[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for atum0:AAK87170.1

[Show Plain Result]


## Summary of Sequence Search
    1::247
    1::247     e-140 100%  247 aa  UPPS_AGRT5 RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    7::247     5e-97  69%  247 aa  UPPS_RHIME RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    2::232     2e-90  70%  254 aa  UPPS_BRUSU RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    2::232     8e-90  70%  254 aa  UPPS_BRUME RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    2::232     8e-90  70%  254 aa  UPPS_BRUAB RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    4::213     1e-84  70%  244 aa  UPPS_RHILO RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   14::226     2e-75  62%  252 aa  UPPS2_BRAJA RecName: Full=Undecaprenyl pyrophosphate synthetase 2; 
   15::248     1e-69  52%  254 aa  UPPS_PHOPR RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   15::248     8e-69  50%  257 aa  UPPS_VIBF1 RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   15::247     3e-68  52%  247 aa  UPPS_THETN RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   22::255     2e-67  54%  257 aa  UPPS_GEOKA RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   23::252     3e-67  52%  253 aa  UPPS_CLOPE RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   29::258     6e-67  53%  260 aa  UPPS_HELMO RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   16::242     6e-67  53%  251 aa  UPPS_CHRVO RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   10::244     6e-66  48%  251 aa  UPPS_VIBPA RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   25::255     1e-65  50%  255 aa  UPPS_CLOTE RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    9::242     1e-65  49%  246 aa  UPPS_GEOSL RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   27::257     1e-65  51%  257 aa  UPPS_BACSK RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   29::258     1e-65  50%  258 aa  UPPS_BACCR RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   29::258     2e-65  50%  258 aa  UPPS_BACHK RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   29::258     2e-65  50%  258 aa  UPPS_BACAN RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   29::258     3e-65  50%  258 aa  UPPS_BACC1 RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   11::244     5e-65  47%  250 aa  UPPS_VIBCH RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   10::239     5e-65  52%  242 aa  UPPS_HAEDU RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   10::249     7e-65  50%  251 aa  UPPS_PSEPK RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   24::254     1e-64  50%  254 aa  UPPS_STAS1 RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    9::244     6e-64  50%  244 aa  UPPS_BACTN RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   10::244     8e-64  48%  251 aa  UPPS_VIBVY RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   10::244     8e-64  48%  251 aa  UPPS_VIBVU RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   13::247     1e-63  47%  249 aa  UPPS_SYNY3 RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    8::249     3e-63  48%  258 aa  UPPS_XANOR RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   23::256     3e-63  48%  256 aa  UPPS_STAES RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   23::256     3e-63  48%  256 aa  UPPS_STAEQ RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   22::256     3e-63  47%  256 aa  UPPS_STAAW RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   22::256     3e-63  47%  256 aa  UPPS_STAAS RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   22::256     3e-63  47%  256 aa  UPPS_STAAR RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   22::256     3e-63  47%  256 aa  UPPS_STAAC RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   17::247     3e-63  48%  249 aa  UPPS_ANAVT RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   17::247     3e-63  48%  249 aa  UPPS1_ANASP RecName: Full=Undecaprenyl pyrophosphate synthetase 1; 
   12::248     4e-63  49%  257 aa  UPPS_XANAC RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   22::256     4e-63  47%  256 aa  UPPS_STAAN RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   22::256     4e-63  47%  256 aa  UPPS_STAAM RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   21::249     4e-63  50%  249 aa  UPPS_MICLU RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   10::249     5e-63  48%  251 aa  UPPS_PSESM RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   19::249     9e-63  49%  251 aa  UPPS_THEEB RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   12::243     9e-63  49%  248 aa  UPPS_NEIMB RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   12::243     9e-63  49%  248 aa  UPPS_NEIG1 RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   22::256     1e-62  50%  257 aa  UPPS_CLOAB RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   12::243     1e-62  49%  248 aa  UPPS_NEIMA RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   25::256     1e-62  50%  256 aa  UPPS_BACHD RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   14::249     2e-62  47%  254 aa  UPPS_PORGI RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   19::259     6e-62  46%  265 aa  UPPS_CHLTE RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   23::256     1e-61  46%  256 aa  UPPS_STAHJ RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   16::246     1e-61  49%  258 aa  UPPS_RALSO RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   16::250     1e-61  47%  258 aa  UPPS2_ANASP RecName: Full=Undecaprenyl pyrophosphate synthetase 2; 
   14::249     2e-61  50%  249 aa  UPPS_STRMU RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   17::250     2e-61  50%  250 aa  UPPS_STRA5 RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   17::250     2e-61  50%  250 aa  UPPS_STRA3 RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    5::248     2e-61  49%  263 aa  UPPS_NITEU RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   20::252     3e-61  44%  272 aa  UPPS_PROMP RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    2::235     3e-61  47%  237 aa  UPPS_COXBU RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   15::247     6e-61  51%  249 aa  UPPS_STRP8 RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   15::247     6e-61  51%  249 aa  UPPS_STRP6 RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   15::249     8e-61  50%  249 aa  UPPS_STRT2 RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   15::249     8e-61  50%  249 aa  UPPS_STRT1 RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   23::252     1e-60  52%  252 aa  UPPS_LISIN RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   20::247     1e-60  48%  249 aa  UPPS_GLOVI RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   60::295     2e-60  47%  296 aa  UPSS_MYCBO RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    1::200     2e-60  54%  222 aa  UPPS_ZYMMO RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   15::247     2e-60  50%  249 aa  UPPS_STRP1 RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   60::295     2e-60  47%  296 aa  UPPS_MYCTU RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   60::295     2e-60  47%  296 aa  UPPS_MYCLE RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   15::248     2e-60  47%  254 aa  UPPS_BORPE RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   15::248     2e-60  47%  254 aa  UPPS_BORPA RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   15::248     2e-60  47%  254 aa  UPPS_BORBR RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   28::247     2e-60  50%  260 aa  UPPS_BACSU RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   11::249     5e-60  46%  255 aa  UPPS_XYLFT RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   11::249     5e-60  46%  255 aa  UPPS_XYLFA RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   16::247     7e-60  50%  249 aa  UPPS_STRP3 RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   24::247     7e-60  48%  259 aa  UPPS_CAUCR RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   23::252     1e-59  50%  252 aa  UPPS_LISMF RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   20::244     2e-59  49%  253 aa  UPPS_SHIFL RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   14::254     2e-59  46%  254 aa  UPPS_PHOLL RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   23::252     2e-59  50%  252 aa  UPPS_LISMO RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   20::244     2e-59  49%  253 aa  UPPS_ECOLI RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   20::244     2e-59  49%  253 aa  UPPS_ECOL6 RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   20::244     2e-59  49%  253 aa  UPPS_ECO57 RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   10::243     4e-59  47%  251 aa  UPPS_PSEAE RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   26::268     6e-59  46%  271 aa  UPPS_ENTFA RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   26::255     1e-58  47%  265 aa  UPPS_PROMM RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   17::252     1e-58  48%  252 aa  UPPS_STRR6 RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   17::252     1e-58  48%  252 aa  UPPS_STRPN RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    3::230     2e-58  49%  233 aa  UPPS_THEMA RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   28::269     2e-58  45%  275 aa  UPPS_SHEON RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    6::236     3e-58  48%  239 aa  UPPS_HAEIN RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   10::237     8e-58  51%  239 aa  UPPS_LACJO RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   10::240     1e-57  43%  244 aa  UPPS_RHOBA RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   22::252     1e-57  45%  252 aa  UPPS_OCEIH RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   13::249     3e-57  46%  258 aa  UPPS_XANCP RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   19::243     4e-57  48%  252 aa  UPPS_SALTY RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   19::243     4e-57  48%  252 aa  UPPS_SALPA RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    6::225     5e-57  46%  227 aa  UPPS_TREDE RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    2::236     9e-57  44%  237 aa  UPPS_HELHP RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   19::243     1e-56  48%  252 aa  UPPS_SALTI RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    5::236     1e-56  42%  238 aa  UPPS_LEGPA RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   17::243     1e-56  48%  253 aa  UPPS_ERWCT RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    5::236     5e-56  42%  238 aa  UPPS_LEGPL RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    5::236     5e-56  42%  238 aa  UPPS_LEGPH RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   19::257     8e-56  45%  257 aa  UPPS_FRATT RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   10::241     1e-55  48%  244 aa  UPPS_LACAC RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   19::255     3e-55  43%  260 aa  UPPS_SYNPX RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   19::252     3e-55  45%  253 aa  UPPS_CHLTR RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   60::294     7e-55  42%  296 aa  UPPS_MYCPF RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   14::248     9e-55  44%  249 aa  UPPS2_TROW8 RecName: Full=Undecaprenyl pyrophosphate synthetase 2; 
