 RecName: Full=NAD(P)H-quinone oxidoreductase subunit H; 
    5::395     3e-79  40%  395 aa  NDHH_PROMS RecName: Full=NAD(P)H-quinone oxidoreductase subunit H; 
   13::393     3e-79  41%  393 aa  NDHH_OENGL RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   13::393     3e-79  41%  393 aa  NDHH_OENEH RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   13::393     3e-79  41%  393 aa  NDHH_OENBI RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   13::393     4e-79  41%  393 aa  NDHH_OENPA RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   13::393     4e-79  41%  393 aa  NDHH_OENAR RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   13::393     4e-79  42%  393 aa  NDHH_BRADI RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
    5::395     5e-79  39%  395 aa  NDHH_PROM9 RecName: Full=NAD(P)H-quinone oxidoreductase subunit H; 
    5::395     5e-79  39%  395 aa  NDHH_PROM2 RecName: Full=NAD(P)H-quinone oxidoreductase subunit H; 
    5::395     5e-79  39%  395 aa  NDHH_PROM0 RecName: Full=NAD(P)H-quinone oxidoreductase subunit H; 
  214::595     6e-79  40%  595 aa  NUOCD_PSYWF RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
    7::393     6e-79  41%  393 aa  NDHH_PSINU RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   13::393     6e-79  41%  393 aa  NDHH_IPOPU RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   13::393     1e-78  41%  393 aa  NDHH_PIPCE RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
  214::596     2e-78  39%  596 aa  NUOCD_BLOFL RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
   13::393     2e-78  41%  393 aa  NDHH_GOSBA RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   13::401     2e-78  41%  401 aa  NDHH_AETCO RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   13::393     2e-78  41%  393 aa  NDHH_GOSHI RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   13::395     2e-78  41%  395 aa  NDHH_DIOEL RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   13::393     2e-78  40%  393 aa  NDHH_CYCTA RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   15::395     2e-78  42%  395 aa  NDHH_CHLSC RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
  210::591     3e-78  40%  591 aa  NUOCD_PSYCK RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  213::595     3e-78  38%  595 aa  NUOCD_BAUCH RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
   13::393     3e-78  42%  393 aa  NDHH_PELHO RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   13::393     3e-78  42%  393 aa  NDHH_CALFG RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
  210::591     4e-78  39%  591 aa  NUOCD_PSYA2 RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
   13::393     4e-78  40%  393 aa  NDHH_SOLLC RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   13::393     5e-78  40%  393 aa  NDHH_SOLTU RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   13::393     5e-78  40%  393 aa  NDHH_CARPA RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   13::393     5e-78  40%  393 aa  NDHH_ATRBE RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   14::373     7e-78  41%  373 aa  NUOD_SYNFM RecName: Full=NADH-quinone oxidoreductase subunit D;    
   35::400     7e-78  43%  400 aa  NUOD_CHLPB RecName: Full=NADH-quinone oxidoreductase subunit D;    
   13::393     7e-78  40%  393 aa  NDHH_TOBAC RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   13::393     7e-78  40%  393 aa  NDHH_NICSY RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
  218::600     9e-78  40%  600 aa  NUOCD_CITK8 RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
   13::393     9e-78  40%  393 aa  NDHH_HUPLU RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
    6::395     9e-78  41%  395 aa  NDHH_CITSI RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   31::396     1e-77  41%  396 aa  NUOD_RUBXD RecName: Full=NADH-quinone oxidoreductase subunit D;    
   13::393     1e-77  40%  393 aa  NDHH_SOLBU RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   13::393     1e-77  40%  393 aa  NDHH_PHAVU RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   13::393     1e-77  40%  393 aa  NDHH_CRYJA RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   13::394     1e-77  41%  394 aa  NDHH_ADICA RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
  216::598     2e-77  39%  598 aa  NUOCD_SERP5 RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  220::602     2e-77  39%  602 aa  NUOCD_KLEP3 RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  218::600     2e-77  39%  600 aa  NUOCD_ECO5E RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  218::600     2e-77  39%  600 aa  NUOCD_ECO57 RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
   13::393     2e-77  41%  393 aa  NDHH_DRIGR RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
  218::600     2e-77  39%  600 aa  NUOCD_ECOUT RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  218::600     2e-77  39%  600 aa  NUOCD_ECOL6 RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  218::600     2e-77  39%  600 aa  NUOCD_ECOK1 RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  218::600     2e-77  39%  600 aa  NUOCD_ECO81 RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  218::600     2e-77  39%  600 aa  NUOCD_ECO45 RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  218::600     2e-77  39%  600 aa  NUOCD_ECO27 RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  218::600     3e-77  39%  600 aa  NUOCD_SHISS RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  218::600     3e-77  39%  600 aa  NUOCD_SHIFL RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  214::596     3e-77  39%  596 aa  NUOCD_SHIF8 RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  218::600     3e-77  39%  600 aa  NUOCD_SHIDS RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  218::600     3e-77  39%  600 aa  NUOCD_SHIBS RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  220::602     3e-77  39%  602 aa  NUOCD_KLEP7 RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  218::600     3e-77  39%  600 aa  NUOCD_ESCF3 RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  218::600     3e-77  39%  600 aa  NUOCD_ECOSM RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  218::600     3e-77  39%  600 aa  NUOCD_ECOSE RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  218::600     3e-77  39%  600 aa  NUOCD_ECOLU RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  218::600     3e-77  39%  600 aa  NUOCD_ECOLC RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  214::596     3e-77  39%  596 aa  NUOCD_ECOL5 RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  218::600     3e-77  39%  600 aa  NUOCD_ECOHS RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  218::600     3e-77  39%  600 aa  NUOCD_ECO8A RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  218::600     3e-77  39%  600 aa  NUOCD_ECO7I RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  218::600     3e-77  39%  600 aa  NUOCD_ECO55 RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  218::600     3e-77  39%  600 aa  NUOCD_ECO24 RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  218::600     4e-77  39%  600 aa  NUOCD_SHIB3 RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  221::603     4e-77  39%  603 aa  NUOCD_ENTS8 RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
   13::393     4e-77  41%  393 aa  NDHH_RANMC RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   13::393     4e-77  41%  393 aa  NDHH_OLIPU RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
  217::599     6e-77  38%  599 aa  NUOCD_PECCP RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  214::596     6e-77  38%  596 aa  NUOCD_BLOPB RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
   13::393     6e-77  40%  393 aa  NDHH_NICTO RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
    1::393     6e-77  41%  393 aa  NDHH_LIRTU RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   13::397     6e-77  40%  397 aa  NDHH_AETGR RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
  214::596     8e-77  39%  596 aa  NUOCD_SALTY RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  214::596     8e-77  39%  596 aa  NUOCD_SALTI RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  218::600     8e-77  39%  600 aa  NUOCD_SALSV RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  218::600     8e-77  39%  600 aa  NUOCD_SALPK RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  218::600     8e-77  39%  600 aa  NUOCD_SALPB RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  218::600     8e-77  39%  600 aa  NUOCD_SALPA RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  218::600     8e-77  39%  600 aa  NUOCD_SALNS RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  214::596     8e-77  39%  596 aa  NUOCD_SALHS RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  214::596     8e-77  39%  596 aa  NUOCD_SALG2 RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  214::596     8e-77  39%  596 aa  NUOCD_SALEP RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  214::596     8e-77  39%  596 aa  NUOCD_SALDC RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  218::600     8e-77  38%  600 aa  NUOCD_SALAR RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  218::600     8e-77  39%  600 aa  NUOCD_SALA4 RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  217::599     8e-77  38%  599 aa  NUOCD_ERWCT RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
   13::393     8e-77  40%  393 aa  NDHH_BUXMI RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   13::393     8e-77  41%  393 aa  NDHH_ARAHI RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   30::411     1e-76  38%  412 aa  NUOD_FLAPJ RecName: Full=NADH-quinone oxidoreductase subunit D;    
  214::596     1e-76  38%  596 aa  NUOCD_ECOLI RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  218::600     1e-76  38%  600 aa  NUOCD_ECODH RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