   14::248     9e-55  44%  249 aa  UPPS1_TROWT RecName: Full=Undecaprenyl pyrophosphate synthetase 1; 
   16::242     1e-54  46%  252 aa  UPPS_YERPS RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   16::242     1e-54  46%  252 aa  UPPS_YERPE RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   27::256     2e-54  44%  266 aa  UPPS_PROMA RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   23::257     3e-54  47%  259 aa  UPPS_LACPL RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   12::240     4e-54  44%  260 aa  UPPS_WIGBR RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    4::227     5e-53  46%  230 aa  UPPS_FUSNN RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    8::228     6e-53  44%  228 aa  UPPS_WOLSU RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    7::240     6e-53  44%  240 aa  UPPS_PASMU RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   26::263     1e-52  42%  264 aa  UPPS_BIFLO RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    5::231     1e-52  45%  231 aa  UPPS_AQUAE RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   14::243     1e-52  44%  244 aa  UPPS_LACLA RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    1::242     3e-52  43%  249 aa  UPPS_ACIAD RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    8::242     4e-52  43%  245 aa  UPPS2_CORDI RecName: Full=Undecaprenyl pyrophosphate synthetase 2; 
    5::231     5e-52  43%  231 aa  UPPS_AQUPY RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    5::224     1e-51  45%  226 aa  UPPS_RICBR RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   18::244     1e-51  45%  251 aa  UPPS_BUCAI RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   77::295     6e-51  45%  310 aa  DDPS2_ARATH RecName: Full=Dehydrodolichyl diphosphate synthase 2;  
   67::299     1e-50  41%  302 aa  DDPS5_ARATH RecName: Full=Dehydrodolichyl diphosphate synthase 5;  
   33::260     2e-50  42%  277 aa  UPPS1_STRCO RecName: Full=Undecaprenyl pyrophosphate synthetase 1; 
    5::224     5e-50  44%  226 aa  UPPS_RICSI RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   14::233     5e-50  44%  235 aa  UPPS_RICCN RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   21::254     8e-50  44%  255 aa  UPPS_METTH RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   17::249     8e-50  44%  250 aa  UPPS_CHLCV RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    5::224     1e-49  43%  226 aa  UPPS_RICTY RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   14::233     1e-49  44%  235 aa  UPPS_RICFE RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    6::232     1e-49  41%  234 aa  UPPS_HELPY RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   45::279     2e-49  46%  280 aa  UPPS_METJA RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    6::232     3e-49  41%  234 aa  UPPS_HELPJ RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    6::238     4e-49  39%  241 aa  UPPS_LEPIN RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    6::238     4e-49  39%  241 aa  UPPS_LEPIC RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    6::242     4e-49  39%  243 aa  UPPS2_CORGL RecName: Full=Undecaprenyl pyrophosphate synthetase 2; 
   34::261     9e-49  41%  285 aa  UPPS2_STRAW RecName: Full=Undecaprenyl pyrophosphate synthetase 2; 
   26::262     4e-48  44%  263 aa  UPPS_THET8 RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   26::262     4e-48  44%  263 aa  UPPS_THET2 RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    5::224     5e-48  42%  226 aa  UPPS_RICPR RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   54::287     2e-47  39%  289 aa  DDPS4_ARATH RecName: Full=Dehydrodolichyl diphosphate synthase 4;  
   17::250     2e-47  41%  251 aa  UPPS_BUCBP RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   20::247     2e-47  40%  249 aa  UPPS_BUCAP RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   67::299     2e-47  40%  302 aa  DDPS3_ARATH RecName: Full=Dehydrodolichyl diphosphate synthase 3;  
   21::252     4e-47  40%  253 aa  UPPS_CHLMU RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   17::249     5e-47  41%  250 aa  UPPS_CHLAB RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   67::300     5e-47  38%  303 aa  DDPS1_ARATH RecName: Full=Dehydrodolichyl diphosphate synthase 1;  
   41::270     7e-47  44%  271 aa  UPPS_METKA RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   34::263     1e-46  42%  264 aa  UPPS_PYRAB RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   34::263     2e-46  42%  264 aa  UPPS_PYRFU RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   34::263     2e-45  41%  264 aa  UPPS_PYRHO RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   28::256     8e-45  39%  257 aa  UPPS1_STRAW RecName: Full=Undecaprenyl pyrophosphate synthetase 1; 
   18::249     2e-44  39%  250 aa  UPPS_CHLPN RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    7::241     2e-44  38%  243 aa  UPPS2_COREF RecName: Full=Undecaprenyl pyrophosphate synthetase 2; 
   25::254     5e-44  41%  255 aa  UPPS_PICTO RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   40::273     2e-43  40%  274 aa  UPPS_DEIRA RecName: Full=Undecaprenyl pyrophosphate synthetase;    
  323::556     3e-43  40%  564 aa  CRUP_STRCO RecName: Full=Bifunctional protein crtB/uppS;Includes:
   33::263     4e-43  40%  264 aa  UPPS_PYRKO RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    2::227     6e-43  38%  228 aa  UPPS_TREPA RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   13::232     3e-42  42%  246 aa  UPPS1_BRAJA RecName: Full=Undecaprenyl pyrophosphate synthetase 1; 
    9::237     2e-41  41%  238 aa  UPPS_PYRAE RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   35::264     2e-41  41%  265 aa  UPPS1_CORDI RecName: Full=Undecaprenyl pyrophosphate synthetase 1; 
   19::259     9e-41  40%  259 aa  UPPS_STRFR RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   24::255     2e-40  40%  298 aa  UPPS_METMA RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   17::245     2e-40  39%  251 aa  UPPS_ARCFU RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    3::224     5e-40  42%  225 aa  UPPS1_CORGL RecName: Full=Undecaprenyl pyrophosphate synthetase 1; 
   24::255     6e-40  39%  298 aa  UPPS_METAC RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   27::261     1e-39  38%  262 aa  ZFPP_MYCBO RecName: Full=Short-chain Z-isoprenyl diphosphate
   29::257     4e-39  37%  258 aa  UPPS_THEAC RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   27::261     7e-39  38%  262 aa  ZFPP_MYCTU RecName: Full=Short-chain Z-isoprenyl diphosphate
   25::261     1e-38  38%  262 aa  ZFPP_MYCLE RecName: Full=Short-chain Z-isoprenyl diphosphate
   18::248     1e-38  35%  250 aa  UPPS_BLOFL RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   28::262     7e-38  34%  264 aa  YE54_SCHPO RecName: Full=Uncharacterized protein C4D7.04c;
   32::262     1e-37  39%  262 aa  UPPS_SULAC RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   25::250     1e-37  39%  302 aa  UPPS_HALSA RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   29::257     6e-37  37%  258 aa  UPPS_THEVO RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   26::255     6e-37  41%  256 aa  UPPS1_COREF RecName: Full=Undecaprenyl pyrophosphate synthetase 1; 
   25::247     1e-36  38%  333 aa  DHDDS_HUMAN RecName: Full=Dehydrodolichyl diphosphate synthase;    
   32::262     1e-36  37%  262 aa  UPPS_SULTO RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   22::251     9e-36  36%  304 aa  UPPS_HALMA RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    5::221     9e-36  36%  222 aa  UPPS_CAMJR RecName: Full=Undecaprenyl pyrophosphate synthetase;    
    5::221     9e-36  36%  222 aa  UPPS_CAMJE RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   25::254     4e-35  36%  333 aa  DHDDS_MOUSE RecName: Full=Dehydrodolichyl diphosphate synthase;    
   31::262     4e-34  36%  262 aa  UPPS_SULSO RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   28::258     4e-33  37%  258 aa  UPPS2_TROWT RecName: Full=Undecaprenyl pyrophosphate synthetase 2; 
   27::257     9e-33  38%  258 aa  UPPS2_STRCO RecName: Full=Undecaprenyl pyrophosphate synthetase 2; 
   28::258     1e-32  37%  258 aa  UPPS1_TROW8 RecName: Full=Undecaprenyl pyrophosphate synthetase 1; 
    3::229     3e-31  30%  230 aa  UPPS_BORBU RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   39::278     7e-31  36%  295 aa  DDPS6_ARATH RecName: Full=Dehydrodolichyl diphosphate synthase 6;  
   24::239     2e-27  37%  286 aa  RER2_YEAST RecName: Full=Dehydrodolichyl diphosphate synthetase;   
   66::299     2e-26  36%  343 aa  SRT1_YEAST RecName: Full=Putative dehydrodolichyl diphosphate
   35::245     4e-25  31%  272 aa  DDPS8_ARATH RecName: Full=Dehydrodolichyl diphosphate synthase 8;  
   34::269     5e-23  32%  271 aa  DDPS7_ARATH RecName: Full=Dehydrodolichyl diphosphate synthase 7;  
    4::218     7e-20  32%  219 aa  UPPS_AERPE RecName: Full=Undecaprenyl pyrophosphate synthetase;    
   74::255     3e-18  34%  270 aa  RER2_ENCCU RecName: Full=Dehydrodolichyl diphosphate synthetase;   
  183::292     4e-09  26%  293 aa  NGBR_HUMAN RecName: Full=Nogo-B receptor;       
  203::296     5e-07  28%  297 aa  NGBR_MOUSE RecName: Full=Nogo-B receptor;       
  162::257     1e-05  29%  258 aa  UPPS_SCHPO RecName: Full=Probable undecaprenyl pyrophosphate
  112::273     2e-05  20%  274 aa  NGBR_DANRE RecName: Full=Nogo-B receptor;       
  250::367     6e-05  27%  375 aa  UPPS_YEAST RecName: Full=Probable undecaprenyl pyrophosphate
    1::247

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MPTTTRSSIPEHVAIIMDGNGRWAKQRGLPRVMGHRRGVEAVRETVRAAGDCGISYLTLFAFSSENWRRP
UPPS_AGRT5      MPTTTRSSIPEHVAIIMDGNGRWAKQRGLPRVMGHRRGVEAVRETVRAAGDCGISYLTLFAFSSENWRRP
UPPS_RHIME      ------ANVPAHVAIIMDGNGRWANARGLPRTMGHRKGVEAVRGAVRTAAEIGIRYLTLFAFSSENWNRP
UPPS_BRUSU      -------SDPRHIAIIMDGNGRWAKARGLPRSAGHRAGVEALREIVRAAGDRGLGYLTLFAFSSENWTRP
UPPS_BRUME      -------SDPRHIAIIMDGNGRWAKARGLPRSAGHRAGVEALREIVRAAGDRGLGYLTLFAFSSENWTRP
UPPS_BRUAB      -------SDPRHIAIIMDGNGRWAKARGLPRSAGHRAGVEALREIVRAAGDRGLGYLTLFAFSSENWTRP