   13::393     1e-76  40%  393 aa  NDHH_TRISU RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   13::393     1e-76  41%  393 aa  NDHH_CRUWA RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   13::393     1e-76  41%  393 aa  NDHH_CERDE RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   13::393     1e-76  41%  393 aa  NDHH_NASOF RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   13::393     1e-76  41%  393 aa  NDHH_LOBMA RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   13::393     1e-76  41%  393 aa  NDHH_CAPBU RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   13::393     1e-76  41%  393 aa  NDHH_BARVE RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   13::393     1e-76  41%  393 aa  NDHH_ARATH RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   24::404     2e-76  37%  405 aa  NUOD_LEPIN RecName: Full=NADH-quinone oxidoreductase subunit D;    
   24::404     2e-76  37%  405 aa  NUOD_LEPIC RecName: Full=NADH-quinone oxidoreductase subunit D;    
   13::393     2e-76  41%  393 aa  NDHH_HELAN RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   13::393     2e-76  41%  393 aa  NDHH_GUIAB RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   13::393     2e-76  41%  393 aa  NDHH_PLAOC RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   13::393     2e-76  40%  393 aa  NDHH_LEPVR RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   13::393     2e-76  41%  393 aa  NDHH_ILLOL RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   23::403     4e-76  42%  403 aa  NUOD_AMOA5 RecName: Full=NADH-quinone oxidoreductase subunit D;    
    1::393     4e-76  41%  393 aa  NDHH_PANGI RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
  213::595     5e-76  39%  595 aa  NUOCD_ENT38 RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  211::592     5e-76  39%  592 aa  NUOCD_CHRSD RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  218::600     6e-76  39%  600 aa  NUOCD_SALPC RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  214::596     6e-76  39%  596 aa  NUOCD_SALCH RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
   13::393     8e-76  40%  393 aa  NDHH_LACSA RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
    1::393     1e-75  41%  393 aa  NDHH_DAUCA RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   25::405     1e-75  38%  406 aa  NUOD_LEPBP RecName: Full=NADH-quinone oxidoreductase subunit D;    
   23::403     1e-75  37%  404 aa  NUOD_LEPBJ RecName: Full=NADH-quinone oxidoreductase subunit D;    
   25::405     1e-75  38%  406 aa  NUOD_LEPBA RecName: Full=NADH-quinone oxidoreductase subunit D;    
   24::404     2e-75  37%  405 aa  NUOD_LEPBL RecName: Full=NADH-quinone oxidoreductase subunit D;    
   18::379     2e-75  42%  379 aa  NUOD1_ANASK RecName: Full=NADH-quinone oxidoreductase subunit D 1; 
  217::599     2e-75  37%  599 aa  NUOCD_SODGM RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
   18::379     3e-75  42%  379 aa  NUOD2_ANADE RecName: Full=NADH-quinone oxidoreductase subunit D 2; 
   13::393     3e-75  40%  393 aa  NDHH_MORIN RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   13::393     4e-75  40%  393 aa  NDHH_LOTJA RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
  189::578     5e-75  37%  578 aa  NUOCD_BUCCC RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  212::600     5e-75  38%  600 aa  NUOCD_BUCAT RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  212::600     5e-75  38%  600 aa  NUOCD_BUCAI RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  212::600     7e-75  38%  600 aa  NUOCD_BUCA5 RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
   13::395     9e-75  40%  395 aa  NDHH_COFAR RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   30::411     1e-74  36%  412 aa  NUOD_FLAJ1 RecName: Full=NADH-quinone oxidoreductase subunit D;    
   40::399     3e-74  41%  399 aa  NUOD2_OPITP RecName: Full=NADH-quinone oxidoreductase subunit D 2; 
  219::601     3e-74  39%  601 aa  NUOCD_AERHH RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
   13::393     4e-74  40%  393 aa  NDHH_FAGEA RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
  172::530     5e-74  39%  530 aa  NUOCD_BACTN RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  219::601     6e-74  38%  601 aa  NUOCD_SHEON RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  209::597     6e-74  38%  597 aa  NUOCD_BUCAP RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
   25::412     8e-74  39%  412 aa  NDUS2_NYCOV RecName: Full=NADH-ubiquinone oxidoreductase 49 kDa
    8::392     1e-73  35%  393 aa  NUOD2_CYTH3 RecName: Full=NADH-quinone oxidoreductase subunit D 2; 
  215::597     1e-73  37%  597 aa  NUOCD_BUCBP RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  219::601     1e-73  38%  601 aa  NUOCD_AERS4 RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  214::595     1e-73  37%  595 aa  NUOCD_ACIAD RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  161::519     3e-73  39%  519 aa  NUOCD_BACV8 RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  214::595     7e-73  36%  595 aa  NUOCD_ACIBY RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  214::595     7e-73  36%  595 aa  NUOCD_ACIBT RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  214::595     7e-73  36%  595 aa  NUOCD_ACIBS RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  214::595     7e-73  36%  595 aa  NUOCD_ACIBC RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  214::595     7e-73  36%  595 aa  NUOCD_ACIB5 RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  214::595     7e-73  36%  595 aa  NUOCD_ACIB3 RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  163::544     3e-72  36%  544 aa  NUOCD_ARCB4 RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  161::530     6e-72  38%  530 aa  NUOCD_BACFR RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
  161::530     6e-72  38%  530 aa  NUOCD_BACFN RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
   14::370     7e-72  40%  370 aa  NUOD_DESHY RecName: Full=NADH-quinone oxidoreductase subunit D;    
  180::561     2e-71  38%  561 aa  NUOCD_CAMFF RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
    1::372     5e-71  38%  372 aa  NUOD_DESPS RecName: Full=NADH-quinone oxidoreductase subunit D;    
  217::599     8e-69  35%  599 aa  NUOCD_ERWT9 RecName: Full=NADH-quinone oxidoreductase subunit C/D; 
   30::394     5e-65  36%  394 aa  NUOD2_STRGG RecName: Full=NADH-quinone oxidoreductase subunit D 2; 
   19::383     4e-61  36%  383 aa  NUOD2_STRAW RecName: Full=NADH-quinone oxidoreductase subunit D 2; 
   19::383     1e-60  36%  383 aa  NUOD1_STRCO RecName: Full=NADH-quinone oxidoreductase subunit D 1; 
   27::388     4e-58  34%  388 aa  NUOD2_SALTO RecName: Full=NADH-quinone oxidoreductase subunit D 2; 
    8::367     5e-58  34%  367 aa  NUOD_THEM4 RecName: Full=NADH-quinone oxidoreductase subunit D;    
   24::385     2e-57  33%  385 aa  NUOD2_SALAI RecName: Full=NADH-quinone oxidoreductase subunit D 2; 
   11::386     9e-51  33%  386 aa  NDUS2_TRYBB RecName: Full=NADH-ubiquinone oxidoreductase 49 kDa
    4::353     2e-46  35%  361 aa  COOH_RHORU RecName: Full=Carbon monoxide-induced hydrogenase;
  178::537     5e-30  28%  569 aa  HYCE_ECOLI RecName: Full=Formate hydrogenlyase subunit 5;       
    7::274     3e-29  30%  380 aa  Y515_METJA RecName: Full=Uncharacterized protein MJ0515;
  174::523     3e-26  28%  555 aa  HYFG_ECOLI RecName: Full=Hydrogenase-4 component G;       
   10::368     4e-19  24%  377 aa  Y1027_METJA RecName: Full=Uncharacterized protein MJ1027;
    1::47      2e-15  73%   47 aa  NDUS2_SOLTU RecName: Full=NADH-ubiquinone oxidoreductase 49 kDa
    1::88      3e-15  43%   90 aa  NDHH_SECCE RecName: Full=NAD(P)H-quinone oxidoreductase subunit H,
   15::163     6e-05  24%  405 aa  FRHA_METTH RecName: Full=Coenzyme F420 hydrogenase subunit alpha;  
   15::107     2e-04  28%  474 aa  VHCA_METVO RecName: Full=F420-non-reducing hydrogenase vhc subunit
   28::121     3e-04  27%  621 aa  MBHL_ALCHY RecName: Full=Uptake hydrogenase large subunit;       
   15::105     4e-04  34%  456 aa  FRHA_METBF RecName: Full=Coenzyme F420 hydrogenase subunit alpha;  
    1::396

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTEHNVRNFTINFGPEHPSAHGVLRLVLELDGEIVERVDPHIGLLHRGTEKLIETKTYLQAVPYFDRLDY
NUOD_AGRT5      MTEHNVRNFTINFGPEHPSAHGVLRLVLELDGEIVERVDPHIGLLHRGTEKLIETKTYLQAVPYFDRLDY
NUOD1_SINMW     MTEHNVRNFNINFGPQHPAAHGVLRLVLELDGEIVERVDPHIGLLHRGTEKLIEAKTYLQAIPYFDRLDY
NUOD1_RHIME     MTEHNVRNFNINFGPQHPAAHGVLRLVLELDGEIVERVDPHIGLLHRGTEKLIEAKTYLQAIPYFDRLDY
NUOD_RHILW      MTEHNVRNFNINFGPQHPAAHGVLRLVLELDGEIVERVDPHIGLLHRGTEKLIETKTYLQAVPYFDRLDY
NUOD1_RHIE6     MTEHNVRNFNINFGPQHPAAHGVLRLVLELDGEIVERVDPHIGLLHRGTEKLIETKTYLQAVPYFDRLDY
NUOD1_RHIEC     MTEHNVRNFNINFGPQHPAAHGVLRLVLELDGEIVERVDPHIGLLHRGTEKLIETKTYLQAVPYFDRLDY
NUOD_RHIL3      MTEHNVRNFNINFGPQHPAAHGVLRLVLELDGEIVERVDPHIGLLHRGTEKLIETKTYLQAVPYFDRLDY
NUOD_BRUME      MAETQVRNFNINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLMEAKTYLQAVPYLDRLDY
NUOD_BRUSI      MAETQVRNFNINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLMEAKTYLQAVPYLDRLDY
NUOD_BRUO2      MAETQVRNFNINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLMEAKTYLQAVPYLDRLDY
NUOD_BRUC2      MAETQVRNFNINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLMEAKTYLQAVPYLDRLDY
NUOD_OCHA4      MAETQVRNFNINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLMEAKTYLQALPYLDRLDY
NUOD_MESSB      MAETSIRNFNINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLIEYKTYLQAIPYFDRLDY
NUOD_BRUSU      MAETQVRNFNINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLMEAKTYLQAVPYLDRLDY
NUOD_BRUAB      MAETQVRNFNINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLMEAKTYLQAVPYLDRLDY
NUOD_BRUA2      MAETQVRNFNINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLMEAKTYLQAVPYLDRLDY
NUOD_BRUA1      MAETQVRNFNINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLMEAKTYLQAVPYLDRLDY
NUOD_RHILO      MAETSVRNFNINFGPQHPAAHGVLRLVLELDGEVVDRVDPHIGLLHRGTEKLIEAKTYLQAVPYLDRLDY
NUOD_XANP2      -----VRNFQINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLIEAKTYLQAVPYFDRLDY
NUOD_BRAJA      ----NLRNFTINFGPQHPAAHGVLRLVLELDGEIVARVDPHIGLLHRGTEKLIEQKTYLQAIPYFDRLDY
NUOD_NITWN      -----MRNFTINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLIEQKTYLQAIPYFDRLDY
NUOD_BRASO      -----LRNFTINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLIETKTYLQAMPYFDRLDY
NUOD_BRASB      -----LRNFTINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLIETKTYLQAMPYFDRLDY
NUOD_RHOPA      ----SVRNFTINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLIEQKTYLQAIPYFDRLDY
NUOD2_NITHX     -----MRNFTINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLIEQKTYLQAIPYFDRLDY
NUOD_RHOPT      ----SVRNFTINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLIEQKTYLQAIPYFDRLDY
NUOD_PARL1      MAEQELRNYHLNFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLIEYKTYLQATPYFDRLDY
NUOD_OLICO      ------RNFTINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLIEQKTYLQAIPYFDRLDY
NUOD_BARBK      MAEVNVRNFNINFGPQHPAAHGVLRMVLELDGEVVERVDPHIGLLHRGTEKLMETKTYLQAGPYLDRLDY
NUOD_RHOPS      -----LRNFTINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLIEHKTYLQAIPYFDRLDY
NUOD_RHOP2      -----LRNFTINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLIEQKTYLQAIPYFDRLDY
NUOD_AZOC5      -----VRNFQINFGPQHPAAHGVLRMVLELNGEVVERVDPHIGLLHRGTEKLIEAKTYLQAVPYFDRLDY
NUOD_RHOP5      MPEGALRNFTINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLIEQKTYLQAIPYFDRLDY
NUOD_METEP      MTEHNIRNFSINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLIEHKTYLQATPYFDRLDY
NUOD_BARQU      MAEVNVRNFNINFGPQHPAAHGVLRMVLELDGEVVERVDPHIGLLHRGTEKLMETKTYLQAVPYLDRLDY
NUOD_METS4      MTEHSIRNFSINFGPQHPAAHGVLRLVLELDGEIVERVDPHIGLLHRGTEKLIEVKTYLQATPYFDRLDY
NUOD_METRJ      MTEHNIRNFAINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLIEYKTYLQATPYFDRLDY
NUOD_METPB      MSEHNIRNFSINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLIEHKTYLQATPYFDRLDY
NUOD_RHOPB      MPEGALRNFTINFGPQHPAAHGVLRLVLELDGEIVERVDPHIGLLHRGTEKLIEAKTYLQAIPYFDRLDY
NUOD_BART1      MAEVNVRNFNINFGPQHPAAHGVLRMVLELDGEVVERVDPHIGLLHRGTEKLMETKTYLQAGPYLDRLDY
NUOD_BARHE      MAEVNVRNFNINFGPQHPAAHGVLRMVLELDGEVVERVDPHIGLLHRGTEKLMETKTYLQAGPYLDRLDY
NUOD_CAUCR      --ETPVRKFNINFGPQHPAAHGVLRLVLELDGEIVERVDPHIGLLHRGTEKLMEARTYLQNIPYFDRLDY
NUOD1_BEII9     MNDNPVRNFAINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLMEARTYLQNVPYFDRLDY
NUOD1_NITHX     MVEAAPRNFTINFGPQHPAAHGVLRLVLELDGEVVRRVDPHIGLLHRGTEKLIEHKTYLQALPYFDRLDY
NUOD_CAUSK      --ETPVRKFNINFGPQHPAAHGVLRLVLELDGEIVERVDPHIGLLHRGTEKLMEARTYLQNIPYFDRLDY
NUOD_PHEZH      LPETKVRKFNINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLMEARPYAQTIPYFDRLDY
NUOD2_BEII9     MDEAGFRNFTVNFGPQHPAAHGVLRLVLELDGEVVERADPHIGLLHRGTEKLIEYRTYLQALPYFDRLDY
NUOD_MARMM      ------RNFTINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLLEHKTYLQGIGYFDRLDY
NUOD_SILPO      --EQKIRNFNINFGPQHPAAHGVLRMVLELDGEIVERCDPHIGLLHRGTEKLMESRTYLQNLPYFDRLDY
NUOD_JANSC      --EQKIRNFNLNFGPQHPAAHGVLRLVLELDGEICERCDPHIGLLHRGTEKLMESRTYLQNLPYFDRLDY
NUOD_DINSH      --EQKIRNFNINFGPQHPAAHGVLRLVLELDGEIVERCDPHIGLLHRGTEKLMESRTYLQNLPYFDRLDY
NUOD_RHOS5      --EQKLRNFNINFGPQHPAAHGVLRLVLELDGEVVERCDPHIGLLHRGTEKLMETRTYLQNLPYFDRLDY
NUOD_RHOS4      --EQKLRNFNINFGPQHPAAHGVLRLVLELDGEVVERCDPHIGLLHRGTEKLMESRTYLQNLPYFDRLDY
NUOD_RHOS1      --EQKLRNFNINFGPQHPAAHGVLRLVLELDGEVVERCDPHIGLLHRGTEKLMESRTYLQNLPYFDRLDY
NUOD_ROSDO      --EQKIRNFNINFGPQHPAAHGVLRLVLELDGEIVERCDPHIGLLHRGTEKLMESRTYLQNLPYFDRLDY
NUOD_HYPNA      ------RKFTLNFGPQHPAAHGVLRMILDLDGEIVTRVDSHIGLLHRGTEKLLEYKTYLQGMPYFDRLDY
NUOD_SILST      --EQKIRNFNINFGPQHPAAHGVLRLVLELDGEIVERCDPHIGLLHRGTEKLMESRTYLQNLPYFDRLDY
NUOD_PELUB      -----IKTLNLNFGPQHPAAHGVLRLILELDGEVVEKADPHIGLLHRGTEKLIENKTYMQAVPYFDRLDY
NUOD_RHOCA      --EQSIRNFNINFGPQHPAAHGVLRMVLELDGEIVERADPHIGLLHRGTEKLMESRTYLQNTPYFDRLDY
NQO4_PARDP      --EQSIRNFNINFGPQHPAAHGVLRMVLELDGEIVERADPHIGLLHRGTEKLMESRTYLQNLPYLDRLDY
NQO4_PARDE      --EQSIRNFNINFGPQHPAAHGLLRMVLELDGEIVERADPHIGLLHRGTEKLMESRTYLQNLPYLDRLDY
NUOD_MAGSA      MAESQIQSYTINFGPQHPAAHGVLRLILEMSGEVVDRADPHVGLLHRGTEKLIEHKTYLQATPYFDRLDY
NUOD_EHRCJ      ---------TLNFGPQHPAAHGVMRLVLEMGGEVIERIDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDY
NUOD_RHOCS      VAETQIKPFTMNFGPQHPAAHGVLRLVLEMDGEVVQRADPHVGLLHRGTEKLIEYKTYIQALPYFDRLDY
NUOD_WOLTR      ----DLKTMMLNFGPQHPAAHGVLRLVLEMDGEIIERADPHIGLLHRGTEKLIEHKTYLQALPYFDRLDY
NUOD_EHRRW      MSDHKITPMTLNFGPQHPAAHGVMRLVLEMGGEVIERIDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDY
NUOD_EHRRG      MSDHKITPMTLNFGPQHPAAHGVMRLVLEMGGEVIERIDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDY
NUOD_WOLPM      ----DLKTMMLNFGPQHPAAHGVLRLVLEMDGEVIERADPHIGLLHRGTEKLIEHKTYLQALPYFDRLDY
NUOD_NOVAD      -----ITNYTINFGPQHPAAHGVLRMVMELDGEIIERIDPHVGLLHRGTEKLIEHKTYLQALPYFDRLDY
NUOD_WOLPP      ----DLKTMMLNFGPQHPAAHGVLRLVLEMDGEVIERADPHIGLLHRGTEKLIEHKTYLQALPYFDRLDY
NUOD_RHORT      MAQTEIKSYTLNFGPQHPAAHGVLRLVLELSGEVIERADPHIGLLHRGTEKLIEYKTYLQALPYFDRLDY
NUOD_SPHWW      --EVEIQNYTINFGPQHPAAHGVLRMVMELDGEIVERVDPHVGLLHRGTEKLIEYKTYLQALPYFDRLDY
NDUS2_RECAM     -----LKNFTMNFGPQHPAAHGVLRLVLELNGEVVNRADPHIGLLHRGTEKLIEYKNYLQALPYFDRLDY
NUOD_SPHAL      -----VTNYTINFGPQHPAAHGVLRMVMELDGEIIERVDPHVGLLHRGTEKLIEYKTYLQALPYFDRLDY
NUOD_EHRCR      ---------TLNFGPQHPAAHGVMRLVLEMGGEVIERIDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDY
NUOD_RICBR      ---NNTKSITLNLGPQHPATHGVLRLILEMDGEVVNNADPHIGLLHRGTEKLIEHKTYLQAIPYFDRLDY
NUOD_RICB8      ---NNTKSITLNLGPQHPATHGVLRLILEMDGEVVNNADPHIGLLHRGTEKLIEHKTYLQAIPYFDRLDY
NUOD_ANAMM      -----IKPMTLNFGPQHPAAHGVMRLILEMSGEVIERIDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDY
NUOD_GRABC      -----IDSHAINFGPQHPAAHGVLRLVLELDGEVVERADPHIGLLHRGTEKLIEYKSYLQALPYFDRLDY
NUOD_RICFE      ---NNTKTITLNLGPQHPATHGVLRLILEMDGEVVNNADPHIGLLHRGTEKLIEHKTYLQAIPYFDRLDY
NUOD_ERYLH      -----ITNYTINFGPQHPAAHGVLRMIMELDGEIIERVDPHVGLLHRGTEKLIEHKTYLQALPYFDRLDY
NDUS2_NEPOL     -----VKNFTLNFGPQHPAAHGVLRLVLELNGEVVARADPHIGLLHRGTEKLIEYKTYTQALPYFDRLDY
NUOD_RICPR      ------KTITLNLGPQHPATHGVLRLILEMDGEVVNNADPHIGLLHRGTEKLIEHKTYLQAIPYFDRLDY
NUOD_RICAH      ---NNTKTITLNLGPQHPATHGVLRLILEMDGEIVNNADPHIGLLHRGTEKLIEHKTYLQAIPYFDRLDY
NUOD_RICCK      ---NNIKTITLNLGPQHPATHGVLRLILEMDGEVVNNTDPHIGLLHRGTEKLIEHKTYLQAIPYFDRLDY
NUOD_ANAPZ      ---------TINFGPQHPAAHGVMRLILEMSGEVIERIDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDY
NDUS2_PROWI     ITAPKYKNFTINFGPQHPAAHGVLRLVLEMNGEVVQRSDPHIGLLHRGTEKLIEYKNYLQALPYFDRLDY
NDUS2_RAT       LKEKVVTNVTLNFGPQHPAAHGVLRLVLELSGEMVRKCDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDY
NUOD_RICCN      ---NNTKTITLNIGPQHPATHGVLRLILEMDGEVVNNADPHIGLLHRGTEKLIEHKTYLQAIPYFDRLDY
NDUS2_MOUSE     LKEKAVTNMTLNFGPQHPAAHGVLRLVLELSGEMVRKCDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDY
NDUS2_ACACA     -----IKNFTMNFGPQHPAAHGVLRLILELDGELVRKADPHIGLLHRGTEKLIEYKTYIQALPYFDRLDY
NUOD_RICRO      ---NNTKTITLNLGPQHPATHGVLRLILEMDGEVVNNADPHIGLLHRGTEKLIEHKTYLQAIPYFDRLDY
NDUS2_BOVIN     -----VSNLTLNFGPQHPAAHGVLRLVMELSGEMVRKCDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDY
NUOD_RICTY      ------KTITLNLGPQHPATHGVLRLILEMDGEVVNNADPHIGLLHRGTEKLIEHKTYLQAIPYFDRLDY
NUOD_RICRS      ---NNTKTITLNLGPQHPATHGVLRLILEMDGEVVNNADPHIGLLHRGTEKLIEHKTYLQAIPYFDRLDY
NUOD_RICM5      ---NNTKTITLNLGPQHPATHGVLRLILEMDGEVVNNAVPHIGLLHRGTEKLIEHKTYLQAIPYFDRLDY
NDUS2_PONAB     -----VKNMTLNFGPQHPAAHGVLRLVMELSGEMVRKCDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDY
NDUS2_PANTR     -----VKNMTLNFGPQHPAAHGVLRLVMELSGEMVRKCDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDY
NDUS2_HUMAN     -----VKNITLNFGPQHPAAHGVLRLVMELSGEMVRKCDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDY
NDUS2_GORGO     -----VKNMTLNFGPQHPAAHGVLRLVMELSGEMVRKCDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDY
NUOD_ORITI      ----------LNLGPQHPATHGVLRLILEMDGEIVERADPHIGLLHRGTEKLIEYKTYLQAIPYFDRLDY
NUOD_ORITB      ----------LNLGPQHPATHGVLRLILEMDGEIVERADPHIGLLHRGTEKLIEYKTYLQAIPYFDRLDY
NUOD_NEOSM      ----------LNFGPQHPAAHGVLRLIMQLDGETVERLDPHIGFLHRGTEKLIEHKTYLQALPYFDRLDY
NDUS2_ARATH     --KRQIKNFTLNFGPQHPAAHGVLRLVLEMNGEVVERAEPHIGLLHRGTEKLIEYKTYLQALPYFDRSDY
NUOD_GLUDA      -----IDSHALNFGPQHPSAHGVLRLVLEMEGEVVARAIPHIGLLHRGTEKLIEYKTYPKALPYFDRLDY
NDUS2_PYLLI     -------HFTINFGPQHPAAHGVLRLILELNGEVVQRADPHIGLLHRGTEKLIEAKTYFQALPYFDRLDY
NUOD_AZOSB      -----IRNYTINFGPQHPSAHGVLRLVLELDGEVVERADPHIGLLHRGTEKLAETRTWVQSVPYMDRLDY
NUOD_AZOSE      -----IRNYTINFGPQHPSAHGVLRLVLELDGEVVVRADPHIGLLHRGTEKLAETRTWVQSVPYMDRLDY
NDUS2_NEUCR     -----VRHYTVNFGPQHPAAHGVLRLILELKGEEIVRADPHVGLLHRGTEKLCEYRTYLQALPYFDRLDY
NUOD_ACICJ      ---------TVNVGPQHPATHGVLRLIMELEGETVTRADPHIGLLHRGTEKLIEYKSYLQAVPYFDRLDY
NDUS2_CAFRO     LKETEIKDFTLNFGPQHPAAHGVLRLILELNGETIKNADPHIGLLHRGTEKLIENRNYLQALPYFDRLDY
NUOD_NEIG2      ---NKLRNYTINFGPQHPAAHGVLRMILELDGEQIVRADPHIGLLHRGTEKLAETKTYLQALPYMDRLDY
NUOD_NEIG1      ---NKLRNYTINFGPQHPAAHGVLRMILELDGEQIVRADPHIGLLHRGTEKLAETKTYLQALPYMDRLDY
NUOD_NEIMB      ---NKLRNYTINFGPQHPAAHGVLRMILELDGEQIVRADPHIGLLHRGTEKLAETKTYLQALPYMDRLDY
NUOD_NEIMA      ---NKLRNYTINFGPQHPAAHGVLRMILELDGEQIVRADPHIGLLHRGTEKLAETKTYLQALPYMDRLDY
NUOD_NEIMF      ---NKLRNYTINFGPQHPAAHGVLRMILELEGETIVRADPHIGLLHRGTEKLAETKTYLQALPYMDRLDY
NUOD_METFK      -----IRNYTMNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRGTEKLAENRTYLQSVPYMDRLDY
NUOD_NEIM0      ---NKLRNYTINFGPQHPAAHGVLRMILELEGETIVRADPHIGLLHRGTEKLAETKTYLQALPYMDRLDY
NUOD_MAGSM      ITDHKFQNYAINFGPQHPAAHGVLRLLLELDGEVVERADPHVGLLHRGTEKLLEQKTYIQGTPYFDRLDY
NDUS2_CAEEL     --EKNLENMILNFGPQHPAAHGVLRLVLKLEGEVIIKAIPHIGLLHRATEKLIEHKTYTQALPYFDRLDY
NUOD_ACIF5      -----INNFTMNFGPQHPSAHGVLRLVLELDGEVIERADPHIGLLHRATEKLAENKTYLQNLPYMDRLDY
NUOD_THIDA      -----IRNYTMNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAEHKTFLQALPYMDRLDY
NUOD_JANMA      -----IKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAEQKTYLQSVPYMDRLDY
NUOD_POLNA      -----IKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAESKTYIQSLPYMDRLDY
NUOD_NITMU      -----IRNYTMNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAEYKTYIQSVPYMDRLDY
NUOD_HERAR      -----IKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAEQKTYLQSVPYMDRLDY
NUOD_BORA1      -----IKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRGTEKLAEHKTFIQALPYMDRLDY
NUOD_NITEU      -----IRNYTMNFGPQHPAAHGVLRLVMELDGEVIRRADPHIGLLHRATEKLAENKTYVQSVPYMDRLDY
NUOD_CUPTR      ----DIKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAEQKTWIQSVPYMDRLDY
NUOD_BURTA      -----IKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAESKTFIQSVPYMDRLDY
NUOD_BURPS      -----IKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAENKTFIQSVPYMDRLDY
NUOD_BURP6      -----IKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAENKTFIQSVPYMDRLDY
NUOD_BURP1      -----IKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAENKTFIQSVPYMDRLDY
NUOD_BURP0      -----IKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAENKTFIQSVPYMDRLDY
NUOD_BURMS      -----IKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAENKTFIQSVPYMDRLDY
NUOD_BURMA      -----IKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAENKTFIQSVPYMDRLDY
NUOD_BURM9      -----IKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAENKTFIQSVPYMDRLDY
NUOD_BURM7      -----IKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAENKTFIQSVPYMDRLDY
NUOD_BORPE      -----IKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAEHKTFIQALPYMDRLDY
NUOD_BURP8      -----IKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAESKTFIQSVPYMDRLDY
NUOD_BURPP      -----IKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAETKTFIQSVPYMDRLDY
NUOD_DELAS      -----IKNYSLNFGPQHPAAHGVLRLVLELDGEVVQRADPHIGLLHRATEKLAESKTYIQSLPYMDRLDY
NUOD_BURXL      -----IKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAETKTFIQSVPYMDRLDY
NUOD_BORPD      -----IKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAEHKTYIQALPYMDRLDY
NUOD_BORPA      -----IKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAEHKTFIQALPYMDRLDY
NUOD_BORBR      -----IKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAEHKTFIQALPYMDRLDY
NUOD_RALME      ----DIKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAEQKTWIQSVPYMDRLDY
NUOD_NITEC      ----DIRNYTMNFGPQHPAAHGVLRLVMELDGEVIRRADPHIGLLHRATEKLAENKTYIQSVPYMDRLDY
NUOD_THICR      -----IRNYTLNFGPQHPSAHGVLRLVLELDGETIVRSDPHIGLLHRGTEKLAEYKPFNQSIGYMDRLDY
NUOD_CHRVO      -----IRNYTLNFGPQHPAAHGVLRLVLELDGEVVQRADPHIGLLHRGTEKLAESKTFIQSLPYMDRLDY
NUOD_BURCJ      -----IKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAESKTFIQSVPYMDRLDY
NUOD_BURCH      -----IKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAESKTFIQSVPYMDRLDY
NUOD_BURCA      -----IKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAESKTFIQSVPYMDRLDY
NUOD_BURS3      -----IKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAESKTFIQSVPYMDRLDY
NUOD_BURCC      -----IKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAESKTFIQSVPYMDRLDY
NUOD_BURVG      -----IKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAENKTFIQSVPYMDRLDY
NUOD_BURM1      -----IKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAENKTFIQSVPYMDRLDY
NUOD_BURCM      -----IKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAESKTFIQSVPYMDRLDY
NUOD_ACIAC      -----IKNYSLNFGPQHPAAHGVLRLVLELDGEVVQRADPHIGLLHRATEKLAEHKTFIQSLPYMDRLDY
NUOD_BURA4      -----IKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAENKTFIQSVPYMDRLDY
NUOD_POLSJ      -----IKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAESKTYIQSLPYMDRLDY
NUOD_RALEH      ----DIKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAEQKTWIQSVPYMDRLDY
NUOD_RALPJ      ----DIKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAEQKTWIQSVPYMDRLDY
NUOD_RALEJ      ----DIKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAEQKSWIQNVPYMDRLDY
NUOD_METPP      -----IKNYTLNFGPQHPAAHGVLRLILELDGEVIQRADPHIGLLHRATEKLAESKTYIQSLPYMDRLDY
NUOD_LEPCP      -----IKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRGTEKLAESKTFIQSLPYMDRLDY
NUOD_ALHEH      ------KSYTVNFGPQHPAAHGVLRMVLEMEGETVRRADPHIGLLHRATEKLAESKPYNQSIGYMDRLDY
NUOD_DECAR      ----DIRNFTLNFGPQHPAAHGVLRLVLELDGEVVQRADPHIGLLHRATEKLAETRTWVQSVPYMDRLDY
NUOD_RHOFD      -----IKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAETKTYIQALPYMDRLDY
NUOD_POLSQ      -----IKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAETRTWIQNVPYMDRLDY
NUOD_NITOC      -----IRNFTLNFGPQHPAAHGVLRLVLEMDGEIIQRADPHVGLLHRATEKLAESKPFNQSIGYMDRLDY
NUOD_VEREI      -----IKNYCLNFGPQHPAAHGVLRLVLELDGEVVQRADPHIGLLHRATEKLAEHKTYIQSLPYMDRLDY
NUOD_COXB2      -----VRNYTFNFGPQHPAAHGVLRLIVEVDGEVIQRIDPHIGLLHRATEKLAESKPYNQTIGYMDRLDY
NUOD_COXB1      -----VRNYTFNFGPQHPAAHGVLRLIVEVDGEVIQRIDPHIGLLHRATEKLAESKPYNQTIGYMDRLDY
NUOD_COXBN      -----VRNYTFNFGPQHPAAHGVLRLIVEVDGEVIQRIDPHIGLLHRATEKLAESKPYNQTIGYMDRLDY
NUOD_POLNS      -----IKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHRATEKLAKTRTWIQNIPYMDRLDY
NUOD_COXBU      -----VRNYTFNFGPQHPAAHGVLRLIVEVDGEVIQRIDPHIGLLHRATEKLAESKPYNQTIGYMDRLDY
NUOD_COXBR      -----VRNYTFNFGPQHPAAHGVLRLIVEVDGEVIQRIDPHIGLLHRATEKLAESKPYNQTIGYMDRLDY
NUOD1_STRM5     -----IRNYVMNLGPQHPAAHGVLRLVLEMDGETVVRADPHVGLLHRGTEKLAESKPFNQSIGYMDRLDY
NUOD_ACISJ      -----IKNYSLNFGPQHPAAHGVLRLVLELDGEVVQRADPHIGLLHRATEKLAEHKTYIQSLPYMDRLDY
NUOD2_STRM5     -SRQEIRNYTMNFGPQHPAAHGVLRLILEMDGETIMRADPHVGLLHRGTEKLAESKPFNQSIGYMDRLDY
NUOD_XANC5      -SKQEIRNYTMNFGPQHPAAHGVLRLILEMDGETVVRADPHIGLLHRGTEKLAESKPFNQSVPYMDRLDY
NUOD_RUTMC      -----IRNYTLNFGPQHPAAHGVLRLILEIDGEVIERADPHIGLLHRGTEKLVESKPYNQSIGYMDRLDY
NUOD_XANCP      -SKQEIRNYTMNFGPQHPAAHGVLRLILEMDGETVVRADPHIGLLHRGTEKLAESKPFNQSVPYMDRLDY
NUOD_XANCB      -SKQEIRNYTMNFGPQHPAAHGVLRLILEMDGETVVRADPHIGLLHRGTEKLAESKPFNQSVPYMDRLDY
NUOD_XANC8      -SKQEIRNYTMNFGPQHPAAHGVLRLILEMDGETVVRADPHIGLLHRGTEKLAESKPFNQSVPYMDRLDY
NUOD_STRMK      -SRQEIRNYTMNFGPQHPAAHGVLRLILEMDGETIMRADPHVGLLHRGTEKLAESKPFNQSIGYMDRLDY
NUOD_XANOR      -SKQEIRNYTMNFGPQHPAAHGVLRLILEMDGETVVRADPHIGLLHRGTEKLAESKPFNQSVPYMDRLDY
NUOD_XANOP      -SKQEIRNYTMNFGPQHPAAHGVLRLILEMDGETVVRADPHIGLLHRGTEKLAESKPFNQSVPYMDRLDY
NUOD_XANOM      -SKQEIRNYTMNFGPQHPAAHGVLRLILEMDGETVVRADPHIGLLHRGTEKLAESKPFNQSVPYMDRLDY
NUOD_XANAC      -SKQEIRNYTMNFGPQHPAAHGVLRLILEMDGETVVRADPHIGLLHRGTEKLAESKPFNQSVPYMDRLDY
NUOD_FRATN      ------KNYTLNFGPVHPAAHGVLRLILELDGENVVRADPHVGLLHRGTEKLAEFKPYNQSIGYMDRLDY
NDUS2_NICSY     MTTKNIKNFTSNFGPQHPAAHGVSRSVLEMNGEVVERAEPHIGLLQRGTEKLIEYKTYLQALPYSDRSEY
NUOD_HALHL      ------QSYTLNFGPQHPAAHGVLRLVLEMEGEAVRRADPHIGLLHRATEKLAESKPYNQSIGYMDRLDY
NUOD_FRATT      ------KNYTLNFGPVHPAAHGVLRLILELDGENVVRADPHVGLLHRGTEKLAEFKPYNQSIGYMDRLDY
NUOD_FRAT1      ------KNYTLNFGPVHPAAHGVLRLILELDGENVVRADPHVGLLHRGTEKLAEFKPYNQSIGYMDRLDY
NUOD_FRAP2      ------KNYTLNFGPVHPAAHGVLRLILELDGETVVRADPHVGLLHRGTEKLAEFKPYNQSIGYMDRLDY
NUOD_VESOH      -----IRNYTLNFGPQHPAAHGVLRLILEIDGEVIERADPHIGLLHRGTEKLVESKPYNQSIGYMDRLDY
NUOD_FRATW      ------KNYTLNFGPVHPAAHGVLRLILELDGENVVRADPHVGLLHRGTEKLAEFKPYNQSIGYMDRLDY
NUOD_FRATM      ------KNYTLNFGPVHPAAHGVLRLILELDGENVVRADPHVGLLHRGTEKLAEFKPYNQSIGYMDRLDY
NUOD_XYLFA      -SKQEIRNYTMNFGPQHPAAHGVLRLILEMDGETVVRADPHIGLLHRGTEKLAESKPFNQSIGYMDRLDY
NUOD_XYLFT      -SKQEIRNYTMNFGPQHPAAHGVLRLILEMDGETVVRADPHIGLLHRGTEKLAESKPFNQSIGYMDRLDY
NUOD_XYLF2      -SKQEIRNYTMNFGPQHPAAHGVLRLILEMDGETVVRADPHIGLLHRGTEKLAESKPFNQSIGYMDRLDY
NUOD_XYLFM      -SKQEIRNYTMNFGPQHPAAHGVLRLILEMDGETVVRADPHIGLLHRGTEKLAESKPFNQSIGYMDRLDY
NUOD_FRATO      ------KNYTLNFGPVHPAAHGVLRLILELDGENVVRADPHVGLLHRGTEKLAEFKPYNQSIGYMDRLDY
NUOD_FRATH      ------KNYTLNFGPVHPAAHGVLRLILELDGENVVRADPHVGLLHRGTEKLAEFKPYNQSIGYMDRLDY
NUOD_FRATF      ------KNYTLNFGPVHPAAHGVLRLILELDGENVVRADPHVGLLHRGTEKLAEFKPYNQSIGYMDRLDY
NUOD_LEGPL      -----LKNYTLNFGPQHPAAHXXXXXXXXXXXXTIVRADPHIGLLHRATEKLAETKPYIQSIGYMDRLDY
NUOD_LEGPH      -----LKNYTLNFGPQHPAAHXXXXXXXXXXXXTIVRADPHIGLLHRATEKLAETKPYIQSIGYMDRLDY
NUOD_LEGPC      -----LKNYTLNFGPQHPAAHXXXXXXXXXXXXTIVRADPHIGLLHRATEKLAETKPYIQSIGYMDRLDY
NUOD_LEGPA      -----LKNYTLNFGPQHPAAHXXXXXXXXXXXXTIVRADPHIGLLHRATEKLAETKPYIQSIGYMDRLDY
NDUS2_DICDI     -----MKNFTLNFGPQHPAAHGVLRLIVELESENVVRVEPHIGLLHRGTEKLIEGKTYTQALPYFDRLDY
NDUS2_DICCI     -----MKNFTLNFGPQHPAAHGVLRLIVELESENVVRVEPHIGLLHRGTEKLIEGKTYTQALPYFDRLDY
NUOD_GEOUR      ---------TINMGPQHPSTHGVLRLIVELDGEIIQKVTPHIGYLHRGIEKLSEHRTYHQTIPLTDRLDY
NUOD_GEOMG      ---------TVNMGPQHPSTHGVLRLVVELDGEIIQKITPHIGYLHRGVEKLSEHRTYHQTIPLTDRLDY
NUOD_GEOSL      ---------TVNMGPQHPSTHGVLRMVIELDGEVIQKITPHIGYLHRGVEKLSEHRTYHQTIPLTDRLDY
NUOD_GEOBB      ---------TLNMGPQHPSTHGVLRLVVELDGEVIQKITPHIGYLHRGIEKLSEHRTYHQALPLTDRMDY
NUOD_GEOLS      ---------TINMGPQHPSTHGVLRMVIELDGETILKIDPDIGYLHRGVEKLSEHRTYHQTLPLTDRLDY
NUOD2_RHIE6     ----NTREVLLNLGPQHPSTHGVLRLVLELDGEFVERVDPHIGYLHRGTEKLAESFTYTQIFPLTDRLDY
NUOD2_RHIEC     ----NTREVLLNLGPQHPSTHGVLRLVLELDGEFVERVDPHIGYLHRGTEKLAESFTYTQIFPLTDRLDY
NDUS2_PARTE     ----------VNFGPQHPAAHGVLRLILQLNGEVVEKMDIHIGLLHRGSEKLMETKPYLQSMPYFDRLDY
NUOD2_RHIME     ----NTKEVLLNLGPQHPSTHGVLRLVLQLDGEYVERVDPHIGYLHRGTEKLAESFTYTQIFPLTDRLDY
NUOD2_SINMW     ----NTKEVLLNLGPQHPSTHGVLRLVLQLDGEYVERIDPHIGYLHRGTEKLAESFTYTQIFPLTDRLDY
NUOD2_CHLAA     ----------LNMGPHHPSTHGVLRLVLELDGEVVVNVAPDVGYLHTGIEKTMESKTYQKAVVLTDRMDY
NUOD1_OPITP     ---------SLSMGPSHPSTHGVLRIQMELEGEILTKADPIIGYLHRGDEKIAENMTYNQFVPYTDRLDY
NUOD1_ROSCS     ----------LNMGPHHPSTHGVLRLVVELDGETVVDVAPDIGYLHTGIEKTMESKTYQKAVVLTDRTDY
NUOD2_ROSS1     ----------LNMGPHHPSTHGVLRLVVELDGETVVDVAPDIGFLHTGIEKTMESKTYQKAVVLTDRTDY
NUOD_AKKM8      ---------TLNVGPSHPATHGVLRLVLELDGEEIISCDPVVGHLHRGMEKIGETIQYNQFVPYTDRFDY
NUOD_METI4      ----------LNMGPSHPSTHGVFQLLLELDGEVITKAIPEVGYLHRGDEKIAENMQYNQFVPYTDRLDY
NUOD2_THEYD     --------FVLQMGPHHPATHGVLKLLCEFEGERVINIKPDVGYLHRGVEKLSESKTYPGAMTLTDRLDY
NUOD_CAMC1      --EQNDGKMILNFGPQHPSAHGQLKLVLELDGEKVVRAMPEVGFMHRGVEKMAENMTYQEFIPVTDRVDY
NUOD2_ACIBL     ------KTMVLNMGPQHPSTHGVLRLLLEIDGETIVRIMPDIGYLHTGIEKTCEAKFYQQVVPMTDRIDY
NUOD_SACEN      ----------INFGPQHPSAHGVLRLVFELEGETIVKARSVIGYLHTGIEKNVEYRTWTQGVTFVTRMDY
NUOD_FRASN      --EDDGERITVNMGPQHPSTHGVLRLVLEIEGETVTETRLVIGYLHTGIEKSCEYRTWTQAVTFLTRADY
NQO4_THET2      ---------TLNVGPQHPSTHGVLRLMVTLSGEEVLEVVPHIGYLHTGFEKTMEHRTYLQNITYTPRMDY
NUOD_SULNB      --ERDDNTMVINFGPQHPSAHGQLRLVLELEGEQVVKAYPDIGYLHRGIEKMAENMTYNEFLPTTDRLDY
NQO4_THET8      ---------TLNVGPQHPSTHGVLRLMVTLSGEEVLEVVPHIGYLHTGFEKTMEHRTYLQNITYTPRMDY
NUOD_WOLSU      --ERHDNQMVINFGPQHPSAHGQLRLILELEGEKVTRAVPDVGYLHRGMEKMGENMIYNEFIPTTDRMDY
NUOD_DEIGD      ---------SLNVGPQHPSTHGVLRLVVDMDGEYVTRVTPHMGYLHTGFEKTFEHRTYHQGVTYAPRTDY
NUOD1_HERA2     --ENGEQSMVLSMGPQHPSTHGVLRLAVELNGENVVQLAPDVGFLHXXXXXXXXXXXXXXXXVLTDRMDY
NUOD_CAMC5      --ERNDGKMILNFGPQHPSAHGQLKLVLELDGEKVVRAMPEVGFMHRGIEKMAENMTYQEFIPVTDRVDY
NUOD2_SOLUE     ----------LNMGPQHPSTHGVLRVILKLDGEKVLGTDCIIGYLHRGVEKIAENRTYAQFNPYVDRMDY
NUOD_MYCA9      ----------VNMGPQHPSTHGVLRLILEIEGETVTDVRCGIGYLHTGIEKNLEYRTWTQGVTFVTRMDY
NUOD_NOCFA      ----------VNMGPQHPSTHGVLRLILEIEGETVVEARCGIGYLHTGIEKNLEYRTWMQGVTFVTRMDY
NUOD1_SOLUE     ------RRMVLNMGPQHPSTHGVLRLLMELDGENIMKCVPDIGFLHTGIEKEFEEKFYQQAVTLTDRVDY
NUOD_MYCPA      ----------VNMGPQHPSTHGVLRLILEIEGETVTEARCGIGYLHTGIEKNLEYRYWTQGVTFVTRMDY
NUOD_MYCA1      ----------VNMGPQHPSTHGVLRLILEIEGETVTEARCGIGYLHTGIEKNLEYRYWTQGVTFVTRMDY
NUOD_HELPY      --EHDDNQMILNFGPQHPSSHGQLRLILELEGEKIIKATPEIGYLHRGCEKLGENMTYNEYMPTTDRLDY
NUOD_HELPS      --EHDDNQMILNFGPQHPSSHGQLRLILELEGEKIIKATPEIGYLHRGCEKLGENMTYNEYMPTTDRLDY
NUOD_FRAAA      --EQDAERIVVNMGPQHPSTHGVLRLVLEIDGETVTETRLVIGYLHTGIEKSCEYRTWTQAVTFLTRADY
NUOD1_ACIBL     ----------LNMGPQHPSTHGVLRVILKLDGERVLGTECVIGYLHRGVEKIAENRTYVQFNPYVDRMDY
NUOD_HELPJ      --EHDDNQMILNFGPQHPSSHGQLRLILELEGEKIIKATPEIGYLHRGCEKLGENMTYNEYMPTTDRLDY
NUOD_HELPH      --EHDDNQMILNFGPQHPSSHGQLRLILELEGEKIIKATPEIGYLHRGCEKLGENMTYNEYMPTTDRLDY