UPPS_RHILO      ---------PAHVAIIMDGNGRWAKARGMPRLAGHRAGVEALRKTVRAAPDLGISFLTVYAFSSENWSRP
UPPS2_BRAJA     -----RSDAPAHVAIIMDGNGRWAAARGLPRAEGHRRGVEALRRVVRASHELGIRYLTIFSFSSENWSRP
UPPS_PHOPR      --------LPKHVAVIMDGNGRWAKAKGKARVFGHKAGVEAVRKSVTTANRLGVKVLTLFAFSSENWRRP
UPPS_VIBF1      --------LPKHIAVIMDGNGRWAKAQGKPRVFGHKAGVDAVRKTISAASKLGINAITLFAFSSENWRRP
UPPS_THETN      -----KTRLPQHVGIIMDGNGRWAQKRGMPRVYGHKAGVNAVREVIRSCRELGIKYLTLYAFSTENWKRP
UPPS_GEOKA      -----RHPMPNHVAIIMDGNGRWAKKRALPRAAGHYEGMQVVRKITRFANELGIQILSLYAFSTENWKRP
UPPS_CLOPE      --------MPKHIAIIMDGNGRWAKKRGLPRTMGHRAGVKTIKTIVKECDKLGVKYLTLYAFSTENWKRP
UPPS_HELMO      --------IPKHIAIIMDGNGRWAKRRGLPRVAGHRAGVESLRRVLEVCEDYNIAYLTVYAFSTENWKRP
UPPS_CHRVO      ---------PRHIAIIMDGNGRWAKKRFLPRVAGHKRGLDAVREVVKACKEMGVGYLTLFAFSTENWRRP
UPPS_VIBPA      -------SLPKHIAIIMDGNGRWAKSKGKPRVFGHKKGVNAVRKTVAAASKLGIKAMTLFAFSSENWRRP
UPPS_CLOTE      -------NIPKHIAIIMDGNGRWAKERKLPRSLGHKAGVETIRDIVKECNNIGVRYLTLYAFSTENWKRP
UPPS_GEOSL      --------LPRHLAIIMDGNGRWAQERMLTRIIGHQKGVETVRIIVEECSRLGIGYLTLFAFSAENWLRP
UPPS_BACSK      -------NIPRHVAIIMDGNGRWAKEKGLPRIAGHREGMKTVNKIVRAANTLNIEILTLYAFSTENWKRP
UPPS_BACCR      --------IPEHIAIIMDGNGRWAKRRAMPRIAGHHEGMQVVKKITKFASKLNVKVLTLYAFSTENWKRP
UPPS_BACHK      --------IPEHIAIIMDGNGRWAKRRAMPRIAGHHEGMQVVKKITKFASKLNVKVLTLYAFSTENWKRP
UPPS_BACAN      --------IPEHIAIIMDGNGRWAKRRAMPRIAGHHEGMQVVKKITKFASKLNVKVLTLYAFSTENWKRP
UPPS_BACC1      --------IPEHIAIIMDGNGRWAKRRAMPRIAGHHEGMQVVKKITKFASKLNVKVLTLYAFSTENWKRP
UPPS_VIBCH      --------LPKHIAVIMDGNGRWAKAQGKPRVFGHKNGVAAVRKTISTSARLGIKAVTLFAFSSENWRRP
UPPS_HAEDU      ------SNMPQHVAIIMDGNGRWAKKQGKLRVFGHQNGVNAVRAAVHFAAKYGIKVLTLYAFSSENWNRP
UPPS_PSEPK      ------SSVPRHVAIIMDGNNRWAKKRLLPGVAGHKAGVDAVRAVIEVCAKSGVEVLTLFAFSSENWQRP
UPPS_STAS1      -------NIPEHVAIIMDGNGRWAKQRKLPRIKGHYQGMQTVKKITKVASDIGIKYLTLYAFSTENWTRP
UPPS_BACTN      -----KNRIPQHIAIIMDGNGRWAKQRGKERTYGHQAGAETVHKIIEDAARLGVKYLTLYTFSTENWNRP
UPPS_VIBVY      -------SLPKHIAIIMDGNGRWAKSKGQPRVFGHKKGVSAVRKTIAAASKLNIQAITLFAFSSENWRRP
UPPS_VIBVU      -------SLPKHIAIIMDGNGRWAKSKGQPRVFGHKKGVSAVRKTIAAASKLNIQAITLFAFSSENWRRP
UPPS_SYNY3      -PDLDQQRLPQHVAVIMDGNGRWAKQRGMPRIMGHQRGVDSLKNLLRCCDDWGIAALTAYAFSTENWGRP
UPPS_XANOR      -PVPPVADVPRHIAIIMDGNGRWAQRRRRPRVIGHRAGARAVNRTIDFCLEKGVSALTLFAFSSENWGRP
UPPS_STAES      -------NIPEHVAIIMDGNGRWAKKRKMPRIKGHYEGMQTIKKITREASDIGIKYLTLYAFSTENWSRP
UPPS_STAEQ      -------NIPEHVAIIMDGNGRWAKKRKMPRIKGHYEGMQTIKKITREASDIGIKYLTLYAFSTENWSRP
UPPS_STAAW      ------SNIPEHIAIIMDGNGRWAKKRKMPRIKGHYEGMQTIKKITRVASDIGVKYLTLYAFSTENWSRP
UPPS_STAAS      ------SNIPEHIAIIMDGNGRWAKKRKMPRIKGHYEGMQTIKKITRVASDIGVKYLTLYAFSTENWSRP
UPPS_STAAR      ------SNIPEHIAIIMDGNGRWAKKRKMPRIKGHYEGMQTIKKITRVASDIGVKYLTLYAFSTENWSRP
UPPS_STAAC      ------SNIPEHIAIIMDGNGRWAKKRKMPRIKGHYEGMQTIKKITRVASDIGVKYLTLYAFSTENWSRP
UPPS_ANAVT      -----RELLPKHVAVIMDGNGRWAKRQGLPRIMGHKRGVDALKDLLRCCRDWGIQALTAYAFSTENWKRP
UPPS1_ANASP     -----RELLPKHVAVIMDGNGRWAKRQGLPRIMGHKRGVDALKDLLRCCRDWGIQALTAYAFSTENWKRP
UPPS_XANAC      ------AAVPRHIAIIMDGNGRWAQRRRRPRVIGHRAGARAVNRTIDFCLEKGVSALTLFAFSSENWGRP
UPPS_STAAN      ------SNIPEHIAIIMDGNGRWAKKRKMPRIKGHYEGMQTIKKITRIASDIGVKYLTLYAFSTENWSRP
UPPS_STAAM      ------SNIPEHIAIIMDGNGRWAKKRKMPRIKGHYEGMQTIKKITRIASDIGVKYLTLYAFSTENWSRP
UPPS_MICLU      ---------PKHIAIIMDGNGRWAKQKKMPRIKGHYEGMQTVKKITRYASDLGVKYLTLYAFSTENWSRP
UPPS_PSESM      ------SSVPRHVAIIMDGNNRWARKRLLPGVAGHKAGVDAVRAVIEVCAEAKVEVLTLFAFSSENWQRP
UPPS_THEEB      -----RDRLPRHVAVIMDGNGRWAKQRNLPRIMGHQRGVDTLKDLLRCCKDWGIEALTAYAFSTENWGRP
UPPS_NEIMB      ------TAIPKHIAVIMDGNGRWAKKRFLPRIMGHKRGLDALENMVKHCAKLGVQYLTVFAFSTENWRRP
UPPS_NEIG1      ------TAIPRHIAVIMDGNGRWAKKRFLPRIMGHKRGLDALENMVKHCAKLGVQYLTVFAFSTENWRRP
UPPS_CLOAB      ------SNIPKHIAIIMDGNGRWAKKRNLPRTMGHKAGGEALKRIVRECSDIGVKYLTVYGFSTENWIRP
UPPS_NEIMA      ------TAIPKHIAVIMDGNGRWAKKRFLPRIMGHKRGLDALENMVKHCAKLGVQYLTVFAFSTENWRRP
UPPS_BACHD      ------SAIPKHVAIIMDGNGRWAKKKGLPRIAGHREGMKVINKIVRKAIDLKIEVLSLYAFSTENWKRP
UPPS_PORGI      --------VPRHIALVMDGNGRWAKIRGKERCEGHXXXXXXXXXXXXXXXXCGVEYLTAYTFSTENWNRP
UPPS_CHLTE      ---TLKSSLPRHIGIIMDGNGRWAKIKGKSRIAGHVAGVESVRDVVEASSQLGIENLTLFTFSIENWKRP
UPPS_STAHJ      -------NLPEHVAIIMDGNGRWAKKRKMPRIKGHYEGMQTIKTVTREASDLGIKYLTLYAFSTENWSRP
UPPS_RALSO      ---------PHHVAIIMDGNGRWATERHLPRMAGHSRGLDAVRAAVQAADHRGVRYLTLFAFSSENWRRP
UPPS2_ANASP     -PDLDPQKIPQHIAVIMDGNGRWATSRGLPRIAGHRQGARTLKELLRCCKDWGIKALTAYAFSTENWQRP
UPPS_STRMU      ------SKIPAHIGIIMDGNGRWAKKRMKPRVFGHKAGMDALQDVTIAASELGVKILTVYAFSTENWARP
UPPS_STRA5      --------IPAHIGIIMDGNGRWAKKRLKPRVMGHKAGMDALQEVTIAASGLGVKVLTVYAFSTENWSRP
UPPS_STRA3      --------IPAHIGIIMDGNGRWAKKRLKPRVMGHKAGMDALQEVTIAASGLGVKVLTVYAFSTENWSRP
UPPS_NITEU      -PSSTRGAIPKHIAIIMDGNGRWARKRFLPRIAGHTQGVEAVRGTIKACIERGVSHLTIFAFSSENWRRP
UPPS_PROMP      -----KERIPEHIAIIMDGNGRWATKKGLPRSFGHNKGVSVLKEIIKASKNIDCKVLTVYAFSTENWIRP
UPPS_COXBU      --------IPRHVAIVMDGNGRWANRRGLPRVAGHRAGAKVVRRIVEYAAEKPLEVLTLFAFSIENRARP
UPPS_STRP8      -------SIPKHIGIIMDGNGRWAKKRLKPRVFGHKAGMDALQEVTITASELGVKVLTVYAFSTENWSRP
UPPS_STRP6      -------SIPKHIGIIMDGNGRWAKKRLKPRVFGHKAGMDALQEVTITASELGVKVLTVYAFSTENWSRP
UPPS_STRT2      -------NIPNHIGIIMDGNGRWAKKRLQPRVMGHKAGMDALQKVTIEASQLGVKVLTVYAFSTENWSRP
UPPS_STRT1      -------NIPNHIGIIMDGNGRWAKKRLQPRVMGHKAGMDALQKVTIEASQLGVKVLTVYAFSTENWSRP
UPPS_LISIN      --------IPRHVAIIMDGNGRWAKKRFLPRIAGHKEGMDVVKRVTRYANAIGIDVLTLYAFSTENWKRP
UPPS_GLOVI      --------LPRHVAAIMDGNGRWASKRNLPRVMGHQAGVSALKELLRCCKDWGIGALTVYAFSTENWKRP
UPSS_MYCBO      -PRIPADRLPNHVAIVMDGNGRWATQRGLARTEGHKMGEAVVIDIACGAIELGIKWLSLYAFSTENWKRS
UPPS_ZYMMO      ----------------MDGNGRWASARHLPRIAGHKKGADAVKTTVRAAAEMGIEVLTLYAFSSENWRRP
UPPS_STRP1      -------SIPKHIGIIMDGNGRWAKKRLKPRVFGHKAGMDALQEVTITASELGVKVLTVYAFSTENWSRP
UPPS_MYCTU      -PRIPADRLPNHVAIVMDGNGRWATQRGLARTEGHKMGEAVVIDIACGAIELGIKWLSLYAFSTENWKRS
UPPS_MYCLE      -PRLSAAQLPTHVAIVMDGNGRWANQRGLHRTEGHKMGEAVVIDVACGAIELGIKWLSLYAFSTENWKRS
UPPS_BORPE      --------IPRHVAIIMDGNGRWATRRHLPRTAGHAKGVHAVRRVVEACGRRGVRYLTLFAFSSENWRRP
UPPS_BORPA      --------IPRHVAIIMDGNGRWATRRHLPRTAGHAKGVHAVRRVVEACGRRGVRYLTLFAFSSENWRRP
UPPS_BORBR      --------IPRHVAIIMDGNGRWATRRHLPRTAGHAKGVHAVRRVVEACGRRGVRYLTLFAFSSENWRRP
UPPS_BACSU      -----KGEIPEHIAIIMDGNGRWAKKRSLPRIAGHHEGMKVVKRTTKLANELGVKVLTLYAFSTENWKRP
UPPS_XYLFT      -------TLPRHIAIIMDGNGRWAERRSRPRTTGHRAGVKAAMRTVDFCLEKGIKMLTLFAFSSENWNRP
UPPS_XYLFA      -------TLPRHIAIIMDGNGRWAERRSRPRTTGHRAGVKAAMRTVDFCLEKGIKMLTLFAFSSENWNRP
UPPS_STRP3      --------IPKHIGIIMDGNGRWAKKRLKPRVFGHKAGMDALQEVTITASELGVKVLTVYAFSTENWSRP
UPPS_CAUCR      -----------HVAIIMDGNGRWAKQRGMPRVLGHRAGVNALKRTVEGAQSQNVGVLTVFGFSTENWSRP
UPPS_LISMF      --------IPRHVAIIMDGNGRWAKKRFLPRIAGHKEGMDVVKRVTRYANAIGIDVLTLYAFSTENWKRP
UPPS_SHIFL      -----------HVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFSSENWNRP
UPPS_PHOLL      ------SLLPKHVAIIMDGNGRWAKKRGKLRAFGHRAGIKAVRSAVSFSAKHNIESLTLYAFSSENWNRP
UPPS_LISMO      --------IPRHVAIIMDGNGRWAKKRFLPRIAGHKEGMDVVKRVTRYANAIGIDVLTLYAFSTENWKRP
UPPS_ECOLI      -----------HVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFSSENWNRP
UPPS_ECOL6      -----------HVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFSSENWNRP
UPPS_ECO57      -----------HVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFSSENWNRP
UPPS_PSEAE      --------VPRHVAIIMDGNNRWAKKRLLPGVAGHKAGVDAVRAVIEVCAEAGVEVLTLFAFSSENWQRP
UPPS_ENTFA      --------IPQHIAIIMDGNGRWAQNRRLPRIAGHKEGMDTVKKITKHASHLGVKVLTLYAFSTENWKRP
UPPS_PROMM      --------LPNHVAVIMDGNGRWAKARGLPRMVGHRAGVEALKRTLRLCSDWGIGALTAYAFSTENWSRP
UPPS_STRR6      ------TQVPAHIGIIMDGNGRWAKKRMQPRVFGHKAGMEALQTVTKAANKLGVKVITVYAFSTENWTRP
UPPS_STRPN      ------TQVPAHIGIIMDGNGRWAKKRMQPRVFGHKAGMEALQTVTKAANKLGVKVITVYAFSTENWTRP
UPPS_THEMA      --------IPQHVAIIMDGNGRWAKKRGLPRIKGHQRGAEVLHNTVKWSLELGIKYLTAFSFSTENWKRP
UPPS_SHEON      LPELVKQSLPKHVAIIMDGNGRWAQTQGKPRVMGHXXXXXXXXXXXXXXXQLGIQSLTLFAFSSENWRRP
UPPS_HAEIN      -----QTNIPKHVAIIMDGNGRWAKQKNKMRIFGHTNGVTAVRKAVAYARQIGVEVLTLYAFSSENWSRP
UPPS_LACJO      -----------HLAIIMDGNGRWAKKRHLPRFVGHRHGMDNIRNIALAANKLGIKVLTLYAFSTENWARP
UPPS_RHOBA      -------NLPRHVAIIMDGNGRWAQARDLPRIEGHXXXXXXXXXXXEMASELKLDALTLYCLSSENWKRP
UPPS_OCEIH      -------NIPSHIAIIMDGNGRWAQKRGLPRIAGHREGVSTVNRIVKTAVNANVKVLTLYTFSTENWKRP
UPPS_XANCP      ------AAVPRHLAIIMDGNGRWAQRRRRPRVIGHRAGARAVNRTIDFCLDKGVSALTLFAFSSENWGRP
UPPS_SALTY      -----------HVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIDALTLYAFSSENWNRP
UPPS_SALPA      -----------HVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIDALTLYAFSSENWNRP
UPPS_TREDE      ----------KHIAIVMDGNGRWAKKRGLPRSMGHKEGLNTVKRITKAVSDLGIPYITLYIFSTENWKRT
UPPS_HELHP      -----KPSYPQHIAVIMDGNGRWAKKQGKKRTQGHKEGAKIVRDITQWCAEKGIPYLTLYAFSTENWKRP
UPPS_SALTI      -----------HVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIDALTLYAFSSENWNRP
UPPS_LEGPA      --------LPQHIAVVMDGNGRWAESRGLPRVEGHKAGLDSVKKIINCCLEKKISCLSLFAFSSENWSRP
UPPS_ERWCT      ---------PRHVAIIMDGNGRWAKSRGKMRIFGHQAGVKAVRRSVSFAVNHGLDALTLYAFSSENWNRP
UPPS_LEGPL      --------LPQHIAVVMDGNGRWAESRGLPRVEGHKAGLDSVKKIINCCLEKKISCLSLFAFSSENWSRP
UPPS_LEGPH      --------LPQHIAVVMDGNGRWAESRGLPRVEGHKAGLDSVKKIINCCLEKKISCLSLFAFSSENWSRP
UPPS_FRATT      --TSAKENILRHLAIIMDGNGRWAKSRLKPRIFGHRNSVSSVDATIEYCVENNIEMLTLFAFGRDNWLRP
UPPS_LACAC      -----------HLAIIMDGNGRWAKKRHKPRFVGHREGMDNVERITLAANQLGIKVLTLYAFSTENWARP
UPPS_SYNPX      -PELDGDRLPVHVAVIMDGNGRWAEARGLPRMMGHRAGVEALKSTLRLCSDWGIAALTAYAFSTENWSRP
UPPS_CHLTR      ------NSLPRHIAIIMDGNRRWQRKHEQRAISGHRQGADSIPQIVDTALHLGVEALTLFAFSTENFSRS
UPPS_MYCPF      -PQIPADQVPQHVAVVMDGNGRWATQRGLGRTEGHKMGEAVLIDITCGAIEIGIKHLTVYAFSTENWKRS
UPPS2_TROW8     -PHIPRKSLPRHVAVVMDGNGRWANQRNLPRIEGHKAGESALIDVVAGAVQVGVPYLSLYVFSTENWLRA
UPPS1_TROWT     -PHIPRKSLPRHVAVVMDGNGRWANQRNLPRIEGHKAGESALIDVVAGAVQVGVPYLSLYVFSTENWLRA
UPPS_YERPS      ---------PRHVAIIMDGNGRWAKNKGKLRVFGHKAGVKSVRRAVSFAAKHNLDALTLYAFSSENWNRP
UPPS_YERPE      ---------PRHVAIIMDGNGRWAKNKGKLRVFGHKAGVKSVRRAVSFAAKHNLDALTLYAFSSENWNRP
UPPS_PROMA      --------LPEHIAIIMDGNGRWANAKKLPRAMGHSAGVDALKQTLRLCNDWGIGVLTVYAFSTENWSRP
UPPS_LACPL      --------IPAHVAIIMDGNGRWAKARHLPRVAGHKEGMNTVKKITIAASDLGVKVLTLYAFSTENWKRP
UPPS_WIGBR      ---------PRHIAIIMDGNGRWAKNRGKLRIFGHKAGVESAKKAIKFAINNHLNALTLYAFSSENWKRP
UPPS_FUSNN      -------NIPKHIAIIMDGNGRWAKKRGLARSFGHMEGAKTLRKALEYLTEIGVKYLTVYAFSTENWNRP
UPPS_WOLSU      ----------KHLAIIMDGNGRWAQERGKQRVRGHEKGAETIREITMFCSKSDISFLTLYAFSTENWKRP
UPPS_PASMU      ------NNIPQHVAIIMDGNGRWAQQKGKMRIFGHKNGVKAVREAVSYARKVGIKVLTLYAFSSENWNRP
UPPS_BIFLO      IPDFPKNKVPRHIGVIMDGNGRWAKQRGMVRTNGHQAAEPVVFDTIAGAIEAGVRYLSLYTFSTENWKRS
UPPS_AQUAE      --------LPEHVAIIMDGNGRWARQRGLPRVAGHYRGAEVAEDIIEYCIELGIKHLTLFAFSTENWNRP
UPPS_LACLA      --------LPEHIGIIMDGNGRWAKQKGKPRIFGHKAGMDSLKDVAVHGARRGIKVMTVYAFSTENWTRP
UPPS_ACIAD      MTLSEESHLPKHVAIIMDGNNRFAKKNQMQKGDGHREGKNSLDPIVEHCCTRGVQALTVFAFSSENWNRP
UPPS2_CORDI     -PQIPQEFLPRHIALVMDGNGRWATNRGLKRTEGHKRGEAVLLDMVDACIAMGIPYLSAYAFSTENWRRS
UPPS_AQUPY      --------IPEHVAIIMDGNGRWARKRGLPRIAGHYKGAEVAEDIVEFAIELGIKHLTLFAFSTENWNRP