NUOD_HELP2      --EHDDNQMILNFGPQHPSSHGQLRLILELEGEKIIKATPEIGYLHRGCEKLGENMTYNEYMPTTDRLDY
NUOD_HELPG      --EHDDNQMILNFGPQHPSSHGQLRLILELEGEKIIKATPEIGYLHRGCEKLGENMTYNEYMPTTDRLDY
NUOD1_CHLT3     ------QTMVLNMGPQHPATHGVLRVVLKLDGERVVHAVPELGYLHRAMEKLAENKSYHEFMPYTDRLDY
NUOD_MYCTU      ----------VNMGPQHPSTHGVLRLILEIEGETVVEARCGIGYLHTGIEKNLEYRYWTQGVTFVTRMDY
NUOD_MYCTA      ----------VNMGPQHPSTHGVLRLILEIEGETVVEARCGIGYLHTGIEKNLEYRYWTQGVTFVTRMDY
NUOD_MYCBP      ----------VNMGPQHPSTHGVLRLILEIEGETVVEARCGIGYLHTGIEKNLEYRYWTQGVTFVTRMDY
NUOD_MYCBO      ----------VNMGPQHPSTHGVLRLILEIEGETVVEARCGIGYLHTGIEKNLEYRYWTQGVTFVTRMDY
NUOD_MYCMM      ----------VNMGPQHPSTHGVLRLILEIEGETVTEARCGIGYLHTGIEKNLEYRYWTQGVTFVTRMDY
NUOD_FRASC      --EENER-IVVNMGPQHPSTHGVLRLVLEIEGETVTETRLVIGYLHTGIEKSCEYRTWTQAVTFLTRADY
NUOD_SALRD      ----------LNIGPQHPATHGVLRCVVKMDGETIEKSVLDIGYLHRGIEKLAEHKTYQEFMPYTDRMDY
NUOD_HELHP      ----------LNFGPQHPSAHGQLRLILELENEKIIKATPDIGYLHRGIEKMAENMIYNEFMPTTDRLDY
NUOD2_ROSCS     ----------INIGPQHPSTHGVFRMIVTVDGETIIDLKPVFGYLHRNHEQLAEVSTYIQSMPYTDRLDY
NUOD1_STRAW     ----------VNMGPQHPSTHGVLRLILEIDGETVTEARCGIGYLHTGIEKNLEYRTWTQGTTFVTRMDY
NUOD_NITSB      --ERDDNKMVVNFGPQHPSAHGQLRLILEMDGEQITKAVPDIGYLHRGMEKMGENMIYNEFLPTTDRMDY
NUOD_MYCGI      --EHAGERIVVNMGPQHPSTHGVLRLILEIEGETIVEARCGIGYLHTGIEKNLEFRTWTQGVTFVTRMDY
NUOD_MYXXD      ------KRMVINMGPSHPATHGTVRLKVELEGETIVKIDPEIGFLHRGFQKSCENVTWTQCLPYTDRLNY
NUOD_CAMHC      -------NMILNFGPQHPSAHGQLKLVLEVDGEKIIKARPGIGYMHRGVEKMAENMIYQEFVPVTDRVDY
NUOD1_ROSS1     ----------INIGPQHPSTHGVFRMIVTVDGETIVDLKPVFGYLHRNHEQLAEVSTYIQSMPYTDRLDY
NUOD_CAMJR      ----------INLGPQHPSAHGNLRLILELDGEQVVKARPCIGYMHRGMEKMAENMIYQEFIPTTDRMDY
NUOD_CAMJJ      ----------INLGPQHPSAHGNLRLILELDGEQVVKARPCIGYMHRGMEKMAENMIYQEFIPTTDRMDY
NUOD_CAMJE      ----------INLGPQHPSAHGNLRLILELDGEQVVKARPCIGYMHRGMEKMAENMIYQEFIPTTDRMDY
NUOD_DEIRA      ---------SLNVGPQHPSTHGVLRLVVDMDGEYVTRVEPHMGYLHTGFEKTMEHRTYQQNVTYAPRTDY
NUOD_CAMJD      ----------INLGPQHPSAHGNLRLILELDGEQVVKARPCIGYMHRGMEKMAENMIYQEFIPTTDRMDY
NUOD_CAMJ8      ----------INLGPQHPSAHGNLRLILELDGEQVVKARPCIGYMHRGMEKMAENMIYQEFIPTTDRMDY
NUOD_SULDN      ----------LNFGPQHPSAHGQLRLMLHLQQEMIVKAHPDIGYLHRGMEKMAENMIYNEFMPTTDRMDY
NUOD2_STRCO     ----------VNMGPQHPSTHGVLRLILEIDGETVTEARCGIGYLHTGIEKNLEYRTWTQGTTFVTRMDY
NUOD1_CHLAA     ----------VNIGPQHPSTHGVFRMLVTVDGETVVDLKPVFGYLHRNHEQIAEANSYLQNMPYTDRLDY
NUOD1_STRGG     ----------VNMGPQHPSTHGVLRLILEIDGETVTEARCGIGYLHTGIEKNLEFRNWTQGTTFVTRMDY
NUOD2_SYMTH     MNVERTQELLVNMGPQHPSTHGVLRLMIKLDGEQVTWCEPDIGYLHRCFEKLAEQKTYPQVIPFTDRTDY
NUOD_RHOSR      ----------VNMGPQHPSTHGVLRLILEIEGETVTEARCGIGYLHTGIEKNLEYRTWTQGVTFVTRMDY
NUOD1_ANADE     ------KHMVINLGPSHPAMHGVTRAVVELNGEIIEEMKLDIGFLHRGFEKSCENVTWGQVFPYTDRLNY
NUOD2_ANASK     ------KHMVINLGPSHPAMHGVTRAVVELNGEIIEGMKLDIGFLHRGFEKSCENVTWGQVFPYTDRLNY
NUOD_MYCUA      ----------VNMGPQHPSTHGVLRLILEIEGETVTEARCGIGYLHTGIEKNLEYRYWTQGVTFVTRMDY
NUOCD_BDEBA     ----NDKYLPLNIGPSHTAMHGTLRVMAEMDGETIVRCNNEIGYLHRCFEKMAETHPYNQVIPYTDRLNY
NUOCD_ACICJ     ----------LNLGPNHPSVHGVFRIILQLEGEEIVDAVPEIGFHHRGAEKMAERQSWHTYIPYTDRIDY
NDHH_CHAGL      ----------VSMGPHHPSMHGVLRLVVSLDGENVIDCDPVLGYLHRGMEKIAENRSIVQYLPYVTRWDY
NUOD1_THEYD     -----VKELTVNMGPQHPATHXXXXXXXXXXXXXIKKCIPYIGYLHRGVEKLSEDLTYVQSLPITDRMDY
NUBCD_GEOMG     ----------INLGPQHPGTHGIIRFILKLDGEEIVDMDTDIGYHHRGAEKIGERQHWNQFIPYTDRIDY
NUOD_PELPD      ----------VNMGPSHPATHGTIQIIAALDGERVAKADIHCGYLHRGFEKESEHHTYHKIIPFTDRLNY
NUOCD_GLUDA     ----------LNLGPNHPSVHGVFRIVLQLEGERIVDAVPDIGFHHRGAEKMGERQSWHSFIPYTDRVDY
NUBCD_GEOUR     ----------LNLGPQHPGTHGIIRFILKLKGEEIVDMDTDIGFHHRGAEKMGERQHWNQFIPYTDRIDY
NUOD_HELMI      ------QTYELNFGPQHPSTHGVLRIVLELDGEVVVKATPVIGYLHRGIEKICENRTYIQTVPFTDRMDY
NUOD_ACIC1      ----------VNMGPQHPSTHXXXXXXXXXXXXXXXQARVVVGYLHTGIEKNCEYRTYTQAVTFLTRADY
NUOD_NOCSJ      ----------VNMGPQHPSTHGVLRLILELEGETVTEARAGIGYLHTGIEKNMEYRTWTQGVTFCTRMDY
NUBCD_GEOSL     ----------LNLGPQHPGTHGIIRFVLKLDGEEIVDMDTDIGYHHRGAEKIGERQHWNQFIPYTDRIDY
NDHH_ANASP      --ETRTEPMVLNMGPHHPSMHGVLRLIVTLDGEDVVDCEPVIGYLHRGMEKIAENRTTVMYVPYVSRWDY
NUOD_THEFY      ----------INMGPQHPSTHGVLRLILTLDGETVTEARVGIGYLHTGIEKNMEYRTWTQGTTFVTRMDY
NUBCD_SYNFM     ----------LNIGPSHVSTHGLLRYVVSLDGEEISDLELEIGYHHRGVEKIGERQTWHQFIPYCARVDY
NUBCD_PELCD     ----------LNLGPQHPGTHGILRVILQLAGEEIVDLDSEIGYHHRGAEKIAERQHWNQYIPYTDRIDY
NDHH_NOSP7      --ETRTEPMVLNMGPHHPSMHGVLRLIMTLDGEDVVDCEPVIGYLHRGMEKIAENRTNVMYVPYVSRWDY
NDHH_SYNJA      MIETRTDRMLLNFGPHHPSMHGVLRLLVTLDGENIVDCEPVIGYLHRGMEKIAENRTVVQYLPYVSRWDY
NUOD_CARHZ      ------QEISINVGPQHPSTHGVFRIILKLDGETIVDAEPVVGYLHRGIEKLAEDRTYTQVIPYTDRMDY
NUOD_DEHE1      -------SFILNIGPQHPSTHGVFRLRLILDGEVITDLEPVFGYLHRGIEKLAEGRTYLQDIPFTDRLDY
NUOD2_HERA2     ----------INIGPQHPSTHGVFRMLVTVDGETLVDLKPVFGYLHRNHEQLGEVNTYLQNMPFTDRLDY
NDHH_CHLAT      MLETKTDPMVISMGPHHPSMHGVLRLIVTLDGENVIDCEPVLGYLHRGMEKIAENRTIVQYLPYVTRWDY
NUOD_DEHSB      -------NFILNIGPQHPSTHGVFRLRIVLDGEVITDLEPVFGYLHRGIEKLAEGRTYLQDIPFTDRLDY
NDHH_SYNJB      MIETRTDRMLLNFGPHHPSMHGVLRLLVTLDGENIVDCEPVIGYLHRGMEKIAENRTVVQYLPYVSRWDY
NUOD2_ANADF     ---------TVNLGPSHPAMHGVTRAVVELDGEMIRSMKLDIGFLHRGFEKSCENVTWTQCFPYTDRLNY
NUOD_PROAC      --ERGDETVVVNFGPSHPSTHGVMRLIIELDGESVSDLRVGIGFLHTGIEKNMEFRTWTQGVTFMTRCNY
NUOD1_SALAI     ----NDERIVVNMGPQHPSTHXXXXXXXXXXXXXXXXARSVVGYLHTGIEKNLEFRNWVQGSTFVTRMDY
NUOD1_SALTO     ----NDERIVVNMGPQHPSTHXXXXXXXXXXXXXXXXXXSVVGYLHTGIEKNMEFRNWVQGAAFVTRMDY
NDHH_ANAVT      --ETRTEPMVLNMGPHHPSMHGVLRLIVTLDGEDVVDCEPVIGYLHRGMEKIAENRTTVMYVPYVSRWDY
NUOD_DEHSC      -------NFILNIGPQHPSTHGVFRLRIVLDGEVITDLEPVFGYLHRGIEKLAEGRTYLQDIPFTDRLDY
NUOCD_NITOC     ----------LNLGPNHPSVHGVFRIVLQLDGEEIVDAVPDIGYHHRGAEKMGERQSWHTYIPYTDRIDY
NUOCD_NITMU     ----------LNLGPNHPSVHGVFRIVLQLDGEEIIDAVPEIGFHHRGAEKMGERQSWHTYIPYTDRIDY
NDHH_THEEB      --ETRTEPMVINMGPHHPSMHGVLRLMVTLDGEDVIDCEPVIGYLHRGMEKIAENRTNIMFIPYVSRWDY
NUOD1_SYMTH     LEEQRPERMTLSIGPHHPATHGVLRVKLELEGETVVKAEPETGFLHTGIEKTAEHLTWNQATTVMDRMDY
NUOD_PELLD      ----------LSMGPQHPSTHGVLRLECRTDGEVVTEAEPYLGYLHRCFEKYCENVDYPAIVPYTDRMDY
NDHH_ACAM1      --ETRTEPMVINMGPQHPSMHGVLRLMVTLDGENVVDCEPVIGYLHRGMEKIAESRSNIMFVPYVSRWDY
NUOD_PARUW      ----------LNLGPQHPSTHGVLRLKLRLEGEVVLSCDPVIGYLHTGVEKECESRTYHQVFTLVDRLDY
NUOD_MYCSS      ----------VNMGPQHPSTHGVLRXXXXXXXXXXXXARCGIGYLHTGIEKNLEYRNWTQGVTFVTRMDY
NUOD_MYCSK      ----------VNMGPQHPSTHGVLRXXXXXXXXXXXXARCGIGYLHTGIEKNLEYRNWTQGVTFVTRMDY
NUOD_MYCSJ      ----------VNMGPQHPSTHGVLRXXXXXXXXXXXXARCGIGYLHTGIEKNLEYRNWTQGVTFVTRMDY
NUOD_HELAH      --EHDDNQMVLNFGPQHPSSHGQXXXXXXXXXXXXXKATPEIGYLHRGCEKLGENMTYNEYMPTTDRLDY
NUOCD_HYDS0     ----------LNWGPLHPGTHGTMWFLFDLEGERIVQTDVILGQLHRGVEKLAEHEPYQQFLVYTDRMDY
NUCD2_AQUAE     ----------LNWGPLHPGTHGTIWFLFDLEGEKVVQSDVILGQLHRGMEKLAENLHYFQFIPYTDRMDY
NUCD1_AQUAE     ----------LNWGPLHPGTHGTMWFLFDLEGERIVQTDVILGQLHRGVEKLAEHEMYNQFLVYTDRMDY
NDHH_PAUCH      ----------INFGPHHPSMHGVLRLVVTLDGEDVVDCEPVIGYLHRGMEKIAESRTAITFVPYVSRWDY
NUOD_PELPB      -------------GPQHPSTHGVLKLECLTDGEVITEAEPYLGYLHRCFEKSCEHVDYPAIVPYTDRLDY
NDHH1_GLOVI     MLETRAERMVINLGPHHPSMHGVLRLIVTLDGENVVDCVPVLGYLHRSMEKIAESRTIIQYLPYVTRWDY
NUOD_DESRM      --------FLLNLGPQHPSTHGVFRIVLTLDGETVVKAVPVPGYLHRGIEKLLESRTYTQVIPYTDRLDY
NUOD_BACAH      ----------LNVGPQHPSTHGVFRLVIKIDGEIIKEATPVIGYLHRGTEKIAESLQYTQIIPYTDRMDY
NUOD2_CHLT3     ----------VNMGPQHPSTHGVLRVELLTDGEVVVKATAHLGYLHRCFEKHAEYVDYPGIVPYVDRMDY
NUOCD_RHOP5     ----------LNYGPHSMATHGVFRVVLALDGEEIVAARPDIGFHHRGAEKMGERQSWHQFIPYTDRIDY
NUOD_BACAN      ----------LNVGPQHPSTHGVFRLVIKIDGEIIKEATPVIGYLHRGTEKIAESLQYTQIIPYTDRMDY
NUOCD_RHOS4     ----------LNFGPHHPSTHGVLRILLGLDGEEVVWAWPDIGYHHRGAEKMAERQTWHGFIPYCDRIDY
NUOD_BACCR      ----------LNVGPQHPSTHGVFRLVIKIDGEIIKEATPVIGYLHRGTEKIAESLQYTQIIPYTDRMDY
NUOD_BACC1      ----------LNVGPQHPSTHGVFRLVIKIDGEIIKEATPVIGYLHRGTEKIAESLQYTQIIPYTDRMDY
NDHH_MARPO      ----------VSMGPHHPSMHGVLRLIVTLDGEDVLDCEPVLGYLHRGMEKIAENRTIVQYLPYVTRWDY
NUOD_CHLTE      -TEHMV----LSMGPQHPSTHGVLRLECITDGEVVVEAEPYLGYLHRCFEKHCEKIDYPAIVPYTDRMDY
NUOCD_METCA     ----------LNLGPNHPSVHGVFRVALQLDGEEIVDAVPDIGYHHRGAEKMGERQSWHSYIPYTDRIDY
NDHH_EUCGG      ----------VNMGPHHPSMHGVLRLILTLDGEDVIDCEPILGYLHRGMEKIAENRTVIQYLPYVTRWDY
NUOD1_SORC5     ----------LNMGPSHPAMHGTVRIVLELSGETINKADVQIGYLHRGFEKMCERGTWSQVFPYVDRLNY
NUOCD_RHOSK     ----------LNFGPHHPSTHGVFRILLGLDGEEVVWAWPDIGYHHRGAEKMAERQTWHGFIPYCDRIDY
NDHH_TRIEI      ----------INMGPHHPSMHGVLRLIVTLDGEDVIDCEPVIGYLHRGMEKIAENRTNTMFVPYVSRWDY
NUOD_CHLL2      ----------LSMGPQHPSTHGVLKLECMTDGEVVTSAEPYLGYLHRCFEKHCEVVDYPGIVPYTDRMDY
NUOD_BACWK      ----------LNVGPQHPSTHGVFRLVIKIDGEIIKEATPVIGYLHRGTEKIAESLQYTQIIPYTDRMDY
NUOD_BACCZ      ----------LNVGPQHPSTHGVFRLVIKIDGEIIKEATPVIGYLHRGTEKIAESLQYTQIIPYTDRMDY
NDHH_MESVI      ----------ISMGPHHPSMHGVLRLIVTLDGENVIDCEPVLGYLHRAMEKIAENRTIVQYLPYVTRWDY
NDHH_SYNSC      --ETRTEPMVVNFGPHHPSMHGVLRLVVTLDGEDVVDCEPVIGYLHRGMEKIAENRTNVMFVPYVSRMDY
NDHH_CHAVU      MLIRKTNSMIVSMGPHHPSMHGVLRLIITLDGENVIDCEPVLGYLHRGMEKIAENRTIIQYLPYVTRWDY
NUOD_MYCVP      --EHAGERIVVNMGPQHPSTHXXXXXXXXXXXXXXXXARCGIGYLHTGIEKNLEFRNWTQGVTFVTRMDY
NUOD_BACHK      ----------LNVGPQHPSTHGVFRLVIKIDGEIIKEATPVIGYLHRGTEKIAESLQYTQIIPYTDRMDY
NDHH_SYNS9      --ETRTEPMVVNFGPHHPSMHGVLRLVVTLDGEDVVDCEPVIGYLHRGMEKIAENRTNVMFVPYVSRMDY
NDHH_SYNPX      --ETRTEPMVVNFGPHHPSMHGVLRLVVTLDGEDVVDCEPVIGYLHRGMEKIAENRTNVMFVPYVSRMDY
NUOD_CHLP8      -TEHMV----LSMGPQHPSTHGVLRLECITDGEVIVEAEPYLGYLHRCFEKHCENVDYPGIVPYTDRMDY
NUOCD_RHOS1     ----------LNFGPHHPSTHGVFRILLGLDGEEVVWAWPDIGYHHRGAEKMAERQTWHGFIPYCDRIDY
NUOCD_RHOPS     ----------LNYGPHSMATHGVFRIVLALDGEEIVAARPDIGFHHRGAEKMAERQTWHSFLPYTDRVDY
NDHH_POPTR      ----------VNMGPHHPSMHGVLRLILSLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NDHH_POPAL      ----------VNMGPHHPSMHGVLRLILSLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NUOD_CHLCH      -------------GPQHPSTHGVLKLECLTDGEVVTEAEPVLGYLHRCFEKTAENVDYPAVVPFTDRLDY
NDHH_AGRST      ----------VNMGPQHPSMHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NUOD_BACCN      ----------LNVGPQHPSTHGVFRLIIKIDGETIKEATPVIGYLHRGTEKIAESLQYTQIIPYTDRMDY
NDHH_ANTFO      ---------TLSMGPHHPSMHGVLRLIVTLDGENVTDCEPILGYLHRGMEKIAENRTIVQYLPYVTRWDY
NDHH_ANGEV      ----------VSMGPQHPSMHGVLRLIVTSDGENVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NDHH_SYNS3      --ETRTEPMVVNFGPHHPSMHGVLRLVVTLDGEDVVDCEPVIGYLHRGMEKIAENRTNVMYVPYVSRMDY
NUOD_PROVI      ----STEQMVLSMGPQHPSTHGVLRLECLTDGEVVTEAEPYLGYLHRCFEKHCEHVDYPAIVPYTDRMDY
NUOD_GEOKA      ----------LNVGPQHPSTHGVFRLILKIDGEIIQEATPVIGYLHRGTEKIAEGLQYTQIIPYTDRMDY
NDHH_SYNPW      --ETRTEPMVVNFGPHHPSMHGVLRLVVTLDGEDVVDCEPVIGYLHRGMEKIAENRTNVMFVPYVSRMDY