UPPS_RICBR      ----------KHLAIIMDGNARWAATHNLPKSEGHRAGADKVHELLPEFINLKIPYITLYTFSSENWQRS
UPPS_BUCAI      ---------PCHVAIIMDGNGRWATRQGKIRIMGHKEGFRAVKEAIKFSIANNLKILTLYAFSSENWNRP
DDPS2_ARATH     --------MPKHVAIIMDGNGRWAKNRGLQPWDGHRAGVEALKEIVELCGKWGIQVLTVFAFSTDNWIRP
DDPS5_ARATH     -----RNIMPKHVAVILDGNRRWAEKRGLGTSEGHEAGARRLMENAKDCFAMGTNTISLFAFSTENWERP
UPPS1_STRCO     --------VPEHVAIVMDGNGRWAKERGLPRTEGHKVGAEQVMDVLQGAIEMGVGNISLYAFSTENWKRS
UPPS_RICSI      ----------KHLAIIMDGNARWADQHNLTKSEGHKAGADKIRELLPEFLNLNIPYITLYTFSSENWQRS
UPPS_RICCN      ----------KHLAIIMDGNARWADQHNLTKSEGHKAGADKIRELLPEFLNLNIPYITLYTFSSENWQRS
UPPS_METTH      -----RDRMPRHVAIIMDGNRRYSKLQGMNPIEGHKKGIETLEKVLDWCVDLGIEIVTAYAFSTENFKRP
UPPS_CHLCV      -------SLPRHVAIIMDGNRRWHQQHQLKQTSGHYYGAKALPSIIESAFSLGIEVLTLFAFSTENFLRS
UPPS_RICTY      ----------KHLAIIMDGNARWADQHNLTKSEGHKAGADKIRELLPEFINLNIPYITLYTFSSENWQRS
UPPS_RICFE      ----------KHLAIIMDGNARWADQHNLTKSEGHKAGADKIRELLPEFINLNIPYITLYTFSSENWQRS
UPPS_HELPY      ----------KHLAIIMDGNGRWAKLKNKARAYGHKKGVKTLKDITIWCANHKLECLTLYAFSTENWKRP
UPPS_METJA      -----KDNLPKHVAIIMDGNRRAAEIYGKDRYYGHYLGAEKVREVLRWARDLGINVVTLYAFSTENFRRP
UPPS_HELPJ      ----------KHLAIIMDGNGRWAKLKNKARAYGHKKGVKTLKDITIWCANHKLECLTLYAFSTENWKRP
UPPS_LEPIN      ------SNLPKHIAVIMDGNGRWATSRGKSRSEGHREGAQAIDRLMDASLELGLKNISLYAFSTENWKRP
UPPS_LEPIC      ------SNLPKHIAVIMDGNGRWATSRGKSRSEGHREGAQAIDRLMDASLELGLKNISLYAFSTENWKRP
UPPS2_CORGL     VPEIPAQFLPKHIALVMDGNGRWATERGMKRTEGHKRGEAVLLDVVDACIELGVPYLSAYAFSTENWRRS
UPPS2_STRAW     --------IPNHVACVMDGNGRWAKERGLPRTEGHKVGEGVVMDVLKGCIELGVKNLSLYAFSTENWKRS
UPPS_THET8      -----RGPMPRHLGLILDGNRRYARALGLSPTKGHEFGVQKAYEVLEWCLEMGIKTVTVWVFSTDNFKRP
UPPS_THET2      -----RGPMPRHLGLILDGNRRYARALGLSPTKGHEFGVQKAYEVLEWCLEMGIKTVTVWVFSTDNFKRP
UPPS_RICPR      ----------KHLAIIMDGNARWADRHNLTKSEGHKAGADKIRELLPEFINLNIPYITLYTFSFENWQRS
DDPS4_ARATH     -----RELMPRHVAVIMDGNRRWAKQTGLLTSQGYEAGAKRLLEFADLCFKLGINTVSAFAFSTENWGRH
UPPS_BUCBP      -----KKNIPSHVAIIMDGNGKWARKRGKSRFFGHFSGFYAARRAISFALFHKLKILTLYAFSSDNWNRS
UPPS_BUCAP      -----------HIAIIMDGNGRWAEKRGKIRTLGHKEGFKTARKIIKYAVENNIKILTLYVFSRENWRRP
DDPS3_ARATH     -----RELMPRHVAVIMDGNRRWAKRAGLLTSQGHEAGAKRLIEFSELCFKLGIHTVSAFAFSTENWGRH
UPPS_CHLMU      --------LPKHIAIIMDGNRRWQKKHEQNAISGHRRGADSIPQIVDTAALLGVEALTLFAFSTENFSRS
UPPS_CHLAB      -------SLPKHVAIIMDGNRRWYRQHSIKSSSGHYYGAKVLPNIIESAFSLGIEVLTLFAFSTENFLRS
DDPS1_ARATH     -----RELMPRHVAFILDGNRRWAKRAGLTTSQGHEAGAKRLIDIAELCFELGVHTVSAFAFSTENWGRD
UPPS_METKA      --------VPEHVGIIMDGNRRFARELGLEPWEGHRYGADKLEDVLEWCLDLGVKAVTVYALSTENLNRP
UPPS_PYRAB      --------LPKHVAIIMDGNRRWAKKREKPPWYGHLFGSKKLEEILEWCHELGIRILTVYAFSTENFKRS
UPPS_PYRFU      --------IPKHVAIIMDGNRRWARKREKPPWYGHFFGSKKLEEIVEWCHELGIRILTVYAFSTENFKRS
UPPS_PYRHO      --------LPKHVAIIMDGNRRWARKHEKPPWYGHLFGSKKLEEILEWCHELGIRILTVYAFSTENFKRS
UPPS1_STRAW     --------VPKHIGVIMDGNRRWAKAAGSTTAQGHRAGADKIEEFLGWCSETDVGVVTLWLLSTDNFDRP
UPPS_CHLPN      --------LPNHVAIIMDGNRRWYKKHGHTHTSGHYYGAKVLPNILNAVLDLGIKVLTLYTFSTENFGRP
UPPS2_COREF     -PNIPAEFLPRHIALVMDGNGRWATEKGMKRTEGHRRGEXXXXXXXXXXXXXXXPYLSAYAFSTENWRRS
UPPS_PICTO      --------VPGHLGIITDGNRRYARSIGISENEGHVKGKEKLEEVLNWSMEVGIHMVTVYAFSTENFKRK
UPPS_DEIRA      --------LPRHLGLILDGNRRFARAAGLQREMGHSFGADKAHEVLQWCLELGIPSATIWVLSTDNGSRE
CRUP_STRCO      -----------HIAVIADGNRRWAEARGLLADQGHRAGIRAVLRLVNAAQRTGIRHVTVYMFSTENWYRS
UPPS_PYRKO      -------NIPKHVAIIMDGNRRWARKLEKPPWYGHLFGSKKLEEILEWCRELNIRTLTVYAFSTENFKRS
UPPS_TREPA      ----------QHVAIIMDGNGRWAEXXXXXXXXXXXXXLQTAREIVAALCAIRVPFVTLYVFSTENWKRS
UPPS1_BRAJA     -----------HVGIIMDGNGRWATRRGLSRLRGHEAGVETIRRIVEAAPKQGIGTLTLYAFSTDNWRRP
UPPS_PYRAE      --------IPTHIAVIPDGNRRYAKKTGIDFYHAYKKGVEKVRNFLTWALEFDIKNVTFFALSTENLQRS
UPPS1_CORDI     ---------PEHVAIMCDGNRRWAREAGFADVTGHRVGAKKIGEMVRWCAHTDVELVTVYLLSTENLGRA
UPPS_STRFR      ---TAAGPLPKHIGLIMDGNRRWARQMGMANPIGHRYGAEHVESVLSWCETAGIKHVTVFVCSTENLRRG
UPPS_METMA      ------SEIPEHIAVIMDGNRRYAGQLGKARIFGHAMGAEVTEQVIEWCYEIGVKQLTLYAFSTENFQRS
UPPS_ARCFU      -----KGAIPHHIAIIMDGNRRFARKKGLEPHEGHFFGSKKAEEVLEWCWDLGVKMLTLYAFSTENFRRS
UPPS1_CORGL     -----------------DGNRRWAREAGFTDVSGHRVGAKKIGEMVRWCDDVDVNLVTVYLLSMENLGRS
UPPS_METAC      ------SEIPDHIAVIMDGNRRYAGQRGRTRSFGHAMGAEVTEQVIEWCYEIGVKELTLYAFSTENFQRS
ZFPP_MYCBO      ----SKSDLPRHIAVLCDGNRRWARSAGYDDVSGYRMGAAKIAEMLRWCHEAGIELATVYLLSTENLQRD
UPPS_THEAC      ---------PRHIGIITDGNRRYARNVGISENXXXXXXXXXXXXXXDWCMELDIRIVTFYAFSTENFRRS
ZFPP_MYCTU      ----SKSDLPRHIAVLCDGNRRWARSAGYDDVSGYRMGAAKIAEMLRWCHEAGIELATVYLLSTENLQRD
ZFPP_MYCLE      --TASESRLPRHIAVLCDGNRRWARDAGYDDVSGYRMGAAKIAEMLRWCQEAGIEMTTVYLLSTENLQRD
UPPS_BLOFL      --------LPRHIAIIMDGNGRWARGRGKLRIVGHXXXXXXXXXXXXXXXHCRFNALTLYAFSSENWTRS
YE54_SCHPO      --TIKRGKVPQHIAFVMDGNRRWARQRRMETIEGHSSGFEALKSLLKVCLKLGVKEVSAFTFSIENFKRS
UPPS_SULAC      ---------PFHVGIIPDGNRRWARNNRLPLDQGYYTGYVKLRDVLTWILEIGISTVTVFALSAENCKRT
UPPS_HALSA      ---------PAHVAVIQDGNRRYAREHGDDPTDGYQSGARTTERVLEWCSDLGVEELTLYAFSTENFERP
UPPS_THEVO      ---------PRHVGIITDGNRRYARIVGIPENEGHVKGKNKVEEVLDWCMELDIKIVTFYAFSTENFKRS
UPPS1_COREF     ---------PGHVAIMCDGNRRWAREAGFVDLSGHRVGAKKIGELVRWCXXXXXXXXXXXXXSTENLGRD
DHDDS_HUMAN     --------MPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFKRS
UPPS_SULTO      ---------PQHVGIIPDGNRRWARANNLSINDAYYSGYRKLKQVLLWLLEMGIKNITVFALSTENCKRS
UPPS_HALMA      ------SGTPDHVAVIMDGNRRYAEKQGTKKQEGHKEGAQTTEALLNWCDELGIREVTLYTFSTENFDRD
UPPS_CAMJR      ----------KHLAVVMDGNRRWARAKGFLAKLGYSQGVKTMQKLMEVCMEENISNLSLFAFSTENWKRP
UPPS_CAMJE      ----------KHLAVVMDGNRRWARAKGFLAKLGYSQGVKTMQKLMEVCMEENISNLSLFAFSTENWKRP
DHDDS_MOUSE     --------VPKHIAFIMDGNRRYAKKCQVERQEGHTQGFNKLAETLRWCLNLGILEVTVYAFSIENFKRS
UPPS_SULSO      --------LPDHVGIIPDGNRRWARDNNLSLNDAYFYGYKKLKEVLIWLLELGIKNITVFVLSTENCKRK
UPPS2_TROWT     ------NNLPGHVALIVDGNRRWARKEKRDRISGHRAGAGKAVDFLHWCDELDINIVTLYLLSNDNLKRN
UPPS2_STRCO     ---------PQHIGIMLDGNRRWAKMSGIPRE-GYRAGGAKVLDFLRWCDSAQIEHVTLFMLSDDNLARP
UPPS1_TROW8     ------NNLPGHVALIVDGNRRWARKEKRDRISGHRAGAGKAVDFLHWCDELDINIVTLYLLSNDNLKRN
UPPS_BORBU      -----KGSLPSHVGIIMDGNRRWALGKRLSSLEGYKEGLKRAKEIVKYSLRVGIKCLSFYVFSTENWRRD
DDPS6_ARATH     --------IPCHIAFIMDGNRRYAKKCGLLDGSGHKAGFSALMSMLQYCYELGIKYVTIYAFSIDNFRRK
RER2_YEAST      ---TLRASVPRHVGFIMDGNRRFARKKEMDVKEGHEAGFVSMSRILELCYEAGVDTATVFAFSIENFKRS
SRT1_YEAST      --------VPEHVSFIMDGNRRYAKSRRLPVKKGHEAGGLTLLTLLYICKRLGVKCVSAYAFSIENFNRP
DDPS8_ARATH     --------IPTNISFIMDGNRRFAKKRNLEGLAGHRAGFISVKYILQYCKEIGVPYVTLYAFGMDNFKRG
DDPS7_ARATH     --------IPTNISFIMDGNRRFAKKHNLIGLAGHRAGFISVKYILQYCKEIGVPYVTLHAFGMDNFKRG
UPPS_AERPE      ---------PRAIGIIPDGNRRWASLRGENLYIAYYTGYRNVKRILTYIRDFAIRSVYLYVLSRDNCKRS
RER2_ENCCU      -----------NIAFICDGNRRYARKLGLEDSFIKDKGLQKIYEFIEFGCFYGIKEISFFCFALSNFKRS
NGBR_HUMAN      ----------------------------------------------------------------------
NGBR_MOUSE      ----------------------------------------------------------------------
UPPS_SCHPO      ----------------------------------------------------------------------
NGBR_DANRE      ----------------------------------------------------------------------
UPPS_YEAST      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ESEVSDLMGLLKAFIRRDLAELHRENVRVRIIGDRQGLKTDIRSLLEEAEQMTAGNTKLTLVIAFNYGSR
UPPS_AGRT5      ESEVSDLMGLLKAFIRRDLAELHRENVRVRIIGDRQGLKTDIRSLLEEAEQMTAGNTKLTLVIAFNYGSR
UPPS_RHIME      ENEVSDLMGLLKAFIRRDLADLHRENVRIRVIGDRSNLSGDILPLLIEAEETTIANTGITVVIAFNYGAR
UPPS_BRUSU      SGEVSDLLGLLKLFIRRDLAELHRNNVRVNIIGERAELAADIRALLNEAESLTHRNTGLNLVIAFNYGSR
UPPS_BRUME      SGEVSDLLGLLKLFIRRDLAELHRNNVRVNIIGERAELAANIRALLNEAESLTHRNTGLNLVIAFNYGSR
UPPS_BRUAB      SGEVSDLLGLLKLFIRRDLAELHRNNVRVNIIGERAELAANIRALLNEAESLTHRNTGLNLVIAFNYGSR
UPPS_RHILO      KAEVSDLMGLLKLFIRRDLAELHQSGVRVRIIGDRAGLQADIRGLLEEAESLTARNESLTLVIAFNYGGR
UPPS2_BRAJA     ASEIGDLFGLLRRFIRNDLASLHRDGVKVRIIGERDGLESDICALLNEAEELTRDNSRLTLVVAFNYGSR
UPPS_PHOPR      EDEVSLLMELFMTVLTREVKRLHKNNIQLRIIGDKSGFSERLQRKIATSEALTANNTGLVLNIAANYGGQ
UPPS_VIBF1      EEEVSVLMELFITVLSREVKRLHKNNIQLRIIGETSQFSSRLQKKIVEAETLTSENTGLVLNVAANYGGK
UPPS_THETN      KEEVDFLMDLLVEYLSKEVDELNKNNVVVKFIGDISRLPEKCQIEIEKAQKLTEKNTGLVVNIALNYGGR
UPPS_GEOKA      KSEVDYLMKLPEQFLTTFLPELVAENVKVQVIGHTEALPDHTRRAVEKAVKETSGNTGLVLNFALNYGSR
UPPS_CLOPE      EDEVNALMKLVVEFIKNEIDELHQNGVRVQTIGDLSRFPEEPKKAILWAMEKTKDNTGVVLSLALNYGGR
UPPS_HELMO      ADEVNALFDLLVEYLHRELNTLHSKGVRIRAIGKIEDLPGGPRRELEKAIAKTANNTRLVLNVALNYGGR
UPPS_CHRVO      QEEVSFLMDLFLRALEHEVAKLHNNNIRLKVLGSRERFSAELSERIDRAEAKTAGNDGLVLTIAADYGGR
UPPS_VIBPA      EEEVGLLMELFITVLSSEVKKLHKNNLQLRVIGDTSRFSERLQKKIVEAENLTASNTGMVINIAANYGGK
UPPS_CLOTE      KEEINALMELLVNYLRKEVAELHQNNVVVNTIGDVSKLPKACEDELMKAYNKTKNNTGLVLNLALNYGGR
UPPS_GEOSL      KTEVKALMALLKKYIASEAARMDANNIRFNVIGNRDELPPDVNKAVQGAIDRTSGNTGMILTLALSYGAR
UPPS_BACSK      KAEVEFLLKLPERYLKSELPTLIEENVQVRLMGSKDGLPSYTLHAVDEAIEKTKHNTGLILNFALNYGSR
UPPS_BACCR      KKEVDYLMKLPEEFLGTFLPELIEENVQVRVIGQKDRLPTHTRRAMEKAMEDTKENTGLILNFALNYGSR
UPPS_BACHK      KKEVDYLMKLPEEFLGTFLPELIEENVQVRVIGQQDRLPTHTRRAMEKAMEETKENTGLILNFALNYGSR
UPPS_BACAN      KKEVDYLMQLPEEFLGTFLPELIEENVQVRVIGQQDRLPTHTRRAMEKAMEETKENTGLILNFALNYGSR
UPPS_BACC1      KKEVDYLMKLPEEFLGTFLPELIEENVQVRVIGQQDRLPTHTRRAMEKAMEETKENTGLILNFALNYGSR
UPPS_VIBCH      EEEVGVLMELFMTVLSTEIKKLHKNNLRLRVIGDKSRFSERLQTKIAQAEQLTASNTGMVVNIAANYGGQ
UPPS_HAEDU      ATEVSALMSLFIQALNTEVSKLHKHNIRLNILGDKTRFSDSLQKRIIESETLTAHNTRLTLNIAANYGSH
UPPS_PSEPK      AEEVGALMELFFSALRREAKRLDENNISLRIIGDRSRFHPELQAAMREAEAVTAGNNRFILQIAANYGGQ
UPPS_STAS1      ENEVNYIMNLPVNFLKTFLPELIENNVKVETIGFMEYLPSSTLKAIAKAKEDTKDNTGLKLIFAINYGGR
UPPS_BACTN      QEEVAALMNLLVDSIEEET--LMKNNIRFRIIGDIKKLPAEVQEGLSRCIEHTANNTGTCLVLALSYSSR
UPPS_VIBVY      EEEVGLLMELFITVLSSEVKKLHKNNLRLRIIGDTSRFSERLQKKIVEAQELTASNTGMVINVAANYGGK
UPPS_VIBVU      EEEVGLLMELFITVLSSEVKKLHKNNLRLRIIGDTSRFSERLQKKIVEAQELTASNTGMVINVAANYGGK
UPPS_SYNY3      LEEVEFLMTLFERVLRRELKEMMAENVRIRFVGNLTSLPRSLQDEIARSMEDTKNNTGIRFTVATNYGGR
UPPS_XANOR      QDEVDALMKLFLHALDREVGELQRRGVQVRFIGDRSRFAAPLRDRMAGAERSTAANARLVLSIAASYGGR
UPPS_STAES      ESEVNYIMNLPVNFLKTFLPELIEKNVKIETIGFYEGLPQSTIDAIDFAKAKTQHNTGLTLVFAINYGGR
UPPS_STAEQ      ESEVNYIMNLPVNFLKTFLPELIEKNVKIETIGFYEGLPQSTIDAIDFAKAKTQHNTGLTLVFAINYGGR
UPPS_STAAW      ESEVNYIMNLPVNFLKTFLPELIEKNVKVETIGFTDKLPKSTIEAINNAKEKTANNTGLKLIFAINYGGR
UPPS_STAAS      ESEVNYIMNLPVNFLKTFLPELIEKNVKVETIGFTDKLPKSTIEAINNAKEKTANNTGLKLIFAINYGGR
UPPS_STAAR      ESEVNYIMNLPVNFLKTFLPELIEKNVKVETIGFTDKLPKSTIEAINNAKEKTANNTGLKLIFAINYGGR
UPPS_STAAC      ESEVNYIMNLPVNFLKTFLPELIEKNVKVETIGFTDKLPKSTIEAINNAKEKTANNTGLKLIFAINYGGR
UPPS_ANAVT      QEEVEFLMTLFQRVLRQELREMVEENVQIQFVGNLAALPRSLQAEISRSMEATKNNRGIRFSVATNYGGR
UPPS1_ANASP     QEEVEFLMTLFQRVLRQELREMVEENVQIQFVGNLTALPRSLQAEISRSMEETKNNRGIRFSVATNYGGR
UPPS_XANAC      QDEVDALMKLFLHALDREVEELQRRGVQVRFIGDRSRFAAPLRDRMAGAERSTAANSRLVLSIAASYGGR
UPPS_STAAN      ESEVNYIMNLPVNFLKTFLPELIEKNVKVETIGFTDKLPKSTIEAINNAKEKTANNTGLKLIFAINYGGR
UPPS_STAAM      ESEVNYIMNLPVNFLKTFLPELIEKNVKVETIGFTDKLPKSTIEAINNAKEKTANNTGLKLIFAINYGGR
UPPS_MICLU      KDEVNYLMKLPGDFLNTFLPELIEKNVKVETIGFIDDLPDHTKKAVLEAKEKTKHNTGLTLVFALNYGGR
UPPS_PSESM      AEEVGALMELFFTALRRETKRLNENDISLRIIGDRSRFHPELQAAMREAEVRTSGNSRFVLQIAANYGGQ
UPPS_THEEB      LPEVEFLMTLFEQVLRRELGEMVAEGVQIHFVGDLTCLPKSLQAEIERAVAATANNQKIKFVVATNYGGR
UPPS_NEIMB      EDEVSFLMGLFLQALQKQVRRLHENNMRLKILGSRERFNRQILQGIEEAEALTANNTGLTLSIAADYGGR
UPPS_NEIG1      EDEVSFLMGLFLQALQKQVRRLHENNMRLKILGSRERFNRQILQGIEEAEALTANNTGLTLSIAADYGGR
UPPS_CLOAB      KEEVNAIMRLIVEFLKREFNELNKNNVIINPIGNILGLPEACITALNDAKNKTKNNTGLMLNLALNYGGR
UPPS_NEIMA      EDEVSFLMGLFLQALQKQVRRLHENNMRLKILGSRERFNRQILKGIEEAEALTANNTGLTLSIAADYGGR
UPPS_BACHD      RTEVDYLLKLPERFLKLELPNLMEENVQVRIMGGLDTLPEHTAKAVTKAMEETKDNTGLILNFALNYGSR
UPPS_PORGI      EEEVRALMGLFVTAIMNEMLDLMTNNIRLLAIGDFSRLPEDVRESLEKGIRETAGNTGLTLVLALSYSSR
UPPS_CHLTE      KPEISALMKLLIKVLRKEAVKLLENDIRLEVIGDMEMIPDDVRKTLDETIELTRKNRGMAMTIALSYSGK
UPPS_STAHJ      ENEVNYIMNLPVNFLKTFLPELIEKNVQIETIGFLDAVPKSTIEAIEHAKEKTKNNTGLKLIFAINYGGR
UPPS_RALSO      AEEISFLMKLFMTALRREVSKLNDSGIRLRVVGDLSAFSPRIQLMIREAEAKTATNPGLTVTIAANYGGR
UPPS2_ANASP     IEEVDXXXXXXXXXXXXXXSQMHREGVRISFIGDLTALPKSLQTEMERSMTETLNNQAIHFTVAVNYGSR
UPPS_STRMU      QEEVKFIMNLPVEFFDKYVPKLHKNNVRILVIGDKEELPAATLDALERARELTKHNSGLILNFALNYGGR
UPPS_STRA5      DDEVKFIMNLPVKFFDKYVPELDKNNVRVQVIGDTHKLPKATYDAMQRACLRTKHNSGLVLNFALNYGGR
UPPS_STRA3      DDEVKFIMNLPVEFFDKYVPELDKNNVRVQVIGDTHKLPKATYDAMQRACLRTKHNSGLVLNFALNYGGR
UPPS_NITEU      AEEVKLLMQLFLAALEREVTGLHENGVRFRVIGDISKFDPKIVDFVQQGEALTAGNSRLNFTVAANYGGR
UPPS_PROMP      SNEVDFLINLFEKVLKKEISEIHQESIKIKFIGDLSPLPNSLKLLIKSSEALTNNNKKFTLNICVNYGGR
UPPS_COXBU      QSEVNFLMSLFLDSLKKNTEELHKNNVQLRVIGDHREFDKKMLAQIQTSQDLTKHNTGLKLIIALNYSGR
UPPS_STRP8      QDEVSFIMNLPVAFFDKYVPVLHENNVKIQMIGETSRLPEDTLAALNAAIDKTKRNTGLILNFALNYGGR
UPPS_STRP6      QDEVSFIMNLPVAFFDKYVPVLHENNVKIQMIGETSRLPEDTLAALNAAIDKTKRNTGLILNFALNYGGR
UPPS_STRT2      QDEVKFIMNLPVEFFNKYVPELDKNNVRILTIGDNSRLPKETLDALEKAVEQTKHNSGLILNFALNYGGR
UPPS_STRT1      QDEVKFIMNLPVEFFNKYVPELDKNNVRILTIGDNSRLPKETLDALEKAVEQTKHNSGLILNFALNYGGR
UPPS_LISIN      TDEVDFLMKLPVEFFDSFVPELIEENVRVNVMGYRENLPEHTMRAVEKAIADTAHCTGLTLNFALNYGGR
UPPS_GLOVI      QYEVEFLMALFEKVLNHELSEMVDEGVRIRFVGALAHLPGALQSAIEGAMAATEANTAVEFTVATNYGGR
UPSS_MYCBO      PEEVRFLMGFNRDVVRRRRDTLKKLGVRIRWVGSRPRLWRSVINELAVAEEMTKSNDVITINYCVNYGGR
UPPS_ZYMMO      ASEVADLMGLLRLCLRQEMHNIKERGICLKVIGDYTRLDQDLVALLNQAIEITANNTRLTLVFALNYGAQ
UPPS_STRP1      QDEVSFIMNLPVTFFDKYVPVLHENNVKIQMIGETSRLPEDTLAALNAAIDKTKRNTGLILNFALNYGGR
UPPS_MYCTU      PEEVRFLMGFNRDVVRRRRDTLKKLGVRIRWVGSRPRLWRSVINELAVAEEMTKSNDVITINYCVNYGGR
UPPS_MYCLE      VEEVRFLMGFNRDVVRRRRENLKEMGVRIRWVGSRPRLWRSVINELAIAEHMTAGNDVITINYCVNYGGR
UPPS_BORPE      ADEVSLLMRLFVQALEREVDKLQDQGVRLHVVGDLSAFEPKLQELIAQAQERTEHNDRLHLTVAANYGGR
UPPS_BORPA      ADEVSLLMRLFVQALEREVDKLQDQGVRLHVVGDLSAFEPKLQELIAQAQERTEHNDRLHLTVAANYGGR
UPPS_BORBR      ADEVSLLMRLFVQALEREVDKLQDQGVRLHVVGDLSAFEPKLQELIAQAQERTEHNDRLHLTVAANYGGR
UPPS_BACSU      KMEVDFLMKLPEEFLNTYLPELVEENVQVRIIGDETALPAHTLRAIEKAVQDTAQNDGMILNFALNYGGR
UPPS_XYLFT      ADEVNFLMEMSIKLFGRGIEELHRRGVQVRFIGERKRFDIALVEHMTKAEHLTASNQRLILSLAVSYGGR
UPPS_XYLFA      ADEVNFLMEMSIKLFGRGIEELHRRGVQVRFIGERKRFDIALVEHMTKAEHLTANNQRLILSLAVSYGGR
UPPS_STRP3      QDEVSFIMNLPVTFFDKYVPVLHENNVKIQMIGETSRLPEDTLAALNAAIDKTKRNTGLILNFALNYGGR
UPPS_CAUCR      PQEVSELMGLLKAYVESDLERLAKAXXXXXXXXXXTGLSPDIAEVIERAERRTAQNSEFVLQVAFNYGGQ
UPPS_LISMF      TDEVDFLMKLPVEFFDSFVPELIEENVRVNVMGYRENLPNHTMRAVEKAIADTAHCTGLTLNFALNYGGR
UPPS_SHIFL      AQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGR
UPPS_PHOLL      EQEVSSLMELFIFALDSEIKSLHKHNIRLSVIGDIGRFSERLQDRIHRSVKLTANNTGLQLNIAANYGGR
UPPS_LISMO      TDEVDFLMKLPVEFFDSFVPELIEENVRVNVMGYRENLPDHTMRAVEKAIADTAHCTGLTLNFALNYGGR
UPPS_ECOLI      AQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGR
UPPS_ECOL6      AQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGR
UPPS_ECO57      AQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGR
UPPS_PSEAE      ADEVSALMELFLVALRREVRKLDENGIRLRIIGDRTRFHPXXXXXXXXXXXXXXGNTRFLLQVAANYGGQ
UPPS_ENTFA      TDEVNFLMQLPVDFFDTFVPELIKENVKVNVMGYQEFLPSHTQDAVKRAIEQTKDNTGMVLNFALNYGAR
UPPS_PROMM      GDEVNFLMTLFERVLQRELESLEREKVRIRFLGDLEGLPSGLQELISEATELTVRNNGIHFNVCTNYGGR
UPPS_STRR6      DQEVKFIMNLPVEFYDNYVPELHANNVKIQMIGETDRLPKQTFEALTKAEELTKNNTGLILNFALNYGGR
UPPS_STRPN      DQEVKFIMNLPVEFYDNYVPELHANNVKIQMIGETDRLPKQTFEALTKAEELTKNNTGLILNFALNYGGR
UPPS_THEMA      KEEVEFLMDLFVQMIDXXXXXXXXXXXXXXXXXXKEGLPEKVLKKWQEVEEKTKEFDRMTLIIAFNYGGR
UPPS_SHEON      DKEVSLLMELFFTVLQREIKLLDKNQVKLNIIGDISRFSARLQKQIRAAEEKTAGNSGLILNVAANYGGR
UPPS_HAEIN      EQEISALMSLFMQALDREVKKLHKNNICLKIIGDVSRFSETLQEKIKKAENLTEKNTALTLNIAANYGGC
UPPS_LACJO      TDEVNYLMRLPIDFFDKFMPELMENNVRVNIMGFVDELPEKTYLVTQKAMAETANNTGMVLNFAFNYGSR
UPPS_RHOBA      QAELDFLMHLLQQYLVEERRTIRDQNMRLRFIGRRDRLSDEVLKEIAKTQAVSENNTGTELVLAVDYGGR
UPPS_OCEIH      KSEVDFILKLPKEFLHVYLPGLIENNVRVQTIGDFNAVPKHTQDAIEYAMEKTKDNDGLVLNFALNYGSR
UPPS_XANCP      QDEVDALMKLFLHALDRGVEELQRRGVQVRFIGDRSRFTAPLRDRMAGAERITAANTRLVLSIAASYGGR
UPPS_SALTY      AQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDISRFNSRLQERIRKSEALTAHNTGLTLNIAANYGGR
UPPS_SALPA      AQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDISRFNSRLQERIRKSEALTAHNTGLTLNIAANYGGR
UPPS_TREDE      EAEVGFLMGLIKQHLKAELKFYADNNIRIEHIGNLSGLPQDIQDEINSVRDKTSAYTGTAIVLGINYGAH
UPPS_HELHP      KIEVDFLMKLLEKYLHDEKPVYMKNHIRFRVIGDISVFNTRLKNAILELEHATQNHTKLTQILALNYGSR
UPPS_SALTI      AQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDISRFNSRLQERIRKSEALTAHNTGLTLNIAANYGGR
UPPS_LEGPA      VTEVNFLMELFLEALRKEIDDLNQHGIRLKFTGDREPLSQVLQKQMYDAEALTRXXXXXXXXXXXXYGGK
UPPS_ERWCT      AQEVSALMELFVRALDSEVKSLHKHNVRLRVIGDIGRFSPRLQERIRRSEVLTEKNQGLTLNIAANYGGR
UPPS_LEGPL      VTEVNFLMELFLEALRKEIDDLNQHGIRLKFTGDREPLSQVLQKQMSDAEALTKXXXXXXXXXXXXYGGK
UPPS_LEGPH      VTEVNFLMELFLEALRKEIDDLNQHGIRLKFTGDREPLSQILQKQMCDAEALTKXXXXXXXXXXXXYGGK
UPPS_FRATT      AQEVSDLMDLFYKTLKDKTPKLHDNNIVVTVVGDRSRLSNKLIGMIEYSESLTKSNTGLKLRLAVDYAGR
UPPS_LACAC      KEEVAYLMNLPVRFFDKYMPTLMENNVKVNIMGYLDELPEKTYKIVQRAMSETVNNTGLILNFAFNYGSR
UPPS_SYNPX      GDEVNFLMTLFERVLQKELRTLEEEQVRIRFLGDLDALPLKLQELIGDATERTAANDGIHFNVCTNYGGX
UPPS_CHLTR      KSEVAELFSLFNSQLRSKLSFLHDREIRLRCIGDLSKLPQELQNNIEQASSATAHYSRMELIFAINYGSK
UPPS_MYCPF      TEEVRFLMGFXXXXXXXXXXXLNDMGVRMRWVGSRPRMWSSVIKEFDIAEQMTVDNDVITINYCVNYGGR
UPPS2_TROW8     PDEVRFLLRFTRDVIARRRELFAHWGVRVRWSGVPNRLGKVLVKELRDTEEITKKNTAMNLNVCLNYGSR
UPPS1_TROWT     PDEVRFLLRFTRDVIARRRELFAHWGVRVRWSGVPNRLGKVLVKELRDTEEITKKNTAMNLNVCLNYGSR
UPPS_YERPS      DQEVTALMELFVRALDSEVKSLHKHNVRLSIIGDISRFSGRLQERIRRSEKLTANNDGLKLNIAANYGGR
UPPS_YERPE      DQEVTALMELFVRALDSEVKSLHKHNVRLSIIGDISRFSGRLQERIRRSEKLTANNDGLKLNIAANYGGR
UPPS_PROMA      KEEVNFLMTLFERVXXXXXXXXXXXXVQISFLGDLDQLPTRLQDLINEATELTSGNNGIRFNVCTNYGGR
UPPS_LACPL      TDEVNYLMQLPVSFFDTFVPDLIKNNVRVQVMGYVDHLPEATQKAVQNAIADTKDCDGMVLNFALNYGSR
UPPS_WIGBR      IQEVSDLMELFSSVLNNAIDSFKKNNIRLKIIGDISKFNLKLQKYIKKSEKITYKNNGLNLNIAANYGGR
UPPS_FUSNN      QDEVSTLMKLFLKYIKNERKNMMKNKIRFFVSGRKNNVPXXXXXXXXXXXXXXXNNDKITLNIAFNYGSR
UPPS_WOLSU      KTEVDFLMRLLSDYLKKEAEVYLKNNIRFKAIGDLSRFSSRLLDEIETLTQKSASCSGLTQVLALNYGSK
UPPS_PASMU      KKEVNALMALFMQALDLEVXXXXXXXXXXXXXGDVTGFSASLQNKIHQAEKXXXXXXXXXXXXXXXYGGC
UPPS_BIFLO      PQEVRFLMGFSREIIHRRVEQMDEWGVRVRWSGRRPKLWKSVIDELEAAEERTKNNKVIDVVFCINYGGX
UPPS_AQUAE      KEEVKALFELMENYIRSKREKLYSLGVRVRLIGRRDRLSRGLVNLMEELESDSKDFKNLFLNVAIDYGGR
UPPS_LACLA      VDEVKFIMSLPIDFYSKYVPVLKEENIQIRMIGEREGLPKATLDSIDRAAQETSENDGMILNFAMNYGGR
UPPS_ACIAD      AFEVDLLMKLLEEAIHEQLPRMRKFNIALRFIGDRSKLSEHLTDLMTHAENETAHFTSMTLTIAISYGGM
UPPS2_CORDI     TDEVRFLMGFNRDVLRRQRDALNAKXXXXXXXXXXXXXXXSVIRELEAAEELTKDNTTMTLAMCVNYGGR
UPPS_AQUPY      KGEVEALFELLRRYLQTKKDKLYKLGIRVRFIGRRDRINKELVKLMQEIEEESKKFKNLFLNLAVDYGGR
UPPS_RICBR      NTEISFLMRLLNIYLKKELDNLHKNGIKIKVIGRLNLLSDSLQKQINNAIELTKDNNKLTLCIAFSYGSR
UPPS_BUCAI      LFEIKALMELFLFALDTEIKNLKKHNIRFKVIGDITCFDKKLQNSIHYAEQITFDNTGLILNIAANYGGR
DDPS2_ARATH     RIEIDFLFSLFERSLKTEFQNLAKNNVRISIIGDSSKLPKSLLRVINEVEEVTKNNTRLQLIVAVGYSGK
DDPS5_ARATH     EDEVKCLMALFEKYLASDMPYLRSDKIKISVIGNRTKLPESLLGLIEEVEEATKSYEGKNLIIAIDYSGR
UPPS1_STRCO     PEEVRFLMNFNRDFIRKSRDTLDELGVRVRWAGRMPRLWKSVAKELQVAQEQTKDNDRLTLYFCMNYGGX
UPPS_RICSI      STEVDFLIKLLSIYLKTELNNLHKNGVKIKVIGRLTLLSSSLQKQINNAIELTKNNNKITLCIAFSYGSR
UPPS_RICCN      STEVDFLIKLLSIYLKTELNNLHKNGVKIKVIGRLTLLSSSLQKQINNAIELTKNNNKITLCIAFSYGSR
UPPS_METTH      EKEVKGLMKLFRENFEAIASKIHKNRVRVRAVGKLELLPEDVRRAIEIAEKSTEQYSDRLVNIAIGYDGR
UPPS_CHLCV      TEEVEELFSLFHSQLDEQFPYLIENKIRLRCIGNLSALPLQLQQKISEISLKTHQNSHRDLVLAINYGGK
UPPS_RICTY      SSEVNFLIKLLSLYLKNELDSLHENGVKIKVIGRLNLLRSSLQKQINNAIELTQNNNKIKLCIAFSYGSR
UPPS_RICFE      STEVDFLIKLLSIYFKNELNSLHKNGVKIKVIGRLNLLSSSLQKQINNAIELTKNNNKITLCIAFSYGSR
UPPS_HELPY      KSEVDFLMKMLKKYLKDERSTYLNNNIRFRAIGDLEGFSKELRDTILQLENDTRHFKDFTQVLALNYGSK
UPPS_METJA      KEEVDKLMELFKFYEIADDEEIHRYEVRVRAIGRINLLPKNVQKAIKYAEERTKNYNKFFVNIAIAYGGQ
UPPS_HELPJ      KSEVDFLMKMLKKYLKDERSTYLDNNIRFRAIGDLEGFSKELRDTILRLENDTRYFKDFTQVLALNYGSK
UPPS_LEPIN      VTEIRSIFSLLIEFIETRLDTIHKRGIRILHSGSRKKLTRGVLDKIDFAVDKTQKNKNLTVNFCLNYGSR
UPPS_LEPIC      VTEIRSIFSLLIEFIETRLDTIHKRGIRILHSGSRKKLTRGVLDKIDFAVDKTQKNKNLTVNFCLNYGSR
UPPS2_CORGL     TDEVRFLMGFNRDVLRRQRDDLHEKXXXXXXXXXXXXXXXSVIRELETAEELTKDNTTMTLAMCVNYGGX
UPPS2_STRAW     PEEVRFLMNFNRDVIRRRRDEMDALGIRIRWVGRMPKLWKSVVQELQIAQEQTKDNDAMTLYFCVNYGGR
UPPS_THET8      PEEVETLMNLFLREAER-MAEDHRHQVRVRFIGRREGFSPEVVRAIERLERRTEGHRGMFLNIAMGYGGR
UPPS_THET2      PEEVETLMNLFLREAER-MAEDHRHQVRVRFIGRREGFSPEVVRAIERLERRTEGHRGMFLNIALGYGGR
UPPS_RICPR      SSEVDFLIKLLSIYLKNELDSLHENGVKIKVIGRLNLLRSSLQKQINNAIELTKNNNKIKLCIAFSYGSR
DDPS4_ARATH     KIEVKCLMYLFQRYLKSKIQFFQSKEIRVSVIGNLAKIPESLLRTVHELEEATKSYKKKHLILAIDYSGR
UPPS_BUCBP      PREIKVLMELFFYALSNETNNLNKYNIRLKVIGNKEKFNTVLKNKIRVVEKETLKNTGLLLNIAANYSGR
UPPS_BUCAP      KLEITALMKLFFFALKSEIKNLNKYNIRLKIIGDTSPFNENLKNYIHKVEKQTFNNTGLILNIAANYSGR
DDPS3_ARATH     KIEVKCLMSLIQHYLKSKIQYFQREETRVSVIGNLTKIPESLLRTVQEIEEATRSYKKKHLILAIDYSGR
UPPS_CHLMU      KTEVAELFSLFNSQLHSKLSFLHDREIRLRCIGDLSKLPQELQNNIAKAVSATTHYSHMELIFAINYGSK
UPPS_CHLAB      AEEVAELFSLFHAQLDEQLPYLIENKIRLRCIGNLLALPPDLQQQIAKVASETQRHGMRELVLAINYGGK
DDPS1_ARATH     KIEIDNLMSLIQHYRNKNIKFFHRSEVRVSVIGNKTKIPESLLKEIHEIEEATKGYKNKHLIMAVDYSGK
UPPS_METKA      KEELKRLFDLMEERFKA-LAEIHRRKVAVRAVGRLHLLPTRVRRAIKKAERATKEYKDRFLNVAVAYGGR
UPPS_PYRAB      KEEVERLMQLFEQKFRELVTDVHEYGVRVNVIGRKELLPKSVRDXXXXXXRATRKYNNYVLNVAIAYGGR
UPPS_PYRFU      KEEVDRLMKLFEEKFRELVTDVHEYGIRVNVMGRKELLPKNVRXXXXXXXRVTRKYNNYFLNIALAYGGR
UPPS_PYRHO      KEEVDRLMKLFEEKFRELVTDVHEYGVRVNVIGRKELLPKSVRDAVEEAERATRKYNNYILNVALAYGGR
UPPS1_STRAW     QEELGPLLGIIEGVVRTLAAD---GRWRVHHVGTPDILPSQMQNALKEAEETTAHVDGILVNVAIGYGGR
UPPS_CHLPN      KEEIQEIFNIFYTQLDKQLPYLMENEICLRCIGDLSKLPKGIQTKINHVSRMTASFSRLELVLAVNYGGK
UPPS2_COREF     TEEVRFLMGFNRDVLRRQRDGLHEKXXXXXXXXXXXXXXXSVIRELEAAEELTKDNTNMTLAMCVNYGXX
UPPS_PICTO      SDEVNFLFNLINAFI--DLLNVYKNGIRVKVIGDISKLPDYLKETIKRVEGETNKFKNFRFNLAIGYGGR
UPPS_DEIRA      PAELAHILSLLEREARQLAVDIHANRVRVRAIGQHDNFPPQVLAALNNLEESTAGYEGMRLNIAVGYGGR
CRUP_STRCO      QGEVAALFGAFADWFARGAQTVHELGVRVRWSGRRDRXXXXXXXXXXXXXXMTANNDKLTLTICLDYGGX
UPPS_PYRKO      KEEVEALMNLFEEKFKELVQDVHRYGIRVNVLGRKDMLPENVXXXXXXXXXXXXXYSNYNLNIALAYGGR
UPPS_TREPA      AHEVHFLMNLIRWYLKKEMSFYVEHAIRVVHLGCAQTLPPDVRSQIEYVVERTRSHRGTTVALAINYGGK