NDHH_STAPU      ----------VSMGPHHPSMHGVLRLIVTLDGENVIDCEPILGYLHRGMEKIAENRTTLQYLPYVTRWDY
NUOD_GEOTN      ----------LNVGPQHPSTHGVFRLILKIDGEIIQEATPVIGYLHRGTEKIAEGLQYTQIIPYTDRMDY
NUOD_CLOB8      --ELHTEEMTLNFGPQHPSTHGVYRAIFTLDGEHIVNVENIIGYLHRGMEKLAESRTYTQFIPYTDRLDY
NUOCD_SHEWM     ----------LNLGPNHPSVHGVFRIALQLDGEHIINSVPDIGYHHRGAEKIAERQTWHGFIPYTDRIDY
NDHH_ZYGCR      ----------VSMGPHHPSMHGVLRLIVTLDGENVADCEPVLGYLHRGMEKIAESRTTLQYLPYVTRWDY
NUOD_MYCS2      ----------VNMGPQHPSTHGVXXXXXXXXXXXXXXARCGIGYLHTGIEKNLEYRNWTQGVTFVTRMDY
NDHH_SYNP6      LLETRTEPMVLNMGPHHPSMHGVLRLIVTLDGENVIDCEPVIGYLHRGMEKIAENRSNVMFVPYVSRWDY
NDHH_SYNE7      LLETRTEPMVLNMGPHHPSMHGVLRLIVTLDGENVIDCEPVIGYLHRGMEKIAENRSNVMFVPYVSRWDY
NDHH_PROMP      --ETRTEPMVVNFGPHHPSMHGVLRLVVTLDGENVIDCEPVIGYLHRGMEKIAENRTNVMYVPYVSRMDY
NDHH_ACOCL      ----------VNMGPHHPSMHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NDHH_ACOAM      ----------VNMGPHHPSMHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NUOCD_RHOS5     ----------LNFGPHHPSTHGVFRILLGLDGEEVVWAWPDIGYHHRGVEKMAERQTWHGFIPYCDRVDY
NDHH_PROMT      --ETRTEPMVVNFGPHHPSMHGVLRLVVTLDGEDVVDCEPVIGYLHRGMEKIAENRTNVMFVPYVSRMDY
NDHH_PROM1      --ETRTEPMVVNFGPHHPSMHGVLRLVVTLDGEDVVDCEPVIGYLHRGMEKIAENRTNVMFVPYVSRMDY
NDHH_NANDO      ----------VNMGPQHPSMHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NDHH_MANES      ----------VNMGPHHPSMHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NUOD2_SORC5     ---------TLNMGPHHPSTHGVLRFVISTDGEIIRKAVPDVGYLHRSIEKIGERCTYSGFMPYTDRVDY
NUOCD_EDWI9     ----------LNLGPNHPSSHGAFRIVLQLDGEDIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUBCD_GEOBB     ----------LNLGPQHPGTHGVIRFVLKLSGEEIVDMDSDIGYHHRAAEKTGERQNWHQYIPYTDRVDY
NUOCD_SULSY     ----------LNWGPLHPGTHGTIWFLFDLDGEYVKQCDIIIGQLHRGVEKLGENVNWQQFIPYTDRMDY
NUOCD_PHOLL     ----------LNLGPNHPSSHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEY
NDHH2_GLOVI     --ETRADQMVLNLGPHHPSTHGVLRLIVTLDGENVVDCRPVLGYLHRGMEKIGENRTIIQYLPYCSRWDY
NUOCD_PROMH     ----------LNLGPNHPSSHGAFRIILQLDGEEIVNCVPDVGYHHRGAEKMGERQSWHSYIPYTDRIEY
NDHH_NEPOL      MIEAKTDPMIVSMGPHHPSMHGVLRLIVTLDGENVLDCEPVVGYLHRGMEKIAENRTIVQYLPYVTRWDY
NDHH_WHEAT      ----------VNMGPQHPSMHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NDHH_MICAN      --ETRTEPMVLNMGPHHPSMHGVLRLIVTLDGEDVIDCEPVIGYLHRGMEKIAENRTNVMYVPYVSRWDY
NUOD_PROA2      ----------LNMGPQHPSTHGVLRLECKTDGEVVTEAEPYLGYLHRCFEKHAEVVDYPGIVPFVDRMDY
NDHH_SYNR3      --ETRTEPMVLNFGPHHPSMHGVLRLVVTLDGEDVVDCEPVIGYLHRGMEKIAENRTNVMFVPYVSRWDY
NDHH_SACOF      ----------VNMGPQHPSMHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRSIIQYLPYVTRWDY
NDHH_SACHY      ----------VNMGPQHPSMHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRSIIQYLPYVTRWDY
NUOCD_RHOPA     ----------LNYGPHSMATHGVFRIVLALDGEEIVAARPDIGFHHRGAEKMAERQTWHNFLPYTDRVDY
NUOCD_RHOP2     ----------LNYGPHSMATHGVFRIVLALDGEEIVAARPDIGFHHRGAEKMAERQTWHNFLPYTDRVDY
NUOCD_RHOPT     ----------LNYGPHSMATHGVFRIVLALDGEEIVAARPDIGFHHRGAEKMAERQTWHNFLPYTDRVDY
NDHH_SORBI      ----------VNMGPQHPSMHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRSIIQYLPYVTRWDY
NDHH_ORYSJ      ----------VNMGPQHPSMHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NDHH_ORYSI      ----------VNMGPQHPSMHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NDHH_ORYSA      ----------VNMGPQHPSMHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NDHH_ORYNI      ----------VNMGPQHPSMHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NDHH_LEMMI      ----------VNMGPQHPSMHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIVQYLPYVTRWDY
NDHH_HORVU      ----------VNMGPQHPSMHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NUOD_MOOTA      ----------LNMGPQHPSTHGVYRALLTLDGEKVVGVENIIGYLHRGIEKLAEDRTYTQVIPYTDRLDY
NUOCD_PSEMY     ----------LNLGPNHPSAHGAFRIILQLDGEEIVDCVPEIGYHHRGAEKMAERQSWHSFIPYTDRIDY
NDHH_NYMAL      ----------VNMGPHHPSMHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NDHH_NUPAD      ----------VNMGPHHPSMHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NUOCD_YERE8     ----------LNLGPNHPSSHGAFRIVLQLDGEEIVDCVPDVGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_PSEPW     ----------LNLGPNHPSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMAERQSWHSFIPYTDRIDY
NUOCD_PSEPF     ----------LNLGPNHPSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMAERQSWHSFIPYTDRIDY
NUOCD_PSEE4     ----------LNLGPNHPSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMAERQSWHSFIPYTDRIDY
NDHH_PROMM      --ETRTEPMVVNFGPHHPSMHGVLRLVVTLDGEDVVDCEPVIGYLHRGMEKIAENRTSVMFVPYVSRMDY
NDHH_PROM5      --ETRTEPMVVNFGPHHPSMHGVLRLVVTLDGENVIDCEPVIGYLHRGMEKIAENRTNVMYVPYVSRMDY
NUOCD_PSEPK     ----------LNLGPNHPSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMAERQSWHSFIPYTDRIDY
NUOCD_PSEPG     ----------LNLGPNHPSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMAERQSWHSFIPYTDRIDY
NUOCD_PSEP1     ----------LNLGPNHPSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMAERQSWHSFIPYTDRIDY
NUOCD_PSE14     ----------LNLGPNHPSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMAERQSWHSFIPYTDRIDY
NDHH_SOYBN      ----------VNMGPHHPSMHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NDHH_MAIZE      ----------VNMGPQHPSMHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRSIIQYLPYVTRWDY
NDHH_CUCSA      ----------VNMGPHHPSMHGVLRLILTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NUOCD_RHOPB     ----------LNYGPHSMATHGVFRIVLALDGEEIVAARPDIGFHHRGAEKMGERQSWHQYIPYTDRIDY
NUOCD_PSEU2     ----------LNLGPNHPSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMAERQSWHSFIPYTDRIDY
NUOCD_PSEFS     ----------LNLGPNHPSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMAERQSWHSFIPYTDRIDY
NUOD1_CYTH3     ----------INMGPQHPSTHGVLRLEILTDGEIVKDVIPHMGYLHRCYEKHAEKLPYNQVIPFVDRMDY
NDHH_VITVI      ----------VNMGPHHPSMHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NDHH_DRANE      ----------VNMGPHHPSMHGVLRLIVTLDGEDVVDCEPILGYLHRGMEKIAENRAIIQYLPYVTRWDY
NUOD_CHLPD      -------------GPQHPSTHGVLKLECFTDGEVVTHAEPYLGYLHRCFEKHCEVVDYPGIVPYTDRMDY
NUOCD_YERPY     ----------LNLGPNHPSSHGAFRIVLQLDGEEIIDCVPDVGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_YERPS     ----------LNLGPNHPSSHGAFRIVLQLDGEEIIDCVPDVGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_YERPP     ----------LNLGPNHPSSHGAFRIVLQLDGEEIIDCVPDVGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_YERPN     ----------LNLGPNHPSSHGAFRIVLQLDGEEIIDCVPDVGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_YERPG     ----------LNLGPNHPSSHGAFRIVLQLDGEEIIDCVPDVGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_YERPE     ----------LNLGPNHPSSHGAFRIVLQLDGEEIIDCVPDVGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_YERPB     ----------LNLGPNHPSSHGAFRIVLQLDGEEIIDCVPDVGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_YERPA     ----------LNLGPNHPSSHGAFRIVLQLDGEEIIDCVPDVGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_YERP3     ----------LNLGPNHPSSHGAFRIVLQLDGEEIIDCVPDVGYHHRGAEKMGERQSWHSYIPYTDRIEY
NDHH_FESAR      ----------VNMGPQHPSMHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NDHH_AMBTC      MTVPATRNMIVNMGPHHPSMHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NUOCD_PSEF5     ----------LNLGPNHPSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMAERQSWHSFIPYTDRIDY
NUOCD_PSEAE     ----------LNLGPNHPSAHGAFRIILQLDGEEIIDCVPEIGYHHRGAEKMAERQSWHSFIPYTDRIDY
NUOCD_PSEAB     ----------LNLGPNHPSAHGAFRIILQLDGEEIIDCVPEIGYHHRGAEKMAERQSWHSFIPYTDRIDY
NUOCD_PSEA7     ----------LNLGPNHPSAHGAFRIILQLDGEEIIDCVPEIGYHHRGAEKMAERQSWHSFIPYTDRIDY
NUOCD_AZOVD     ----------LNLGPNHPSAHGAFRIILQLDGEEIVDCVPEIGYHHRGAEKMAERQSWHSFIPYTDRIDY
NDHH_PROMA      --ETRTEPMVVNFGPHHPSMHGVLRLVVTLDGEDVIDCEPVIGYLHRGMEKIAENRTNVMFVPYVSRMDY
NDHH_PROM3      --ETRTEPMVVNFGPHHPSMHGVLRLVVTLDGEDVVDCEPVIGYLHRGMEKIAENRTSVMFVPYVSRMDY
NDHH_LOLPR      ----------VNMGPQHPSMHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NDHH_CICAR      ----------VNMGPQHPSMHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NUOD1_ANADF     --DRNNEEMVLNFGPQHPSTHGVINFIVETDGEVMKRAIPDVGYLHRSIEKIGEVTGYPGFMPFTDRIDY
NDHH_SYNY3      --ETRTEPMVLNMGPHHPSMHGVLRLIVTLDGEDVVDCEPVIGYLHRGMEKIAESRTNIMYVPYVSRWDY
NDHH_JASNU      ----------INMGPHHPSMHGVLRLIITLDGEDVIDCEPILGYLHRGMEKIAENRTILQYLPYVTRWDY
NUOCD_PSESM     ----------LNLGPNHPSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMAERQSWHSFIPYTDRIDY
NDHH_SPIOL      ----------VNMGPHHPSMHGVLRLIVTLDGEDVIDCEPIVGYLHRGMEKIAENRTIIQYLPYVTRWDY
NDHH_PROM4      --ETRTEPMVVNFGPHHPSMHGVLRLVVTLDGEDVVDCEPVIGYLHRGMEKIAENRTNVMFVPYVSRMDY
NDHH_PHYPA      ----------VSMGPHHPSMHGVLRLIVTLDGENVIDCEPILGYLHRGMEKIAENRTIVQYLPYVTRWDY
NDHH_SYNP2      --ETRTEPMVINMGPHHPSMHGVLRLIVTLDGEDVVDCEPVIGYLHRGMEKIAENRTNVMYVPYVSRWDY
NDHH_PROMS      --ETRTEPMVVNFGPHHPSMHGVLRLVVTLDGENVIDCEPVIGYLHRGMEKIAENRTNVMYVPYVSRMDY
NDHH_OENGL      ----------VNMGPHHPSMHGVLRLILTLDGEDVIDCEPILGYLHRGMEKIAENRTVIQYLPYVTRWDY
NDHH_OENEH      ----------VNMGPHHPSMHGVLRLILTLDGEDVIDCEPILGYLHRGMEKIAENRTVIQYLPYVTRWDY
NDHH_OENBI      ----------VNMGPHHPSMHGVLRLILTLDGEDVIDCEPILGYLHRGMEKIAENRTVIQYLPYVTRWDY
NDHH_OENPA      ----------VNMGPHHPSMHGVLRLILTLDGEDVIDCEPILGYLHRGMEKIAENRTVIQYLPYVTRWDY
NDHH_OENAR      ----------VNMGPHHPSMHGVLRLILTLDGEDVIDCEPILGYLHRGMEKIAENRTVIQYLPYVTRWDY
NDHH_BRADI      ----------VNMGPQHPSMHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NDHH_PROM9      --ETRTEPMVVNFGPHHPSMHGVLRLVVTLDGENVIDCEPVIGYLHRGMEKIAENRTNVMYVPYVSRMDY
NDHH_PROM2      --ETRTEPMVVNFGPHHPSMHGVLRLVVTLDGENVIDCEPVIGYLHRGMEKIAENRTNVMYVPYVSRMDY
NDHH_PROM0      --ETRTEPMVVNFGPHHPSMHGVLRLVVTLDGENVIDCEPVIGYLHRGMEKIAENRTNVMYVPYVSRMDY
NUOCD_PSYWF     ----------LNLGPNHPSAHGAFRLVLQLDGEEVIDCIPDIGYHHRGAEKMAERQTWHSYIPYTDRIDY
NDHH_PSINU      ----NKDQMIVSMGPHHPSMHGVLRLIVTLDGENVADCEPVLGYLHRGMEKIAENRTIIQYLPYVTRWDY
NDHH_IPOPU      ----------VNMGPHHPSMHGVLRLILTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NDHH_PIPCE      ----------VNMGPHHPSMHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NUOCD_BLOFL     ----------LNLGPNHPSVHGVFRIILQLSGEEIIDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRVEY
NDHH_GOSBA      ----------VNMGPHHPSMHGVLRLIVTLDGEDVVDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NDHH_AETCO      ----------VNIGPHHPSMHGVLRLIVTLDGGDVVDCEPILGYLHRGMEKIAENRAIIQYLPYVTRWDY
NDHH_GOSHI      ----------VNMGPHHPSMHGVLRLIVTLDGEDVVDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NDHH_DIOEL      ----------VNMGPHHPSMHGVLRLIVTLEGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NDHH_CYCTA      ----------VSMGPHHPSMHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIVQYLPYVTRWDY
NDHH_CHLSC      ----------VNMGPHHPSMHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NUOCD_PSYCK     ----------LNIGPNHPSAHGAFRLVLQLDGEEVVDCIPDIGYHHRGAEKMAERQTWHSFIPYTDRIDY
NUOCD_BAUCH     ----------LNFGPNHPSAHGAFRIVLQLDGEEIVDCIPDIGYHHRGVEKMSERQSWHSYIPYTDRVEY
NDHH_PELHO      ----------VNMGPHHPSMHGVLRLILTLDGEDVIDCEPVLGYLHRGMEKIAENRTIIQYLPYVTRWDY
NDHH_CALFG      ----------VNMGPHHPSMHGVLRLIVTLDGEDVIDCEPVLGYLHRGMEKIAENRTIIQYLPYVTRWDY
NUOCD_PSYA2     ----------LNIGPNHPSAHGAFRLVLQLDGEEVVDCIPDIGYHHRGAEKMAERQTWHSFIPYTDRIDY
NDHH_SOLLC      ----------VNMGPQHPSMHGVLRLIVTLDGEDVVDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NDHH_SOLTU      ----------VNMGPQHPSMHGVLRLIVTLDGEDVVDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NDHH_CARPA      ----------VNMGPHHPSMHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NDHH_ATRBE      ----------VNMGPQHPSMHGVLRLIVTLDGEDVVDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NUOD_SYNFM      --------YTLNLGPQHPSTHGVLRVLLDLDGEFIVKADPVIGYGHRGHEKMGENRLFKQFLPNTSRLDY
NUOD_CHLPB      ----------LNMGPQHPSTHGVLRLECKTDGEVVIEAEPYLGYLHRCFEKHAEMVDYPGIVPFVDRMDY
NDHH_TOBAC      ----------VNMGPQHPSMHGVLRLIVTLDGEDVVDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NDHH_NICSY      ----------VNMGPQHPSMHGVLRLIVTLDGEDVVDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NUOCD_CITK8     ----------LNLGPNHPSSHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEY
NDHH_HUPLU      ----------VSMGPHHPSMHGVLRLIVTLDGENVTNCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NDHH_CITSI      -TEKEKEFMIVNMGPHHPSMHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NUOD_RUBXD      --EFGLETLDMNMGPQHPAMHGLLRLILELDGETIVRCDPVMGYLHRCQEKIAENRTYPAVIPLTDRLDY
NDHH_SOLBU      ----------VNMGPQHPSMHGVLRLIVTLDGEDVVDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NDHH_PHAVU      ----------VNMGPHHPSMHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NDHH_CRYJA      ----------VSMGPHHPSMHGVLRLIVTLDGEDVIDCEPVLGYLHRGMEKIAENRTIVQYLPYVTRWDY
NDHH_ADICA      ----------VSMGPHHPSMHGVLRLVVALQGENVVDCELILGYLHRGMEKIAENRTTSQYLPYVTRWDY
NUOCD_SERP5     ----------LNLGPNHPSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_KLEP3     ----------LNLGPNHPSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_ECO5E     ----------LNLGPNHPSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_ECO57     ----------LNLGPNHPSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEY
NDHH_DRIGR      ----------INMGPHHPSMHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NUOCD_ECOUT     ----------LNLGPNHPSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_ECOL6     ----------LNLGPNHPSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_ECOK1     ----------LNLGPNHPSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_ECO81     ----------LNLGPNHPSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_ECO45     ----------LNLGPNHPSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_ECO27     ----------LNLGPNHPSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_SHISS     ----------LNLGPNHPSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_SHIFL     ----------LNLGPNHPSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_SHIF8     ----------LNLGPNHPSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_SHIDS     ----------LNLGPNHPSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_SHIBS     ----------LNLGPNHPSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_KLEP7     ----------LNLGPNHPSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_ESCF3     ----------LNLGPNHPSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_ECOSM     ----------LNLGPNHPSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_ECOSE     ----------LNLGPNHPSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_ECOLU     ----------LNLGPNHPSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_ECOLC     ----------LNLGPNHPSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_ECOL5     ----------LNLGPNHPSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_ECOHS     ----------LNLGPNHPSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_ECO8A     ----------LNLGPNHPSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_ECO7I     ----------LNLGPNHPSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_ECO55     ----------LNLGPNHPSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_ECO24     ----------LNLGPNHPSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_SHIB3     ----------LNLGPNHPSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_ENTS8     ----------LNLGPNHPSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRVEY
NDHH_RANMC      ----------VNMGPQHPSMHGVLRLVVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NDHH_OLIPU      ----------VNMGPHHPSMHGVLRLIVTLDGEDVVDCEPILGYLHRGMEKIAENRAIIQYLPYVTRWDY
NUOCD_PECCP     ----------LNLGPNHPSSHGAFRIILQLDGEEIVDCVPDVGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_BLOPB     ----------LNLGPNHPSVHGVFRIILQLNGEEIIDCVPDIGYHHRGAEKMGERQTWHSYIPYTDRIEY
NDHH_NICTO      ----------VNMGPQHPSMHGVLRLIVTLDGEDVVDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NDHH_LIRTU      MTVPDIRKMIVNMGPHHPSMHGVLRLIVTLDGEDVIDCEPVLGYLHRGMEKIAENRTIIQYLPYVTRWDY
NDHH_AETGR      ----------VNIGPHHPSMHGVLRLIVTLDGEDVVDCQPILGYLHRGMEKIAENRAIIQYLPYVTRWDY
NUOCD_SALTY     ----------LNLGPNHPSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_SALTI     ----------LNLGPNHPSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_SALSV     ----------LNLGPNHPSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_SALPK     ----------LNLGPNHPSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_SALPB     ----------LNLGPNHPSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_SALPA     ----------LNLGPNHPSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_SALNS     ----------LNLGPNHPSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_SALHS     ----------LNLGPNHPSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_SALG2     ----------LNLGPNHPSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_SALEP     ----------LNLGPNHPSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_SALDC     ----------LNLGPNHPSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_SALAR     ----------LNLGPNHPSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_SALA4     ----------LNLGPNHPSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_ERWCT     ----------LNLGPNHPSSHGAFRIILQLDGEEIVDCVPDVGYHHRGAEKMGERQSWHSYIPYTDRIEY
NDHH_BUXMI      ----------VNMGPHHPSMHGVLRLIVSLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NDHH_ARAHI      ----------VNMGPHHPSMHGVLRLIVTLDGEDVVDCEPILGYLHRGMEKIAENRAIIQYLPYVTRWDY
NUOD_FLAPJ      ----------LNLGPTHPATHGIFQNILLMDGERIVDAEPTIGYIHRAFEKIAENRPFYQITPLTDRMNY
NUOCD_ECOLI     ----------LNLGPNHPSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_ECODH     ----------LNLGPNHPSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEY
NDHH_TRISU      ----------VNMGPQHPSMHGVLRLIVTLDGEDVVDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NDHH_CRUWA      ----------VNMGPHHPSMHGVLRLIVTLDGEDVVDCEPILGYLHRGMEKIAENRAIIQYLPYVTRWDY
NDHH_CERDE      ----------VNMGPQHPSMHGVLRLIVTLDGEDVIDCEPVLGYLHRGMEKIAENRTIIQYLPYVTRWDY
NDHH_NASOF      ----------VNMGPHHPSMHGVLRLIVTLDGEDVVDCEPILGYLHRGMEKIAENRAIIQYLPYVTRWDY
NDHH_LOBMA      ----------VNMGPHHPSMHGVLRLIVTLDGEDVVDCEPILGYLHRGMEKIAENRAIIQYLPYVTRWDY
NDHH_CAPBU      ----------VNMGPHHPSMHGVLRLIVTLDGEDVVDCEPILGYLHRGMEKIAENRAIIQYLPYVTRWDY
NDHH_BARVE      ----------VNMGPHHPSMHGVLRLIVTLDGEDVVDCEPILGYLHRGMEKIAENRAIIQYLPYVTRWDY
NDHH_ARATH      ----------VNMGPHHPSMHGVLRLIVTLDGEDVVDCEPILGYLHRGMEKIAENRAIIQYLPYVTRWDY
NUOD_LEPIN      ----------VNLGPSHPATHGILQNVIQIDGERIVEAESVIGYVHRCFEKLGERYTYNQFLVCTDRMNY
NUOD_LEPIC      ----------VNLGPSHPATHGILQNVIQIDGERIVEAESVIGYVHRCFEKLGERYTYNQFLVCTDRMNY
NDHH_HELAN      ----------VNMGPHHPSMHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NDHH_GUIAB      ----------VNMGPHHPSMHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NDHH_PLAOC      ----------VNMGPHHPSMHGVLRLIVTLDGEDVIDCEPVLGYLHRGMEKIAENRTIIQYLPYVTRWDY
NDHH_LEPVR      ----------VNMGPHHPSMHGVLRLIVTLDGEDVVDCEPILGYLHRGMEKIAENRAIIQYLPYVTRWDY
NDHH_ILLOL      ----------VNMGPHHPSMHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NUOD_AMOA5      -TDLKVEEVLINIGPQHPATHGILRLEVILDGEIVVDVVPHLGYLHRCFEKHAATLPYNQTIPFVDRLDY
NDHH_PANGI      MTASATRNMIVNLGPQHPSMHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NUOCD_ENT38     ----------LNLGPNHPSSHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_CHRSD     ----------LNLGPNHPSAHGAFRIALQLDGEVVVDCVPDIGYHHRGAEKMAERQSWHSYIPYTDRIDY
NUOCD_SALPC     ----------LNLGPNHPSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOCD_SALCH     ----------LNLGPNHPSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEY
NDHH_LACSA      ----------VNMGPHHPSMHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NDHH_DAUCA      MTAPATRNMIVNMGPQHPSMHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NUOD_LEPBP      ----------VNLGPSHPATHGILQNVIQIDGERVVDTESVIGYVHRCFEKLGERYDYNQFLVCTDRMNY
NUOD_LEPBJ      ----------VNLGPSHPATHGILQNVIQIDGERIVEAESVIGYVHRCFEKLGERYTYNQFLVCTDRMNY
NUOD_LEPBA      ----------VNLGPSHPATHGILQNVIQIDGERVVDTESVIGYVHRCFEKLGERYDYNQFLVCTDRMNY
NUOD_LEPBL      ----------VNLGPSHPATHGILQNVIQIDGERIVEAESVIGYVHRCFEKLGERYTYNQFLVCTDRMNY
NUOD1_ANASK     ----------LNFGPQHPSTHGVINFLVETDGEVLKRATPDVGYLHRSIEKIGEMVGYPGFMPYTDRVDY
NUOCD_SODGM     ----------LNLGPNHPSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRVEY
NUOD2_ANADE     ----------LNFGPQHPSTHGVINFLVETDGEVLKRATPDVGYLHRSIEKIGELVGYPGFMPYTDRVDY
NDHH_MORIN      ----------VNMGPHHPSMHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NDHH_LOTJA      ----------VNMGPHHPSMHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
NUOCD_BUCCC     ---NNSEYMFLNFGPNHPSSHGAFRIVLQLHGEKIINCIPDIGYHHRGAEKIAERQTWHSYIPYTDRIEY
NUOCD_BUCAT     ----NVEFMFLNLGPNHPSAHGAFRIVLQLDGENIVDCVPDIGYHHRGAEKMAERQSWHSYIPYTDRIEY
NUOCD_BUCAI     ----NVEFMFLNLGPNHPSAHGAFRIVLQLDGENIVDCVPDIGYHHRGAEKMAERQSWHSYIPYTDRIEY
NUOCD_BUCA5     ----NVEFMFLNLGPNHPSAHGAFRIVLQLDGENIVDCVPDIGYHHRGAEKMAERQSWHSYIPYTDRIEY
NDHH_COFAR      ----------VNMGPHHPSMHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIVQYLPYVTRWDY
NUOD_FLAJ1      ----------LNLGPTHPATHGIFQNILLMDGERILEAEPTIGYIHRAFEKIAENRPFYQITPLTDRMNY