UPPS1_BRAJA     KAEVAALMTLLRFYLANEVQSLVKNGVRLTVIGRRDRLPDGIXXXXXXXXXXXXHGSTLHLRIAVDY---
UPPS_PYRAE      KIELEILFRIFEDELRRTLEDIHDNKVRVRFIGDRSLLPGKVVKYIDELESVTKNYSNYHLTIALGYGGR
UPPS1_CORDI     SDELQMLFDIIGDVV--DELASPETNCRLRLVGHLDLLPDDVSRRLTQAQDSTNDNTGVFVNVAVGYGGR
UPPS_STRFR      DTEVSFLMQVIEQVVAVHLARPDRWQVRIAGTLDXPCADSTAHALKEAVEATRRCTTGSQVTLAIGYGGR
UPPS_METMA      EEEVGGLFNLIEKFLKLHTKRTYEKEMQVRVIGDRTKLPAYLNESIDRIEKATEHHRKFSLNVAIAYGGR
UPPS_ARCFU      EKEKKNIFQLLESELRRLLKDTYERELRVKVVGKRELLPENLRETIKEVEERTKKHRRHYLNVAVAYGGR
UPPS1_CORGL     SEELQLLFDII-ADVADELAR-PETNCRVRLVGHLDLLPDPVACRLRKAEEATVNNTGIAVNMAVGYGGR
UPPS_METAC      EEEVDGLFNLIEKFLKYNDKRTYEKETQIRVIGDRTKLPAFLNKSIEKIEKATETHRKFNLNVAIAYGGR
ZFPP_MYCBO      PDELAALIEIITDVVEEICAPANHWSVRT--VGDLGLIGEEPARRLRGAVESTPEVASFHVNVAVGYGGR
UPPS_THEAC      PEEVDFLFHLIDNAFKSLLKDVYKNRINVKVIGNLSILPAYLRQTIHIVEETTKNFNNYQLNLAIGYGGR
ZFPP_MYCTU      PDELAALIEIITDVVEEICAPANHWSVRT--VGDLGLIGEEPARRLRGAVESTPEVASFHVNVAVGYGGR
ZFPP_MYCLE      PDELAALIEIITDVVEEICAPANRWSVRT--VGDLELLGEEPACRLRGAVESTPGVAPFHVNVAVGYGGR
UPPS_BLOFL      NTEISSLMQLFIYALNSEXXXXXXXXXXXRIIGDVNRFTQELQDCIYRSEQLTSXXXXXXXXXXXXXXXR
YE54_SCHPO      KYEVDMLMEIAKNSLTQITAHVDQYGIRIRIVGDLSRLQPDVLETALKAVEITKHNTKATLNVCFPYTSR
UPPS_SULAC      QQELSMIFKYLKIGLDELLTSVHKYQVRVKAIGMLDKLPEDLKKLVVDLESTTEKYNKKKLILAICYGGR
UPPS_HALSA      PDQQQHLFDLLESKLREDADRVHADRVRIRAIGDTGRLPQRVRDAITYAESRTAGYDGFTLNVALAYGGR
UPPS_THEVO      PEEVDFLFHLINAFISLLKDEVYKNKINVKVIGNVSMLPEYLRXXXXXXXXXXXNFSNYHMNLAIGYGGR
UPPS1_COREF     EAELQLLYDIIGDVVAE--LSLPETNCRVRLVGHLDLLPKEFAERLRGTVCETVDHTGVAVNIAVGYGGR
DHDDS_HUMAN     KSEVDGLMDLARQKFSRLMEELQKHGVCIRVXXXXXXXXXXXXXXIAQAVQATKNYNKCFLNVCFAYTSR
UPPS_SULTO      NLELNTIFNYIKAGLEELLYGIYKYEVKVRAIGLIYKLPLDLLEVLNQLSKKTENFNKRKLTLAICYGGR
UPPS_HALMA      PEEREHIFDLVEQKLRTDADRVHEAGVCIRAIGETEMLPERVRDAIDYAEGRTAQYDQLNLNIALAYGGR
UPPS_CAMJR      KDEIDFIFELLDRCLDEALEKFEKNNVRLRAIGDLSRLEDKVREKITLVEEKTKHCDALCVNLAISYGAR
UPPS_CAMJE      KDEIDFIFELLDRCLDEALEKFEKNNVRLRAIGDLSRLEDKVREKITLVEEKTKHCDALCVNLAISYGAR
DHDDS_MOUSE     KSEVDGLLDLARSCLMEEQEKLQKHGVCIRVXXXXXXXXXXXQEKIAHAIQATKNYNKCFLNVCFAYTSR
UPPS_SULSO      QNELSIITTYIKRGIQ-DLLEVDKYEVKVSAIGKLDKLPKDLIDYLNRVVEKTSNYDKRKLTLAICYGGR
UPPS2_TROWT     RQELNDLVQVIC-----DLIAQVSKRWKVNHVGSCENLPELLGNSLEGVKSSTKTNRSMTVNLAIGYSGR
UPPS2_STRCO     EEQLNPLIDIIAEVVEQLAAPGNPWPVEA--VGALDLLPAESASRLKTATAATQGRKGGTKVVAVGYGGR
UPPS1_TROW8     RQELNDLVQVICNLIAQV-----SKRWKVNHVGSCENLPELLGNSLEGVKSSTKTNRSMTVNLAIGYSGR
UPPS_BORBU      DCEIENLMFLIANYLRAEFDFYEKNGIKIIVSGDVESLSGEVXXXXXXXXXXXXXXXXXXXXXXXXYGGR
DDPS6_ARATH     PEEVESVMDLMLEKIKSLLEKVHQYGIRVYFIGNLALLNDQVRAAAEKVMKATAKNSRVVLLICIAYNST
RER2_YEAST      SREVESLMTLARERIRQERGELAKYGVRIKIIGXXXXXXXXXXEDVRVAVETTKNNKRATLNICFPYTGR
SRT1_YEAST      KEEVDTLMNLLDEFAKR--AKDYKDPLKIRIVGDQSLLSPEMRKKIKKVEEITQDGDDFTLFICFPYTSR
DDPS8_ARATH     PEEVKCVMDLMLEKVELTIDQAVSGNVRIIFAGDLNSLNERFRAATKKLMELTEENRDLIVVVCVAYSTS
DDPS7_ARATH     PEEVKCVMDLMKVELAIDQAVSGNMNVRIIFAGDLDSLNEHFRAATKKLMELTEENRDLIVVVCVAYSTS
UPPS_AERPE      RAELSILYRIMRRSIERDIAEIEKGGASLVIVGDHPNLPDNIRESLAPYH----------FDMYLKKGSL
RER2_ENCCU      PEEVNKLMGLVKQKIERPKEIGIRP--KFRVYGRLDLLEEDVRKRLMDIEEESKNNTSIIVNIFFAYSAE
NGBR_HUMAN      -------------------------------------------------------NCHLAVKVLSPEDGK
NGBR_MOUSE      ----------------------------------------------------------------------
UPPS_SCHPO      ---------------------------------------------------------------------R
NGBR_DANRE      ---VYDNQGVFKRNNSRLMEEILKQQQELLGMGSSKYSVEILKNGTNKQEHQVLSCQSMVKVLSPDDG-R
UPPS_YEAST      --------------------------------------ETDVGNEIEANQEKDKIAIEISLLS--NRDGR


                         +         .         .         .         .         *         .:210
query           DEITRATASIARDVAEGRLSADAITPEMISSRLDTSGMPDPDLIIRTSGEERLSNFLLWQAAYSEFLFVP
UPPS_AGRT5      DEITRATASIARDVAEGRLSADAITPEMISSRLDTSGMPDPDLIIRTSGEERLSNFLLWQAAYSEFLFVP
UPPS_RHIME      DELARAMRRLAGEVAAGRLRPEEITAERISSTIDTAGIPDPDLIIRTSGEERLSNFLLWQGAYSELLFIP
UPPS_BRUSU      DEIVRAVRSLARDVAAGLLDPSSISAELVSANLDTAGIPDPDLIIRTSGEMRLSNFLLWQAAYSEFLFLP
UPPS_BRUME      DEIVRAVRSLARDVAAGLLDPSSISAELVSANLDTAGIPDPDLIIRTSGEMRLSNFLLWQAAYSEFLFLP
UPPS_BRUAB      DEIVRAVRSLARDVAAGLLDPSSISAELVSANLDTAGIPDPDLIIRTSGEMRLSNFLLWQAAYSEFLFLP
UPPS_RHILO      DEIVRTARKLASAAARGEIDAESITADSFAGGLDTQGIPDPELVIRTSGELRLSNFLLWQAAYSELVFLP
UPPS2_BRAJA     QEIAKAAQKLAREVAEGRRDPATIDAETLGAHLDAXXXXXXXXXXRTSGEQRLSNFLMWQAAYSELVFVP
UPPS_PHOPR      WDILQATKKLAVQIAEQGLTASDITEDMLSAGMSTADLPDVDLMIRTSGECRISNFMLWQAAYAELYFTE
UPPS_VIBF1      WDITQAVRRLAYQVERGNLQADDIDEDLIASKLTMSDLPEVDLMIRTSGECRISNFMLWQMAYAEFYFTD
UPPS_THETN      DEIVKATQNICKKVLNRELSPEDITEDTITQHLYTASQPDPDLIIRTSGEKRLSNFLLWQSAYSELWFTE
UPPS_GEOKA      AEIAAAVKQIAKDVERGMLAPEDITEPLISSYLMTSGLADPDLLIRTSGEIRLSNFMLWQLAYTELWFTD
UPPS_CLOPE      NEIVRGIKSVIEDVKAGKISIDDINEDMFNDYLYTKGMPDPDLIIRPSGEQRLSNFLLWQCAYSEFWYSQ
UPPS_HELMO      FEIVEAVKSIARLAAEGKVNPDQIDEKYMSQYLYTADVPDPDLLIRPSGELRLSNFLLWQSAYTEIWVTP
UPPS_CHRVO      WDIVHA---VNRLIAEGR---SEITEEMVTDRLGMAWAPEPDLFIRTGGEQRISNFLLWQLAYSELYFTD
UPPS_VIBPA      WDITEAAKALALKARNGEIRVEDINEQLITEHLTMADLPEVDLLIRTSGECRISNFMLWQMAYAEMYFTP
UPPS_CLOTE      DEIIRAIKLMYKDIEKKGLDIENVNEDLLKNYLYTKGMPDPDLIIRPSGEQRISNFLLWQCAYSEFWYSN
UPPS_GEOSL      QEIMTAATRIASDIASGVLKADDLSETAFASYLFTSGLPDPDFLIRTSGEMRISNFLLWQLAYTEFYFSS
UPPS_BACSK      FELTSAMQQIAKKVQQGELMPEHITEETISAHLMSNHLRDPDLLIRTSGELRLSNFMLWQIAYSEFLFMD
UPPS_BACCR      DEIVSAVQHMMKDNEEGKIRSEEVSEEMLSSYLMTSSLPDPELLIRTSGELRISNFMLWQIAYSEFWFTD
UPPS_BACHK      DEIVSAVQHMMKDSEEGKVRVEDVSEEMLSSYLMTSSLPDPELLIRTSGELRISNFMLWQIAYSEFWFTD
UPPS_BACAN      DEIVSAVQHMMKDSEEGKVRVEDVSEEMLSSYLMTSSLPDPELLIRTSGELRISNFMLWQIAYSEFWFTD
UPPS_BACC1      DEIVSAVQHMMKDREEGKVRVEDVSEEMLSSYLMTSSLPDPELLIRTSGELRISNFMLWQIAYSEFWFTD
UPPS_VIBCH      WDILQATQALAEKVTQGELQPSDIDEDVFKQHLTMADLPDVDLLIRTSGECRISNFMLWQLAYAEMYFTP
UPPS_HAEDU      WDITEATKKLAEKVKLGKISVTDITPEKVQRALVTAEQPPVDLLIRTSGEQRISNFLLWQIAYAELFFSD
UPPS_PSEPK      WDIAQAAQRLAREVQAGHLRPEDITPGLLQTCLATGDLPLPDLCIRTGGEHRISNFLLWQLAYAELYFSD
UPPS_STAS1      AEILNSVKTIYDELTAKGLTSDDITEQMIDDHLMTHAYPDPDLLIRTSGEQRISNFLIWQVSYSEFIFNE
UPPS_BACTN      WEMTEAVRQIATLAKTGEISPEQITDEYITAHLTTNFMPDPDLLIRTGGEIRLSNYLLWQCAYSELYFCD
UPPS_VIBVY      WDITXXXXXXXXXXXLGDLSAEDITEDDIAKHLTMSDLPEVDLLIRTSGECRISNFMLWQMAYAEMYFTP
UPPS_VIBVU      WDITXXXXXXXXXXXLGDLSAEDITEDDIAKHLTMSDLPEVDLLIRTSGECRISNFMLWQMAYAEMYFTP
UPPS_SYNY3      QEIVHVCQAIAREVQSGKLDPETIDEGVVEKYLYTEGLSHPDLLIRTSGELRISNFLLWQMAYAEIYVTS
UPPS_XANOR      QDIATAARALAEDVAAGRLQPEQIDEALLSSRVALADLPAPDLFIRTGGDTRISNFLLWQLAYTELWFTE
UPPS_STAES      AEIIQSMKAIYNELQLNGQGSEVIDEALIKRHLMTHSYPDPDLLIRTSGEQRISNFLIWQASYSEFIFNE
UPPS_STAEQ      AEIIQSMKAIYNELQLNGQGSEVIDEALIKRHLMTHSYPDPDLLIRTSGEQRISNFLIWQASYSEFIFNE
UPPS_STAAW      AELVHSIKNMFDELHQQGLNSDIIDETYINNHLMTKDYPDPELLIRTSGEQRISNFLIWQVSYSEFIFNQ
UPPS_STAAS      AELVHSIKNMFDELHQQGLNSDIIDETYINNHLMTKDYPDPELLIRTSGEQRISNFLIWQVSYSEFIFNQ
UPPS_STAAR      AELVHSIKNMFDELHQQGLNSDIIDETYINNHLMTKDYPDPELLIRTSGEQRISNFLIWQVSYSEFIFNQ
UPPS_STAAC      AELVHSIKNMFDELHQQGLNSDIIDETYINNHLMTKDYPDPELLIRTSGEQRISNFLIWQVSYSEFIFNQ
UPPS_ANAVT      QEILQACRAIAQKVQQGLLQPDEIDEEVFERHLYTAGIADPDLLIRTSGEMRLSNFLLWQMAYGEIYITD
UPPS1_ANASP     QEILQACRAIAQKVQQGLLQPDEINEEVFERHLYTAGISDPDLLIRTSGEMRLSNFLLWQMAYGEIYITD
UPPS_XANAC      QDIASAARALAEDVAAGRLQPEQIDEALLSSRVALADLPAPDLFIRTGGDTRISNFLLWQLAYTELWFTE
UPPS_STAAN      AELVHSIKNMFDELHQQGLNSDIIDETYINNHLMTKDYPDPELLIRTSGEQRISNFLIWQVSYSEFIFNQ
UPPS_STAAM      AELVHSIKNMFDELHQQGLNSDIIDETYINNHLMTKDYPDPELLIRTSGEQRISNFLIWQVSYSEFIFNQ
UPPS_MICLU      KEIISAVQLIAERYKSGEISLDEISETHFNEYLFTANMPDPELLIRTSGEERLSNFLIWQCSYSEFVFID
UPPS_PSESM      WDIAQAAQRLAREVQAGHLQPEDITPQLLQTCLATGDLPLPDLCIRTGGEHRISNFLLWQLAYAELYFSD
UPPS_THEEB      REIIHACRSIAAQVKAGLLDPADIDEVLFERHLYTGGLPDPDLLIRTSGELRISNFFLWQVAYAEIYVTK
UPPS_NEIMB      WDILQAANKL---IAEG---VSEITEDTLAKHLMLGDAPEPDLFIRTGGETRISNFLLWQMAYAELYFTD
UPPS_NEIG1      WDILQAANKL---IAEG---VSEITEDTLAKHLMLGDAPEPDLFIRTGGETRISNFLLWQMAYAELYFTD
UPPS_CLOAB      DEILNAVKNIFASYEENKISKDEISDEEFSSYLYTGCIPDPDIIIRPSGEKRLSNFLLWQCAYSEFWYSN
UPPS_NEIMA      WDILQAANKL---IAEG---VSEITEDTLAKYLMLGDAPEPDLFIRTGGETRISNFLLWQMAYAELYFTD
UPPS_BACHD      YEMVEAMKQVAKEVETGTLSSDAITEDVISRHLMTADLRDPDLLIRTSGEIRLSNFMLWQLAYSEFWFTD
UPPS_PORGI      WEMTDVIRRLARKVRDGSVEPEDINVDLVSDHLSTAGIPDPDLFIRTGGEKRISNFLMWQMAYTELFFTD
UPPS_CHLTE      WDITQACRHIALQVKQGLLDPETIDENLFASYLSTASMPDPDLLIRTSGEYRISNFMLWQNAYSEIIFSN
UPPS_STAHJ      AEIVQSMKSIYDELQRNGQDSKDIDESMINKHLMTHSYPDPELLIRTSGEQRISNFLIWQSSYSEFIFNE
UPPS_RALSO      WDILQAMRALVADQPD--IAPEAITEEALSPYMALAYASEPDLFIRTGGEQRISNFMLWQLAYSELYFTE
UPPS2_ANASP     NEITRACRQVAELVQQGKLSADAVNEGIVEQHLYTTDTQPPDLLIRTSGEMRLSNFLLWQMAYTEMYFTD
UPPS_STRMU      AEIVDAVKLIAQDVLDARFNPGDITEGLIADYLMTSNLPDPDLIIRTSGELRLSNFLPWQAAYSELYFTD
UPPS_STRA5      SEITNAIKEIAQDVLEAKLNPDDITEDLVANHLMTNSLPDPDLIIRTSGELRLSNFLPWQSAYSEFYFTP
UPPS_STRA3      SEITNAIKEIAQDVLEAKLNPDDITEDLVANHLMTNSLPDPDLIIRTSGELRLSNFLPWQSAYSEFYFTP
UPPS_NITEU      WDIMQA---VRKMITENPDSAVTFDEPDIARHLALADAPEPDLFIRTGGECRISNFLLWQLAYTELYFTD
UPPS_PROMP      QEIVKAAKEIAIKSSSGKIKPSDIDEQLFNSELLTKGSMDPELLIRTSGEKRISNFLLWQLAYSEIYVTD
UPPS_COXBU      WDILQAVQRMAEKIKNQELTSELMSAELFQNYLCLSDLPEPDLLIRTSGEQRLSNFMLWQFAYTEIYFTP
UPPS_STRP8      AEITSAVRFIAQDVLDAKLNPGDITEDLIANYLMTDHLPDPDLIIRTSGELRLSNFLPWQSAYSEFYFTP
UPPS_STRP6      AEITSAVRFIAQDVLDAKLNPGDITEDLIANYLMTDHLPDPDLIIRTSGELRLSNFLPWQSAYSEFYFTP
UPPS_STRT2      AEIVSAVQAIAKEVEIGRLRPEAIDEDLIAKHLMTDKLPDPDLIIRTSGELRLSNFLPWQSAYSEFYFTD
UPPS_STRT1      AEIVSAVQAIAKEVEIGRLRPEAIDEDLIAKHLMTDKLPDPDLIIRTSGELRLSNFLPWQSAYSEFYFTD
UPPS_LISIN      SEITAAKEAMKELVSEGKTSED-LTEELLNDHLMSHGLGDPDLLIRTSGELRLSNFMLWQLAYSEFYFTE
UPPS_GLOVI      QEIVNACRELAEQVRSGRLLPEQIDEKLFAQHLYTRELSDPDLLIRTSGEQRLSNYLLWQMAYTEIYVAD
UPSS_MYCBO      TEITEATREIAREVAAGRLNPERITESTIARHLQRPDIPDVDLFLRTSGEQRSSNFMLWQAAYAEYIFQD
UPPS_ZYMMO      DELVHVTKRIAEKAKEGQLDPENIDVGTIESLLYTHDLPPLDLVIRTSGEKRLSNFLLWQAAYAELLFID
UPPS_STRP1      AEITSAVRFIAQDVLDAKLNPGDITEDLIANYLMTDHLPDPDLIIRTSGELRLSNFLPWQSAYSEFYFTP
UPPS_MYCTU      TEITEATREIAREVAAGRLNPERITESTIARHLQRPDIPDVDLFLRTSGEQRSSNFMLWQAAYAEYIFQD
UPPS_MYCLE      TEIAEATREIARLAAAGRLNPERITESTITRHLQRPDIPDVDLFVRTSGEQRSSNFMLWQAAYTEYIFQD
UPPS_BORPE      WDILQATRAMLRADPGLAQDPDRIDEARLAEHLSMAWAPEPDLFIRTGGEQRISNFLVWQLAYAEFYFTE
UPPS_BORPA      WDILQATRAMLRADPGLAQDPDRIDEARLAEHLSMAWAPEPDLFIRTGGEQRISNFLVWQLAYAEFYFTE
UPPS_BORBR      WDILQATRAMLRADPGLAQDPDRIDEARLAEHLSMAWAPEPDLFIRTGGEQRISNFLVWQLAYAEFYFTE
UPPS_BACSU      TEIVSAAKSLAEKVKEGSLNIEDIDESLFSTYLMTESLQDPELLIRTSGEIRLSNFMLWQVAYSEFVFTD
UPPS_XYLFT      QDITMAARALAQDVAAGRLKPEQIDEDLLGQHMALADLPPPDMFIRTSGVIRISNFLLWQIAYTELWFTD
UPPS_XYLFA      QDITMAARALAQDVAAGRLKPEQIDEDLLGQHMALADLPPPDMFIRTSGVIRISNFLLWQIAYTELWFTD
UPPS_STRP3      AEITSAVRFIAQDVLDAKLNPGDITEDLIANYLMTDHLPDPDLIIRTSGELRLSNFLPWQSAYSEFYFTP
UPPS_CAUCR      ADITDAARAFAERVERGEAKASDLNEKTFEQFLSTASAPPPDLIVRTSGERRISNFLLWDCAYAELVFQD
UPPS_LISMF      SEIITXXXXXXXXXXXXGKSADDLTEEKLNDHLMSSGLGDPDLLIRTSGELRLSNFMLWQLAYSEFYFTD
UPPS_SHIFL      WDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTD
UPPS_PHOLL      WDIVQSVQKIAQQIKDNSLEQQDITEELVNNYMNLSQQPQVDLVIRTGGEHRISNFLLWQIAYAEFYFTD
UPPS_LISMO      SEIITXXXXXXXXXXXXGKSADDLTEEKLNDHLMSSGLGDPDLLIRTSGELRLSNFMLWQLAYSEFYFTD
UPPS_ECOLI      WDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTD
UPPS_ECOL6      WDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTD
UPPS_ECO57      WDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTD
UPPS_PSEAE      WDIVQAAQRLAREVQGGHLAADDISAELLQGCLVTGDQPLPDLCIRTGGEHRISNFLLWQLAYAELYFSD
UPPS_ENTFA      AELLTAMKQIAAEVSEKAYTADEITEETIADHLMTGFLPDPELLIRTSGEERISNFLLWQIAYSELFFTK
UPPS_PROMM      RELVXXXXXXXXXXXXGDLDPTLIDENSFEAELLTAGEVDPDLLIRTSGERRISNFLLWQLAYAEIHVTD
UPPS_STRR6      AEITQALKLISQDVLDAKINPGDITEELIGNYLFTQHLPDPDLIIRTSGELRLSNFLPWQGAYSELYFTD
UPPS_STRPN      AEITQALKLISQDVLDAKINPGDITEELIGNYLFTQHLPDPDLIIRTSGELRLSNFLPWQGAYSELYFTD
UPPS_THEMA      REILDAVEFILKDVSHGK--KIELTEETFRQYLYLPDVPDPDLIIRTSGEMRLSNFLLWQSAYSELYFFK
UPPS_SHEON      WDILQAAQKLAEKVETGEMTSSQFTEEALSEHLCMQNQSEVDLIIRTGGDYRISNFVLWQAAYAELVFLD
UPPS_HAEIN      WDIIQAAKQIAEKVKKEEMSVSDINNSTFQHHLATQNAPPVDLLIRTSGEQRISNFLLWQIAYAELYFSD
UPPS_LACJO      REITAGVQEIARKVKVGEIDIDDISEKMVSDHLLTHSLEDPDLLIRTSGEERLSNFLLWQMAYTEFSFSD
UPPS_RHOBA      DELTRMTRQLAQQVRDGERSIDEITESLVDESLDTAGLPDVDLMIRTGGDIRISNYLLWQISYAELYFTP
UPPS_OCEIH      YEIIHAVKQIVQKTKASELDVEQLDESYFEKHLFTNGLSDPDLLIRTGGEYRLSNFMLWQLAYTEFWFTE
UPPS_XANCP      QDIXXXXXXXXXXXXXXXXQPEQIDEALLASRVALADLPAPDLFIRTGGDTRISNFLLWQLAYTELWFTE
UPPS_SALTY      WDIVQGVRQLAEQVQAGVLRPDQIDEERLGQQICMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTD
UPPS_SALPA      WDIVQGVRQLAEQVQAGVLRPDQIDEERLGQQICMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTD
UPPS_TREDE      DEILRAIKKLNSD------ELASINEESFSLKLDTGKIPPVDLLIRTGGEKRLSNFLLWQSAYAELYFTD
UPPS_HELHP      DEIARTFIKLAHTLTPHTLSQDIIS--MINANLDTATLPDVDMLIRTGGEKRISNFMLWQASYAELFFTP
UPPS_SALTI      WDIVQGVRQLAELVQAGVLRPDQIDEERLGQQICMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTD
UPPS_LEGPA      WDIVTAAKKLIHSVLDGKLACDEINEAVFAQFLDTSGMPEPDLFIRTSGELRISNFFLWQLAYTELYFTD
UPPS_ERWCT      WDIIQGVRQLAEQVQEGILRPDSINEASLCQYICLNDLAPVDLVIRTGGEHRISNFLLWQIAYAELYFTD
UPPS_LEGPL      WDIVTAARKLIRTVLDGKLAYDEINEAVFAQFLDTKGMPEPDLFIRTSGELRISNFFLWQLAYTELYFTD
UPPS_LEGPH      WDIVTAARKLIRTVLDGKLAYDEINEAVFAQFLDTNGMPEPDLFIRTSGELRISNFFLWQLAYTELYFTD
UPPS_FRATT      WDIVEATRAIAREVDIGKLSVDEIDQNSFAKYLVGGNMP-VDLLIRTSGEVRLSDFMLWQLAYAEMYFTD
UPPS_LACAC      REITSAVKELGGMIESGSLKSEEITESMISDHLMTGNFRDPDLLIRTSGEQRISNFLLWQLAYSELAFSE
UPPS_SYNPX      XXXXXXXXXXXXXXXNGDLMPEDIDENSLAAELFTAGEQDPDLLIRTSGEHRISNFLLWQLAYAEIHVTD
UPPS_CHLTR      DELVRAFKELHQDLASKKISVNDISEELISSYLDTSGLPDPDLLIRTGGEMRVSNFLLWQIAYTELYVTD
UPPS_MYCPF      TEIVEAARELAQEAVDGKIKPNRISEAQFAKHLHRSDIPDVDLFIRTSGEQRASNFLLWQAAYAEYVFQD
UPPS2_TROW8     QEIVNAIKSIVSDVNSGLISAKSVNEKIISRRMYMPDFPDVDLFLRSSGENRMSNFMLWQSAYAELIFMS
UPPS1_TROWT     QEIVNAIKSIVSDVNSGLISAKSVNEKIISRRMYMPDFPDVDLFLRSSGENRMSNFMLWQSAYAELIFMS
UPPS_YERPS      WDIIQGVRHLAEQVQKGELQPTDISEESLNSYICLHEQSQVDLVIRTGGEHRISNFLLWQIAYAELYFTD
UPPS_YERPE      WDIIQGVRHLAEQVQKGELQPTDISEESLNSYICLHEQSQVDLVIRTGGEHRISNFLLWQIAYAELYFTD
UPPS_PROMA      RELVLAAQKLAQRVLQGDLDPSFIDEHTFAGELLTSSYADPDLLIRTSGEMRISNFLLWQLAYAEIHVTD
UPPS_LACPL      AEIVTGVQKIAQQVQDGQLAVGDIDDATIDAALMTAPLADPDLLIRTSGEERISNFLMWQIAYSELVFTD
UPPS_WIGBR      WDIIQGVKKIAKQVKKGIIYPDQINESNFCRFICMNELVPVDLVIRTGGEHRISNFLLWQIAYSELFFTD
UPPS_FUSNN      AEIVDAVNRIIKDGKEN------ITEEDFSKYL-YNDFPDPDLVIRTSGEMRISNFLLWQIAYSELYITD
UPPS_WOLSU      DEIIRATQKMIEAGVE-------VSEENLSRFLDTAFAPDVDMLVRTGGDYRLSNYLLWQSSYAELFFTP
UPPS_PASMU      WDIVQATKSLAQQVKEGKLAVDEINAQVLQQALVTKEQPQVDLLIRTSGEQRISNFLLWQIAYAELYFSD
UPPS_BIFLO      XXXXXXXXXXXXXVRDGKISGDRVTEKMIADHLYNPDIPDCDLVIRTSGEQRTSNFLPWEAAYAELDFVP
UPPS_AQUAE      DDILRAVKKIM------EVQPSKLDEETFSQFXXXXXXXXXXXXIRTAGEKRISNFLLWNLAYTELYFTD
UPPS_LACLA      RDIILAIQELAKSGQDLSL----LTEEELSKHLQTANLRDPDLIIRTSGEQRMSNFLTWQSAYSELYFAQ
UPPS_ACIAD      WDITDAAKQIAKDVSDGIVDIEQIDTHLFGRYVSLNQLPPVDLLIRTGGDYRLSNFLLWQAAYAELYFTE
UPPS2_CORDI     AEIVDAAREIARRSAVGTLRPEEITEDSFTQFLDEPDMPDVDLFLRPSGEKRTSNFLLWQSAYAEMVYQN
UPPS_AQUPY      DDILRAVKKAV------KLQREEITEEXXXXXXXXXXXXXXXXXIRTAGEKRISNFLLWNLAYTELYFSE
UPPS_RICBR      QEITDACTKI---IASGKTE---ILESDIQNALYDPEMPDVDLLIRPGGVFRISNFLLWQAAYAELYFSQ
UPPS_BUCAI      WDIIESVKKIINRVQRGILDVNKIHENTISQYLSTSELLPVDLVIRTGGEKRISNFLLWQIAYSELYFTD
DDPS2_ARATH     YDVLQACRGIARRVKDGXXXXXXXXXXXXXXXXXTTEFPYPDLLIRTSGELRVSNFLLWQLAYTELFFAQ
DDPS5_ARATH     YDILQACKSLANKVKDGLIQVEDINEKAMEKELLTSEFPNPDLLIRTSGEQRISNFFLWQSAYTELYFPT
UPPS1_STRCO     XXXXXXXXXXXXXXXXGKLDPAKVNEKTLAKYLYYPDMPDVDLFLRPSGEQRTSNYLLWQSAYAEMVFQD
UPPS_RICSI      QEIVDACTKI---ITSGK---KAVSDSDIQHALYDPEMPDVDLLIRPGGVYRISNFLLWQAAYAELYFSP
UPPS_RICCN      QEIVDACTKI---ITSGK---KAVSDSDIQHALYDPEMPDVDLLIRPGGVYRISNFLLWQAAYAELYFSP
UPPS_METTH      QEIVDATRKIAEDVKAGLIDPEDIDEDMINRNLYTAGLEDPHLIIRTSGEERLSGFLLWQSSYSELYFCD
UPPS_CHLCV      DELVRAFKKLHQDLVEQKISSDSISEELIRLYLDTSEMPDPDLLIRTGGEMRVSNFLLWQIAYTELYVTD
UPPS_RICTY      QEIVDACTKI---IANGK---KQVSENDIQHALYDPEMPDVDLLIRSGGVYRISNFLLWQAAYAELYFSQ
UPPS_RICFE      QEIVDACTKI---IASGK---KEISESDIGHALYDPEMPDVDLLIRPGGVYRISNFLLWQAAYAELYFSP
UPPS_HELPY      NELSRAFKSLLESPPSHINLLESLENE-ISNRLDTHDLPEVDLLLRTGGEMRLSNFLLWQSSYAELFFTP
UPPS_METJA      QEIIDAVKKIAEKVKRGEIEPEDIDKELIDKHLYTANLPNPDLIIRTSGEERISNFLIWQSSYSELYFCD
UPPS_HELPJ      NELSRAFKSLLENPPNHINNIESLENE-ISHRLDTHDLPEVDLLLRTGGEMRLSNFLLWQSSYAELFFTP
UPPS_LEPIN      DELLRAAQELFLERKRSKVAXXXXXXXXXXXXXXTSILPPVDLLIRTAGEQRLSNFLLWQSAYAELYFTD
UPPS_LEPIC      DELLRAAQELFLERKRSKVAXXXXXXXXXXXXXXTSILPPVDLLIRTAGEQRLSNFLLWQSAYAELYFTD
UPPS2_CORGL     XXXXXXXXXXXXXXXXGKLRPEQITEKTFPNFLDEPDMPDVDLFLRPSGEKRTSNFLLWQSAYAEMVYQD
UPPS2_STRAW     XXXXXXXXXXXXXXXXGRLDPAKVSEKTIQKYLYYPDMPDVDLFLRPSGEQRTSNYLLWQSSYAEMVFQD
UPPS_THET8      EEIVDAVKRLLLEAEARGLSAEGLTPEDIARHLYTAGLPDPDFIIRTSGEIRLSGFLLWQSAYSEFYFAD
UPPS_THET2      EEIVDAVKRLLLEAEARGLSAEGLTPEDIARHLYTAGLPDPDFIIRTSGEIRLSGFLLWQSAYSEFYFAD
UPPS_RICPR      QEIVDACTKI---IAHGK---KQVSEYDIQHALYDPEMPDVDLLIRSGGVYRISNFLLWQAAYAELYFSQ
DDPS4_ARATH     FDILGACKNIVKKSEQGLIREEDVDETLFERELQTTEFPSPDLLIRTSGEQRISNFFLWQLAYTEFFFSP
UPPS_BUCBP      WEILEXXXXXXXXXXCKNLSLNAITESTVSDFLLINEKIPVDLVIRTGGECRLSNFLVWQISYSELYFTN
UPPS_BUCAP      WDXXXXXXXXXXXXXXXXXXXXXXXERNFSQYLSTSELLPVDLVIRTGGEKRISNFLLWQIAYSELYFTD
DDPS3_ARATH     LDILRACKSIVKKSEKGLIREEDVDEALIERELLTTEFPSPDLLIRTSGEQRISNFFLWQLAYTELFFSP
UPPS_CHLMU      NELVRAFKELHQDLTNKKXXXXXXXXXXXXXYLDTSGLPDPDLLIRTGGEMRVSNFLLWQIAYTELYVTD
UPPS_CHLAB      DELVRAFKKLHHDLVNKKISLDSVSEELIRLYLDTSEIPDPDLLIRTGGEMRVSNFLLWQIAYTELYVTD
DDPS1_ARATH     FDIMHACKSLVKKSEKGLIREEDVDEALIERELLTSDFPSPDLMIRTSGEQRISNFFLWQLAYSELFFSP
UPPS_METKA      QEIIDAVREIAHDVKVGRLDPDEIDEGTFRKYVYVGDLPDPELIIRTSGEERLSNFLLWYSAYSELYFVD
UPPS_PYRAB      SEIVDAVKDIVRDVMDGKLRVEDIDEELLKKYLYVPNMPDPDIVIRTGGEVRISNFLLYQIAYSELFFVD
UPPS_PYRFU      SEIVDAIKDIVNDVLEGRLKLEDINEEIVRKYLYVPNMPDPDIVIRTGGEVRISNFLLYQIAYSELFFVD
UPPS_PYRHO      SEIVDAVKDIARDVISGKXXXXXXXXXXXXXXXXVPNMPDPDIVIRTGGEVRISNFLLYQIAYSELFFVD
UPPS1_STRAW     QEIADAVRSMLLDAHEKGTSADAVDVDLIGKHLYTGAQPDPDLVIRTSGEQRLSGFMLWQTAHSEYYFCE
UPPS_CHLPN      DELVRAFKKLHVDILNKKIXXXXXXXXXXXXXXXTSGLTDPDLLIRTGGEMRVSNFLLWQIAYTELYITD
UPPS2_COREF     XXXXXXXXXXXXXXXXXXLRPEQINEKTFPDFLDEPDMPDVDLFLRPSGEKRTSNFLLWQSAYAEMVYQD
UPPS_PICTO      QEIIDAIKKIGQDILNGKIKVDNINEEMFRSYLYDKTLPDPDLILRTSGEERISNFLLWQSAYSELYFAD
UPPS_DEIRA      EEIVDAVQSYLRQAAQGATAAENLTPDAIGAHLYAADQPDPDFIIRTSGEIRLSGFMLWQSVYSEYYFCD
CRUP_STRCO      XXXXXXXXXXXXXXVAGTIRPEQIGMAEVARHLYVPEMPDVDLLVRTC-EQRISNFLPWHLAYAELVFDP
UPPS_PYRKO      SEIADAVREIVRDVLEGKIKPEDIDEEAIKRYLYYPNMPDPDIVIRTGGEVRISNFLLYQIAYSELFFVD
UPPS_TREPA      DEILRAVKKVSTSCPDGEL----LTEEAFGACLDAPQLPSVDFLIRTGGQQRMSNFLLWQSAYAEFYFTD
UPPS1_BRAJA     -----SXXXXXXXXXXXXXXLTSLTREAFSQLVGEAGLRDVDLIIRTSGEKRLSDFLLWEGAYAELHFTE
UPPS_PYRAE      AEIVRCI----KRVLSGEVRLETFSEEELFQCLDTRGIPEPDVVVRTGGEKRLSNFLLYQTAYSELIFLE
UPPS1_CORDI     QEIVDAVRELIXXXXXXXXXXXKISVDSISKHLYTSGQPDPDLVIRTSGEQRLSGFLLWQAAYSEIWFTD
UPPS_STRFR      QEVIDAVRELLHEQAAAGTTAASLTMDDITRHLYTAGQPDPDLVIRTSGEQRMSNFLLWQSAYSELYFCE
UPPS_METMA      QDIMQAVRDIATCVSSGKLSLEDVNESLISKHLPAPGVPVPDLIIRTGGDERISNFLPWQANGSETYFCA
UPPS_ARCFU      QEIIDAVRAILRKVRKGEVRPEEIDEKMLEEHLYGEGYSKVDLIIRTGGEQRLSNFLPWQAANSVAYFCD
UPPS1_CORGL     QEIVDAVQKLLTIGKDEGLSVDSVKVDAISTHLYTSGQPDPDLVIRTSGEQRLSGFMLWQSAYSEIWFTD
UPPS_METAC      QDIMQAVRDIAACVSSGKLSLEDVDENLISKHLYPASVPNVDLIVRTGGDERVSNFLPWQANGSETYFCA
ZFPP_MYCBO      REIVDAVALLSKELANGATAVDAVTVEGISENLYTSGQPDPDLVIRTSGEQRLSGFLLWQSAYSEMWFTE
UPPS_THEAC      EEILDAIKRITRDAMDGKLNIDELDEEKFRMYLYDGRIPDPDLILRTSGEERISNFLLWQSAYSELYFSD
ZFPP_MYCTU      REIVDAVALLSKELANGATAVDAVTVEGISENLYTSGQPDPDLVIRTSGEQRLSGFLLWQSAYSEMWFTE
ZFPP_MYCLE      REIVGAVALLGKELANGXXXXXXXXXXXIARNLYTSGQPDPDLVIRTSGEQRLSGFLLWQSAYSEMWFTE
UPPS_BLOFL      WDIVQGVKKIIAQIQKGVLKPNQINENILCKYVCMNELSPVDLVIRTGGEHRISNFLLWQIAYAELFFTD
YE54_SCHPO      HEIATSVQSIVKMAEDGTITPEDIDEDIFEKNXXXXXXXXXXXXXRTSGVERLSDFMLWQCKNTEIKFID
UPPS_SULAC      QEILDAIRKIMNDYKLGIIDSKSIDESTFRKYLYDQELSDIDLLIRSSGEIRISNFLLWHLAYSELFFVD
UPPS_HALSA      DELLTXXXXXXXXXXXXXXXXXXIDAQAIESRLHTSPVRDVDLIIRTGGDERTSNFLPWHANGSEVFFCT
UPPS_THEVO      EEILXXXXXXXXXXXXXXXNVDEIDESKFRNYLYDGNLPDPDLILRTSGEERISNFLLWQSAYSELYFSD
UPPS1_COREF     QEIVDAVRDLARD--EGKTLIESVDAQAISTHLYTSGQPDPDLVIRTSGEQRLSGFMLWQSAYSEIWFTD
DHDDS_HUMAN     HEISNAVREMAWGVEQGLLDPSDISESLLDKCLYTNRSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP
UPPS_SULTO      QEIIDATKKIIADYEKGKIKLDDINENIFRQYLYDKELEDIDLVIRSSGEIRISNFLLWHIAYSELFFVD
UPPS_HALMA      AELLGAARDVAAAVENETLDPTDVSAETIEERLYEGPTRDVDLIVRTGGDERTSNFLPWHANGNETFFCT
UPPS_CAMJR      DEIIRAAKRVI-------XXXXXXXXXXXTQNLD---LPDVDLMLRVGNAKRLSNFLLWQCSYAEIYFSE
UPPS_CAMJE      DEIIRAAKRVI-------XXXXXXXXXXXTQNLD---LPDVDLMLRVGNAKRLSNFLLWQCSYAEIYFSE
DHDDS_MOUSE     HEIANAVREMAWGVEQGLLEPSDVSESLLDKCLYSNHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP
UPPS_SULSO      QEILDAVVRLLDDYRNGKIVKSEINEETFRKYFYDSELQDIDLVIRTSGEVRISNFLLWHVAYSELFFCE
UPPS2_TROWT     AEITEAVRKIVNTYPIGDLP-EKITEEVISANLYTGGLSDPDLIIRTSGEQRLSDFMPWQSTHSEFYFLE
UPPS2_STRCO     REIVDAVRSALTEHSSQGGDIDTFTMEHISKHLYSKTRSESDLIIRTSGEQRLSGFLLWQSAYAEVHFCE
UPPS1_TROW8     AEITEAVRKIVNTYPIGDLP-EKITEEVISANLYTGGLSDPDLIIRTSGEQRLSDFMPWQSTHSEFYFLE
UPPS_BORBU      NEILRA----VKKFVSSDFDLESLNENIFSSFXXXXXXXXXXXXIRTGGNIRISNFFLWRIAYSELIFSN
DDPS6_ARATH     DEIVQAVKKSASNYKHEDSDSDIEGTDMIEENMQMSVAPNPDILIRSSGETRLSNFLLWQTGNTQLCSPA
RER2_YEAST      EEILHAMKETIVQHKKGA----AIDESTLESHLYTAGVPPLDLLIRTSGVSRLSDFLIWQASSKRIELLD
SRT1_YEAST      NDMLHTIRDSVEDHLENRINIRKFTNKMYMGFHSNK----CELLIRTSGHRRLSDYMLWQVHENATIFSD
DDPS8_ARATH     VEIVHAVRDSCVRKSKTGDGSSALELSDIEECMYTSVVPVPDLVVRTGGGDRLSNFMTWQTSRALLHRTE
DDPS7_ARATH     LEIVHAVRSCVRKCTNGXXXXXXXXXXXXXC-MYTSIVPVPDLVIRTGGGDRLSNFMTWQTSRSLLHRTE
UPPS_AERPE      PDGRRVVAGLCYDPF---WEIEHYTPKTLPSRL----LDEIDLVIRTGGEKRLSSFFPLLTRYAELYFID
RER2_ENCCU      DEITRGI--------------------QFNSHV--------DILIRTSNTKRLSNFMIRQVAKTSVFFAK
NGBR_HUMAN      ADIVRAAQDFCQLVAQKQKRPTDLDVDTLASLLSSNGCPDPDLVLKFGPVDSTLGFLPWHIRLTEIVSLP