NUOD2_OPITP     --------FTINLGPQHPAAHGVLRVLMRMDGEWVENAEPVIGYIHRMHEKMGENRTWAKFLPNTSRIDY
NUOCD_AERHH     ----------LNLGPNHPSAHGAFRLVLQLDGEEIRDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRVEY
NDHH_FAGEA      ----------VNMGPQHPSMHGVLRLIVTLDGEDVIDCEPVLGYLHRGMEKIAENRTIIQYLPYVTRWDY
NUOCD_BACTN     --------YVVNIGPQHPATHGVMRFRVSLEGEIIRKIDANCGYIHRGIEKMNESLTYPQTLALTDRLDY
NUOCD_SHEON     ----------LNLGPNHPSAHGAFRLVLQLDGEEVRNCVPDIGYHHRGAEKMGERQSWHSYIPYTDRVEY
NUOCD_BUCAP     ----NVDFMFLNLGPNHPSAHGAFRIVLQLDGENIVDCVPDIGYHHRGAEKMAERQSWHSYIPYTDRIEY
NDUS2_NYCOV     ------RILILNFGPQHPASHGVLRLVIVIIGEVVTKLDPHIGFLHRGTERLVEEHSYMNAAVFMDRLDY
NUOD2_CYTH3     ---------TLNLGPTHPATHGVFQNILKMDGERIVDAVPTVGYIHRAFEKIAERRAFYQITTLTDRMNY
NUOCD_BUCBP     ----------LNLGPNHPSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMGERQTWHNYIPYTDRVEY
NUOCD_AERS4     ----------LNLGPNHPSAHGAFRLVLQLDGEEIRNCVPDIGYHHRGAEKMGERQSWHSYIPYTDRVEY
NUOCD_ACIAD     ----------LNLGPNHPSAHGAFRVVLQLDGEEVKDCVPDIGYHHRGVEKMAERQTWHSFIPYTDRVDY
NUOCD_BACV8     --------YIINIGPQHPATHGVLRFRVSLEGEIIKKLDVHCGYIHRGIEKMCESLTYPQTLALTDRLDY
NUOCD_ACIBY     ----------LNLGPNHPSAHGAFRIVLQLDGEEVKDCVPDIGYHHRGVEKMAERQTWHSFIPYTDRVDY
NUOCD_ACIBT     ----------LNLGPNHPSAHGAFRIVLQLDGEEVKDCVPDIGYHHRGVEKMAERQTWHSFIPYTDRVDY
NUOCD_ACIBS     ----------LNLGPNHPSAHGAFRIVLQLDGEEVKDCVPDIGYHHRGVEKMAERQTWHSFIPYTDRVDY
NUOCD_ACIBC     ----------LNLGPNHPSAHGAFRIVLQLDGEEVKDCVPDIGYHHRGVEKMAERQTWHSFIPYTDRVDY
NUOCD_ACIB5     ----------LNLGPNHPSAHGAFRIVLQLDGEEVKDCVPDIGYHHRGVEKMAERQTWHSFIPYTDRVDY
NUOCD_ACIB3     ----------LNLGPNHPSAHGAFRIVLQLDGEEVKDCVPDIGYHHRGVEKMAERQTWHSFIPYTDRVDY
NUOCD_ARCB4     ----------LNVGPSHPASHGTIRNFVAMEGETITACVTEIGYLHRGFEKACEHHTYSQIIPYTDRLNY
NUOCD_BACFR     -TQENVREYVVNIGPQHPATHGVMRFRVSLEGETIKKLDANCGYIHRGIEKMNESLTYPQTLALTDRLDY
NUOCD_BACFN     -TQENVREYVVNIGPQHPATHGVMRFRVSLEGETIKKLDANCGYIHRGIEKMNESLTYPQTLALTDRLDY
NUOD_DESHY      ----------LNMGPQHPSMHGVFRMVVRLQGETVTGIEPKIGYLHRGLEKIAESRTYPQFIPYTDRLDY
NUOCD_CAMFF     ----------LNIGPSHPATHGTIRNFVALDGEKIISCVTEIGYLHRGFEKACENHSYAQIIPYTDRLNY
NUOD_DESPS      MSEHIILNFTLNLGPQHPATHGVLRVKLTMDGEYIYSAETVIGYIHRMHEKMGENRTYNQYLPNLSRLDY
NUOCD_ERWT9     ----------LNLGPNHPSAHGAFRIILQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEY
NUOD2_STRGG     -------DMVLNIGPQHPSTHGVLRLRIVLDGERVQHAEPVIGYMHRGAEKLFEARDYRQIIMLANRHDW
NUOD2_STRAW     -------DMVLNIGPQHPSTHGVLRLRLVLDGERIQHAEPVIGYMHRGAEKLFEARDYRQIIMLANRHDW
NUOD1_STRCO     -------DMVLNIGPQHPSTHGVLRLKLVLDGERITSAEPVIGYMHRGAEKLFEARDYRQIIMLANRHDW
NUOD2_SALTO     -------DMVLNIGPQHPSTHGVLRLRLVLDGERVVSAEPVVGYMHRGAEKLFEVRDYRQIIVLANRHDW
NUOD_THEM4      ------------FGPNHPGMHGNFSVHMYVEGDTVVKARPLPGFLHRGFEKLMERRLWYQNLALIPRICV
NUOD2_SALAI     -------DMVLNIGPQHPSTHGVLRLRLVLDGERVVSAEPIVGYMHRGAEKLFEVRDYRQIIVLANRHDW
NDUS2_TRYBB     --------YRFTFGPQHPAAHGVLCCLLYFCGEFIVYIDCIIGYLHRGTEKLCEYKSVEQCLPYFDRLDY
COOH_RHORU      --------YTIPVGPLHVALEEPMYFRIEVDGEKVVSVDITAGHVHRGIEYLATKRNIYQNIVLTERVCS
HYCE_ECOLI      ------KNNVVPIGPLHVTSDEPGHFRLFVDGENIIDADYRLFYVHRGMEKLAETRMGYNEVTFLDRVCG
Y515_METJA      ---------TIPIGPIHPVLKEPLRIKLVLDGEKPVDAEIEMGYVHRGIEKIMEGKHCHKGIHLAERVCG
HYFG_ECOLI      INEGNSDARVIPVGPLHITSDEPGHFRLFVDGEQIVDADYRLFYVHRGMEKLAETRMGYNEVTFLDRVCG
Y1027_METJA     ----------IAIGPVHPTMLEPHRLRLFIEDEIIKEAELVIGVNYRGIELIMEGLPPEKISILSEKICG
NDUS2_SOLTU     MTTKNIQNFTLNFGPQHPAAHGVLRLVLEMNGEVVERAEPHIGLL-------------------------
NDHH_SECCE      --------------------------IVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDY
FRHA_METTH      ---------------------GHAELVMEVDDEGIVTKGRYFSITPRGLEKIVTGKAPETAPVIVQRICG
VHCA_METVO      --------------------HGKVTLSFDDSGKL-DKVNFHVVEV-RGFEKFLEGR-YIEDAPIFTRICG
MBHL_ALCHY      ---------------------GHMRCEVNLDANNVIRNAVSTGTMWRGLEVILKRADPADAWAFVERICR
FRHA_METBF      ---------------------GHSKLTLKVDDQIVERGDWLSITPVRGIEKLAIGKTMEQVPKIASRVCG


                         .         .         *         .         .         .         .:140
query           VAPMNQEHAFALAVEKLLGLEIPMRGQLIRVLYSEIGRILSHIMNVTTQAMDVGAMTPPVWGFEEREKLM
NUOD_AGRT5      VAPMNQEHAFALAVEKLLGLEIPMRGQLIRVLYSEIGRILSHIMNVTTQAMDVGAMTPPVWGFEEREKLM
NUOD1_SINMW     VAPMNQEHAFALAVERLTGTQVPIRGQLIRVLYSEIGRILSHLLNVTTQAMDVGALTPPLWGFEEREKLM
NUOD1_RHIME     VAPMNQEHAFALAVERLTGTQVPIRGQLIRVLYSEIGRILSHLLNVTTQAMDVGALTPPLWGFEEREKLM
NUOD_RHILW      VAPMNQEHAYALAVEKLLGIEIPIRGQLIRVLYSEIGRILSHLLNVTTQAMDVGALTPPLWGFEEREKLM
NUOD1_RHIE6     VAPMNQEHAYALAVERLLGIEIPIRGQLIRVLYSEIGRILSHLLNVTTQAMDVGALTPPLWGFEEREKLM
NUOD1_RHIEC     VAPMNQEHAYALAVEKLLGIQIPIRGQLIRVLYSEIGRILSHLLNVTTQAMDVGALTPPLWGFEEREKLM
NUOD_RHIL3      VAPMNQEHAYAMAVEKLLGIEIPIRGQLIRVLYSEIGRILSHLLNVTTQAMDVGALTPPLWGFEEREKLM
NUOD_BRUME      VAPMNQEHAYALAVERLLDIEVPKRGQLIRVLYSEIGRILNHLLNVTTQAMDVGALTPPLWGFEEREKLM
NUOD_BRUSI      VAPMNQEHAYALAVERLLDIEVPKRGQLIRVLYSEIGRILNHLLNVTTQAMDVGALTPPLWGFEEREKLM
NUOD_BRUO2      VAPMNQEHAYALAVERLLDIEVPKRGQLIRVLYSEIGRILNHLLNVTTQAMDVGALTPPLWGFEEREKLM
NUOD_BRUC2      VAPMNQEHAYALAVERLLDIEVPKRGQLIRVLYSEIGRILNHLLNVTTQAMDVGALTPPLWGFEEREKLM
NUOD_OCHA4      VAPMNQEHAYALAVERLLGIDVPKRGQLIRVLYSEIGRILNHLLNVTTQAMDVGALTPPLWGFEEREKLM
NUOD_MESSB      VAPMNQEHAFALAIERLLGIDVPIRGQLIRVLYSEISRILNHLLNITTQAMDVGALTPPLWGFEEREKLM
NUOD_BRUSU      VAPMNQEHAYALAVERLLDIEVPKRGQLIRVLYSEIGRILNHLLNVTTQAMDVGALTPPLWGFEEREKLM
NUOD_BRUAB      VAPMNQEHAYALAVERLLDIEVPKRGQLIRVLYSEIGRILNHLLNVTTQAMDVGALTPPLWGFEEREKLM
NUOD_BRUA2      VAPMNQEHAYALAVERLLDIEVPKRGQLIRVLYSEIGRILNHLLNVTTQAMDVGALTPPLWGFEEREKLM
NUOD_BRUA1      VAPMNQEHAYALAVERLLDIEVPKRGQLIRVLYSEIGRILNHLLNVTTQAMDVGALTPPLWGFEEREKLM
NUOD_RHILO      CAPMNQEHAFALAAERLLGIEVPKRGQLIRVLYCEIGRIMSHILNVTTQAMDVGALTPPLWGFVEREKLM
NUOD_XANP2      CAPMNQEHAFCLAAEKLLGIEVPKRGQLIRVLYSEIGRLLSHLLNVTTFAMDVGALTPPLWGFEEREKLM
NUOD_BRAJA      VAPMNQEHAFCLAAEKLLGIEVPRRGQLIRVLYCEIGRILSHLLNVTTQAMDVGALTPPLWGFEEREKLM
NUOD_NITWN      VAPMNQEHAFCLAAERLLGIAVPRRGQLIRVLYCEIGRILSHLLNVTTQAMDVGALTPPLWGFEEREKLM
NUOD_BRASO      VAPMNQEHAFCLAAERLLGIEVPRRGQLIRVLYSEIGRLLSHLLNVTTQAMDVGALTPPLWGFEEREKLM
NUOD_BRASB      VAPMNQEHAFCLAAERLLGIEVPRRGQLIRVLYSEIGRLLSHLLNVTTQAMDVGALTPPLWGFEEREKLM
NUOD_RHOPA      VAPMNQEHAFCLAVEKLLGIAVPRRAQLIRVLYAEIGRILSHLLNVTTQAMDVGALTPPLWGFEEREKLM
NUOD2_NITHX     VAPMNQEHAFCLAAEKLLGIAVPRRGQLIRVLYCEIGRILSHLLNVTTQALDVGALTPPLWGFEEREKLM
NUOD_RHOPT      VAPMNQEHAFCLAVEKLLGIAVPRRAQLIRVLYAEIGRILSHLLNVTTQAMDVGALTPPLWGFEEREKLM
NUOD_PARL1      VAPMNQEHAFVLAAERLLGLEVPRRAQFIRVLYSEIGRILAHLLNVTTQAMDVGALTPPLWGFEEREKLM
NUOD_OLICO      VAPMNQEHAFCLAAEKLLGITVPRRGQLIRVLYSEIGRILSHLLNITTQALDVGALTPPLWGFEEREKLM
NUOD_BARBK      VAPMNQEHAFVLAVEKLLGVEVPKRGQLIRVLFSEIGRLLNHLLNVTTQAMDVGALTPPLWGFEQREKLM
NUOD_RHOPS      VAPMNQEHAFCLAVEKLLGIAVPRRAQLIRVLYCEIGRILSHLLNVTTQAMDVGALTPPLWGFEEREKLM
NUOD_RHOP2      VAPMNQEHAFCLAAEKLLGIEAPRRAQLIRVLYCEIGRILSHLLNVTTQAMDVGALTPPLWGFEEREKLM
NUOD_AZOC5      CAPMNQEHAFCLAVERLAGIEVPKRGQLIRVLYSEIGRLLSHLLNVTTFAMDVGALTPPLWGFEAREKLM
NUOD_RHOP5      VAPMNQEHAFCLAAEKLLGIAVPRRAQLIRVLYCEIGRILSHLLNVTTQAMDVGALTPPLWGFEEREKLM
NUOD_METEP      VAPMNQEHAFCLAIERLAGIEVPRRAQLIRTLFCEIGRLLSHLLNVTTQAMDVGALTPPLWGFEEREKLM
NUOD_BARQU      VAPMNQEHAFVLAIEKLLGVEVPKRGQLIRVLFSEIGRILNHLLNVTTQAMDVGALTPPLWGFEQRERLM
NUOD_METS4      VAPMNQEHAFCLAVEKLLGIEVPRRAKLIRTLFCEIGRLLSHLLNVTTQAMDVGALTPPLWGFEEREKLM
NUOD_METRJ      VSPMNQEHAFCLAIEKLAGIEVPRRAQLIRVLFCEIGRLLSHLLNVTTQAMDVGALTPPLWGFEEREKLM
NUOD_METPB      VSPMNQEHAFCLAIERLAGIEVPRRAQLIRTLFCEIGRLLSHLLNVTTQAMDVGALTPPLWGFEEREKLM
NUOD_RHOPB      VAPMNQEHAFCLAAEKLLDIAVPRRAQLIRVLYCEIGRILSHLLNVTTQAMDVGALTPPLWGFEEREKLM
NUOD_BART1      VAPMNQEHAFVLAIEKLLNIKVPKRGQLIRVLFSEIGRILNHLLNVTTQAMDVGALTPPLWGFEQRERLM
NUOD_BARHE      VAPMNQEHAFVLAIEKLLGVEVPKRGQLIRVLFSEIGRILNHLLNVTTQAMDVGALTPPLWGFEQRERLM
NUOD_CAUCR      VAPMNQEHAFCLAIEKLLGVEVPIRGQIIRVLYSEIGRILNHLLNVTTQAMDVGALTPPLWGFEEREKLM
NUOD1_BEII9     VAPMNQEHAFCLAIEKLLGIEVPRRGQLLRVLWCEIGRILSHLLNVTTQAMDVGALTPPLWGFEEREKLM
NUOD1_NITHX     VAPMNQEHAFCLATEKLLNITIPKRGQLIRVLYCEIGRLLSHLLNVTTQAMDVGALTPPLWGFEEREKLM
NUOD_CAUSK      VAPMNQEHAFCLAIEKLLGVDVPLRGSLIRVLFCEIGRVLNHLLNVTTQAMDVGALTPPLWGFEEREKLM
NUOD_PHEZH      VAPMNQEHAYCLAIEKLLGVEVPVRGLLIRTLYDEIGRILNHLLNVTTQAMDVGALTPPLWGFEEREKLM
NUOD2_BEII9     VAPMNQEHAFCLAIEKLLQMPVPRRGQLIRVLFCEIGRLLSHLLNITTQALDIGALTPPLWGFEEREKLM
NUOD_MARMM      VAPMNQEHAFCMAAEKLAGITVPKRGEYVRVLYCEIGRVLNHLLNVTTQAMDVGALTPPLWGFEEREKLM
NUOD_SILPO      VAPMNQEHAWCLAIEKLTGVEVPRRASLIRVLYSEIGRILNHLLNVTTQAMDVGALTPPLWGFEEREKLM
NUOD_JANSC      VGTMNQEHAWCLAIERMTGTDVPRRAQLIRVLYCEIGRILNHLLNVTTQALDVGALTPPLWGFEEREKLM
NUOD_DINSH      VAPMNQEHAWCLAIEKLTGTVVPRRGSLIRVLYCEIGRILNHLLNITTQAMDVGALTPPLWGFEEREKLM
NUOD_RHOS5      VAPMNQEHAWCLAIERLTGVQVPRRASLIRVLYSEIGRVLNHLLNVTTQAMDVGALTPPLWGFEEREKLM
NUOD_RHOS4      VAPMNQEHAWCLAIERLTGVAVPRRASLIRVLYSEIGRVLNHLLNVTTQAMDVGALTPPLWGFEEREKLM
NUOD_RHOS1      VAPMNQEHAWCLAIERLTGVAVPRRASLIRVLYSEIGRVLNHLLNVTTQAMDVGALTPPLWGFEEREKLM
NUOD_ROSDO      VAPMNQEHAWCLAIEKLTGVEVPRRASLIRVLFCEIGRILNHILNITTQAMDVGALTPPLWGFEEREKLM
NUOD_HYPNA      CAPMNQEHAWCLAIEKLLGVEVPRRASIIRVMYSEIGRIMSHLLNVGTGVMDVGALTPITWCFEEREKLC
NUOD_SILST      VAPMNQEHAWCLAIEKLTGVEVPRRAQLIRVLYSEIGRILNHLLNITTQAMDVGALTPPLWGFEEREKLM
NUOD_PELUB      VAPMNQEHAFALAIEKILKINVPIRAQLIRVMFCEIGRILSHILNVTTQALDVGALTPSLWGFEERETLM
NUOD_RHOCA      VAPMNQEHAWCLAIEKLTGTAVPRRASIIRVLFSEIGRILNHLLNVTTQAMDVGALTPPLWGFEEREKLM
NQO4_PARDP      VAPMNQEHAWCLAIERLTGTVIPRRASLIRVLYSEIGRILNHLMGVTTGAMDVGALTPPLWGFEAREELM
NQO4_PARDE      VAPMNQEHAWCLAIERLTGTVIPRRASLIRVLYSEIGRILNHLMGVTTGAMDVGALTPPLWGFEAREELM
NUOD_MAGSA      VGTMNQEHAFVLATEKLLGIDIPIRAKFIRTLYDEIGRILNHLLNVTAFIFDVGGMTPLLYGFEEREKLM
NUOD_EHRCJ      VSPMAQEHAYSLCVEKLLKCEIPIRAKYLRVIFCELTRILNHLLNISSQALDIGAMTPLLWMFEEREKIL
NUOD_RHOCS      VSPMSQEHAFALATEKLLGITVPVRGQYIRVLFSEITRILNHLLNITTFGLDVGAITPSLWGFEEREKLM
NUOD_WOLTR      VSPMSQEHAYSLCVEKLLQCEVPIRAKYLRVLFCELTRILNHLLNISSQALDVGAMTPLLWLFEEREKIL
NUOD_EHRRW      VSPMAQEHAYSLCVEKLLKCEVPIRAKYLRVIFCELTRILNHLLNISSQALDIGAMTPLLWMFEEREKIL
NUOD_EHRRG      VSPMAQEHAYSLCVEKLLKCEVPIRAKYLRVIFCELTRILNHLLNISSQALDIGAMTPLLWMFEEREKIL
NUOD_WOLPM      VSPMSQEHAYSLCVEKLLQCEVPIRAKYLRVLFCELTRILNHLLNVSSQALDVGAMTPLLWLFEEREKIL
NUOD_NOVAD      CSPLGMEHSYVLAVEKLLNIEVPLRAQYLRVLFAELTRICNHMLNLGSHVMDVGAMTPNLWLFEIREDCL
NUOD_WOLPP      VSPMSQEHAYSLCVEKLLQCEIPIRAKYLRVLFCELTRILNHLLNISSQALDVGAMTPLLWLFEEREKIL
NUOD_RHORT      ACPMNQEHAYVLAVEKLLGITVPPRAQYLRTLFNEVTRLINHIMNTTSMALDIGAMTPLLYGFEEREHLL
NUOD_SPHWW      CSPLGMEHSYVLAIEKLLQLEVPLRAQYLRVLFAELTRICNHMLNIGSHVMDVGAMTPNLWLFEIREDCL
NDUS2_RECAM     VSMMAQEHAYSLAVEKLLGCEVPKRAQYIRVLFCEITRILNHLMAVTTHALDVGAM