NGBR_MOUSE      -DIVRAAQDFCQLVAQQQRKPTXXXXXXXXXXXXXHGFPDPDLVLKFGPVDSTLGFLPWQIRLTEIVSLP
UPPS_SCHPO      DAIIDLTRGLADLCTKKVISSTQVTLELIDKELKESVIPEPDLLIIFAPLLKLQGFPPWQLRLCEIFHDP
NGBR_DANRE      LSIVQAAQQLCRAVEQKEKTSKDINVSVLDSLLESKNIPDPDLVLKFGTVQSTLGFLPWHIRLTEIISMP
UPPS_YEAST      ETIVDLTKTMAELCAVNELSVSDITMDLVDSELKQLVGPEPDLLLYFGPSLDLQGFPPWHIRLTEF----


                         .         .         .         +         .         .         .:280
query           EYWPDFDRQRFFSAIEQYATRDRRFGALAEQVAVAGA
UPPS_AGRT5      EYWPDFDRQRFFSAIEQYATRDRRFGALAEQVAVAGA
UPPS_RHIME      DLWPDFTRETFFAAIEQYACRERRFGGLTQPTLAVGS
UPPS_BRUSU      CHWPDFRPTDLDAAYETFRQRERRFGGV---------
UPPS_BRUME      CHWPDFRPADLDAAYETFRQRERRFGGV---------
UPPS_BRUAB      CHWPDFRPADLDAAYETFRQRERRFGGV---------
UPPS_RHILO      CYWPDFSRE----------------------------
UPPS2_BRAJA     IHWPDFDK-----------------------------
UPPS_PHOPR      QHWPDFDEESFANAIAWYINRERRFGCTGEQI-----
UPPS_VIBF1      QYWPDFNEQSLADAVAWFVSRERRFGCTGEQI-----
UPPS_THETN      VLWPDFKKRHLIEALLYYQTRKRRFGGV---------
UPPS_GEOKA      VLWPDFTEQHFLEAIAAYQRRDRRFGGVS--------
UPPS_CLOPE      INWPDFNGEDLRKAIFDYQNRDRRFGGI---------
UPPS_HELMO      TLWPDFGRKEMVQAIVDYQGRDRRFGGV---------
UPPS_CHRVO      LLWPDFDRAALQEAIHSYWQRERRFGRTSEQL-----
UPPS_VIBPA      EFWPEFDEDSLVEAVTWFINRERRFGCTGEQV-----
UPPS_CLOTE      IKWPDFKKHHLHKAIKDYQNRNRRFGGV---------
UPPS_GEOSL      VNWPEFTPEELYRALSDYQARERRFGRTSAQI-----
UPPS_BACSK      VYWPNFTEHHFYKAVLTYQNRGRRYGGV---------
UPPS_BACCR      VYWPDFKEEHLLNAITDFQHRGRRFGGV---------
UPPS_BACHK      VYWPDFTEEHLLNAITDFQHRGRRFGGV---------
UPPS_BACAN      VYWPDFTEEHLLNAITDFQHRGRRFGGV---------
UPPS_BACC1      VYWPDFTEEHLLNAITDFQHRGRRFGGV---------
UPPS_VIBCH      VFWPEFDENCLIEAVTWFVNRERRFGCTGEQV-----
UPPS_HAEDU      VLWPDFDETSFSEAIYAYQQRERRFG-----------
UPPS_PSEPK      LYWPDFKHEAMRNALADFASRQRRFGKTSEQVE-AGA
UPPS_STAS1      KLWPDFDKEELINCIKIYQSRQRRFGGL---------
UPPS_BACTN      TFWPDFDKEEFCKAIYEYQQRERRFGKTSEQIS----
UPPS_VIBVY      VFWPDFGEESLIEAITWFVNRERRFGCTGEQI-----
UPPS_VIBVU      VFWPDFGEESLIEAITWFVNRERRFGCTGEQI-----
UPPS_SYNY3      TLWPDFDRQAFHLALRDYQQRHRRFG-----------
UPPS_XANOR      TLWPEFDAGVMQQALDDYAGRERRFGLTSAQIA----
UPPS_STAES      KLWPDFDEKELRECLKIYQSRQRRFGGLSEE------
UPPS_STAEQ      KLWPDFDEKELRECLKIYQSRQRRFGGLSEE------
UPPS_STAAW      KLWPDFDEDELIKCIKIYQSRQRRFGGLSEE------
UPPS_STAAS      KLWPDFDEDELIKCIKIYQSRQRRFGGLSEE------
UPPS_STAAR      KLWPDFDEDELIKCIKIYQSRQRRFGGLSEE------
UPPS_STAAC      KLWPDFDEDELIKCIKIYQSRQRRFGGLSEE------
UPPS_ANAVT      TLWPDFDRTEFHRALCAYQQRERRFG-----------
UPPS1_ANASP     TLWPDFDRTEFHRALCAYQQRERRFG-----------
UPPS_XANAC      TLWPEFDAGVLQQALDDYAGRERRFGLTSAQIA----
UPPS_STAAN      KLWPDFDEDELIKCIKIYQSRQRRFGGLSEE------
UPPS_STAAM      KLWPDFDEDELIKCIKIYQSRQRRFGGLSEE------
UPPS_MICLU      EFWPDFNEESLAQCISIYQNRHRRFGGL---------
UPPS_PSESM      LFWPDFKHDAMRAALADFASRQRRFGKTSEQVE-AGA
UPPS_THEEB      TLWPDFDRSAFHEALRDYQQRQRRFG-----------
UPPS_NEIMB      ILWPDFDGKALDDAVASFQKRERRFGRTSEQLPI---
UPPS_NEIG1      ILWPDFDETALDAAVASFQKRERRFGRTSEQLPI---
UPPS_CLOAB      INWPDFSIEDLHTAIKDYQNRDRRFGGV---------
UPPS_NEIMA      ILWPDFDGKALDDAVASFQKRERRFGRTSEQLPI---
UPPS_BACHD      VLWPDFTEHHLTEAIAVYQKRARRYGGV---------
UPPS_PORGI      TLWPDFDADCLKAAIEEYSSRERRFGKTSEQIAL---
UPPS_CHLTE      TLWPDFRRNELYEAIREFQKRERRFGKTSEQL-----
UPPS_STAHJ      KLWPDFDGEEFKNCLKIYQSRQRRFGGLSKE------
UPPS_RALSO      RYWPDFDAAEMDRAFAWYRNRERRFGRTSAQL-----
UPPS2_ANASP     ILWPDFDREAFHQALLSYQKRDRRFG-----------
UPPS_STRMU      TLWPDFDKKALYLAIEEFNHRHRRFGGV---------
UPPS_STRA5      VLWPDFKKDELHKAIVDYNQRHRRFGSV---------
UPPS_STRA3      VLWPDFKKDELHKAIVDYNQRHRRFGSV---------
UPPS_NITEU      TLWPDFDASALDEAIASYRKRERRFGRTSEQIA----
UPPS_PROMP      VLWPDFTESEFLKAIIDYQSRNRRFGGI---------
UPPS_COXBU      ALWPDFNEETFDQALAFYRTRQRRFGLTPEQV-----
UPPS_STRP8      VLWPDFKKAELLKAIADYNRRQRRFG-----------
UPPS_STRP6      VLWPDFKKAELLKAIADYNRRQRRFG-----------
UPPS_STRT2      VFWPDFDQQGLHQAISDYNKRHRRFGGV---------
UPPS_STRT1      VFWPDFDQQGLHQAISDYNKRHRRFGGV---------
UPPS_LISIN      THWPDFSKEDFLQAIIEYQNRSRRFGGL---------
UPPS_GLOVI      VLWPDFDRAAFHAALQSYQGRQRRFG-----------
UPSS_MYCBO      KLWPDYDRRDLWAACEEYASRTRRFGS----------
UPPS_ZYMMO      TLWPDF-------------------------------
UPPS_STRP1      VLWPDFKKAELLKAIADYNRRQRRFG-----------
UPPS_MYCTU      KLWPDYDRRDLWAACEEYASRTRRFGS----------
UPPS_MYCLE      KLWPDYDRRDLWAACEEYASRNRRFGS----------
UPPS_BORPE      QFWPDFGADELDAAFEWYRTRERRFGRTSAQL-----
UPPS_BORPA      QFWPDFGADELDAAFEWYRTRERRFGRTSAQL-----
UPPS_BORBR      QFWPDFGADELDAAFEWYRTRERRFGRTSAQL-----
UPPS_BACSU      VLWPDFKEDHFLQAL----------------------
UPPS_XYLFT      VMWPEFNSTVLQQALDDYASRERRFGLTNAQIASRG-
UPPS_XYLFA      VMWPEFNSTVLQQALDDYASRERRFGLTNAQIASRG-
UPPS_STRP3      VLWPDFKKAELLKAIADYNHRQRRFG-----------
UPPS_CAUCR      VLWPDYGPEALAAAIAEYRGRDRRY------------
UPPS_LISMF      THWPDFSKEDFLQAIIEYQNRSRRFGGL---------
UPPS_SHIFL      VLWPDFDEQDFEGALNAFANRERRFG-----------
UPPS_PHOLL      ILWPDFDENVFEGAINAFAKRERRFGGTIPDDADVGS
UPPS_LISMO      THWPDFSKEDFLQAIIEYQNRSRRFGGL---------
UPPS_ECOLI      VLWPDFDEQDFEGALNAFANRERRFG-----------
UPPS_ECOL6      VLWPDFDEQDFEGALNAFANRERRFG-----------
UPPS_ECO57      VLWPDFDEQDFEGALNAFANRERRFG-----------
UPPS_PSEAE      LFWPDFKHAAMRAALADFSKRQRRFGKTSEQV-----
UPPS_ENTFA      ALWPDFSGDTLETAIASFQNRNRRFGGLKETTETEGS
UPPS_PROMM      VCWPDFDEVALTKALFDYQSRCRRFGGL---------
UPPS_STRR6      TLWPDFDEAALQEAILAYNRRHRRFGGV---------
UPPS_STRPN      TLWPDFDEAALQEAILAYNRRHRRFGGV---------
UPPS_THEMA      KLWPDFTKRDFLRAIESYSKRERRFGGL---------
UPPS_SHEON      TLWPDFDEQAFHEAIATFANRQRRFGLTGSQI-----
UPPS_HAEIN      VLWPDFNQLEFNRAIASYQQRHRRFG-----------
UPPS_LACJO      KLWPDFDKTDLEELVKDYQGRNRRFG-----------
UPPS_RHOBA      KCWPEFERDDFQAALDEFAGRQRRFGGL---------
UPPS_OCEIH      KLWPEFDEDTFHQALMEYQQRKRRYGGI---------
UPPS_XANCP      TLWPEFDAGVLQQALDDYAGRERRFGLTSAQIA----
UPPS_SALTY      VLWPDFDEQDFEGALHAFANRERRFG-----------
UPPS_SALPA      VLWPDFDEQDFEGALHAFANRERRFG-----------
UPPS_TREDE      TLWPDWTVENLYEAIEDYKKRNRRYG-----------
UPPS_HELHP      TLFPSFGKNELNAMLEEFLQRQRRFGGV---------
UPPS_SALTI      VLWPDFDEQDFEGALHAFANRERRFG-----------
UPPS_LEGPA      VHWPDFNEHEFELALTSFARRARRFGQISQ-------
UPPS_ERWCT      VLWPDFDEQVFEGALNAFAQRERRFG-----------
UPPS_LEGPL      VHWPDFNEHEFELALISFSKRARRFGQISQ-------
UPPS_LEGPH      VHWPDFNEHEFELALISFAKRARRFGQISQ-------
UPPS_FRATT      IMWPDFSKQELTRAVEYFYSRQRRFGKSGEQI-----
UPPS_LACAC      KNWPDFDKDDLKEFVDEYKHRNRRFGKVDE-------
UPPS_SYNPX      VFWPDFNAEALKRALLDFQSRSRRFGGL---------
UPPS_CHLTR      VLWPDFTANDLLEAIKTYQQRSRRGG-----------
UPPS_MYCPF      KLWPDYDRRDLWAACEEYVQRNRRFG-----------
UPPS2_TROW8     KLWPDFRRDDFWAALRAYSGRSRRFG-----------
UPPS1_TROWT     KLWPDFRRDDFWAALRAYSGRSRRFG-----------
UPPS_YERPS      VLWPDFDENVFEGALNAFAQRERRFG-----------
UPPS_YERPE      VLWPDFDENVFEGALNAFAQRERRFG-----------
UPPS_PROMA      TLWPDFDSISLTKALIDYQSRRRRFGGV---------
UPPS_LACPL      VKWPDFTAATLQACIADFQSRDRRFGGLSD-------
UPPS_WIGBR      VLWPDFDHVIFSNAINSFAKRERRFGKI---------
UPPS_FUSNN      VLWPDFDEKEIDKAIESYNQRERRFGGV---------
UPPS_WOLSU      TLWPDFTAGELAIQIEEFKRRKRRFGGI---------
UPPS_PASMU      VLWPDFNEKEFNEAIIAYQQRHRRFGGAEE-------
UPPS_BIFLO      ELFPDCGRDVLWRSIDHYIHRDRRFGGV---------
UPPS_AQUAE      TLWPDFTREEFMKALEDYSRRKRKFGRVLDE------
UPPS_LACLA      TAWPDFDDKELDKAISAFQKRDRRYGGV---------
UPPS_ACIAD      TLWPEFSIDEFDHALAVFAGRERRFGKTSEQI-----
UPPS2_CORDI     KLFPDYTPEDLFAAVEEYALRDRRFG-----------
UPPS_AQUPY      TLWPDFSREEFLKALEDFSRRKRKFGRVLDE------
UPPS_RICBR      KYWPDFNKEDIINAIDDYSKRKRTFG-----------
UPPS_BUCAI      VLWPDFNCHIFQHAIDSFVSRERRFG-----------
DDPS2_ARATH     ELWPDFGRSGFIEAL----------------------
DDPS5_ARATH     VLWPDFGEAEYLEALTWYQQRQRRFG-----------
UPPS1_STRCO     VLWPDFDRRDLWRACLEFASRDRRFG-----------
UPPS_RICSI      KYWPDFNKYDIQEAINDYSKRKRTFG-----------
UPPS_RICCN      KYWPDFNKYDIQEAINDYSKRKRTFG-----------
UPPS_METTH      SLWPELRKVDFLRAIRSYQQRERRFG-----------
UPPS_CHLCV      ILWPDFKPNHFLDAIKAYQHRSRRGG-----------
UPPS_RICTY      KYWPDFNKDDIHEAINDYSKRKRTFG-----------
UPPS_RICFE      KYWPAFNKDDIIEAINDYSKRKRTFG-----------
UPPS_HELPY      ILWPDFTPKDLENIISDFYKRVRKFGEL---------
UPPS_METJA      IYWPLFRRVDFLRAVRDYXXXXXXFG-----------
UPPS_HELPJ      ILWPDFTPKDLENIISDFYKRVRKFGEL---------
UPPS_LEPIN      TLWPEFDKNSLVDSLKWYETRTRKFGGL---------
UPPS_LEPIC      TLWPEFDKNSLVDSLKWYETRTRKFGGL---------
UPPS2_CORGL     KLFPDFTQQDLYDAVLEYAKRDRRFGS----------
UPPS2_STRAW     VLWPDFDRRDLWRACVEYASRDRRFG-----------
UPPS_THET8      VLWPEFRKIDFLRALRSYQARERRFG-----------
UPPS_THET2      VLWPEFRKIDFLRALRSYQARERRFG-----------
UPPS_RICPR      KYWPDFNKDDIHEAINDYSKRKRTFG-----------
DDPS4_ARATH     VLWPDFDKQKFIEALVSYQRRDRRFGS----------
UPPS_BUCBP      TLWPDFDRKEFKKAIDEFSNRERRFGRVS--------
UPPS_BUCAP      ILWPDFNWRDFQHAIDYFFTRERRFGGIS--------
DDPS3_ARATH     VLWPDFDKDKLLEALVSYQRRERRFG-----------
UPPS_CHLMU      VLWPDFTAHDLLEAIKTYQQRSRRGG-----------
UPPS_CHLAB      VLWPDFKPYHLLDAIKAYQHRSRRGG-----------
DDPS1_ARATH     VFWPDFDKDKLLEALASYQRRERRFG-----------
UPPS_METKA      VYWPEFRKIDLLRAIREFQKRERRFG-----------
UPPS_PYRAB      VYFPEFRKIDFLRIIREFQKRERRFG-----------
UPPS_PYRFU      VYFPEFRKIDFLRIIREFQKRERRFG-----------
UPPS_PYRHO      VYFPEFRKIDFLRIIREFQKRERRFG-----------
UPPS1_STRAW     VFWPAFRKVDFLRALRDYAARHRRYG-----------
UPPS_CHLPN      TLWPDFTPQDLFEAINVYQQRSRRGG-----------
UPPS2_COREF     KLFPDFTPQDLFDAVEEYARRDRRFG-----------
UPPS_PICTO      VNWPELRKIDFLRAIYSYQNRKRRFG-----------
UPPS_DEIRA      VYWPGFRRVDFLRALRDFQGRDRRFG-----------
CRUP_STRCO      APWPDFDLARLRDAVDSYAGRERRFGGDAELPAQAG-
UPPS_PYRKO      VYFPEFRKIDFLRIIREFQKRQRRFG-----------
UPPS_TREPA      ILWPDFRVEDMLRALDEYRLRTRTFGGL---------
UPPS1_BRAJA     RMWPEFDAGDLAEALAAFHGRERRFGGL---------
UPPS_PYRAE      KLWPEVEREDLVYIIEEYSRRQRRFG-----------
UPPS1_CORDI     TYWPAFRRVDFLRALREYSKRSRRFG-----------
UPPS_STRFR      AYWPAFREIDFLRALRSYAARQRRYGA----------
UPPS_METMA      PFWPEFRKIDLLRSVRVYQAR----------------
UPPS_ARCFU      VYWPEFRKIDLLRAIRAWQYR----------------
UPPS1_CORGL     TYWPAFRRIDFLRAIRDYSQRSRRFG-----------
UPPS_METAC      PFWPEFRKIDLLRSIRVYQAR----------------
ZFPP_MYCBO      AHWPAFRHVDFLRALRDYSARHRRYG-----------
UPPS_THEAC      VYWPEFSKLDFLRAIYSYQRRQRRFG-----------
ZFPP_MYCTU      AHWPAFRHVDFLRALRDYSARHRSYG-----------
ZFPP_MYCLE      THWPAFRRVDFLRALRDYSMRHRRYG-----------
UPPS_BLOFL      VLWPDFNDIVFRRALHSFMKRDRRFGKSA--------
YE54_SCHPO      FYWPDFSIWKFFPMLIQYQLQNQ--------------
UPPS_SULAC      VYWPDFRKIDLWRAIRSFQKRKRNFGA----------
UPPS_HALSA      PYWPEFSKVDLLRAIRTYESR----------------
UPPS_THEVO      VYWPEFSKLDFLRAIYSYQRRQRRFG-----------
UPPS1_COREF     TYWPAFRRIDFLRALRDYSQRSRRFG-----------
DHDDS_HUMAN     VLWPEYTFWNLFEAILQF-------------------
UPPS_SULTO      TYWPDFRKIDLWRAIRSYQKRKRNFGA----------
UPPS_HALMA      PYWPEFRKVDFLRAIRTYQNRE---------------
UPPS_CAMJR      TLFPSLTKREFKRIIKEFRNRERTFG-----------
UPPS_CAMJE      TLFPSLTKREFKRIIKEFRNRERTFG-----------
DHDDS_MOUSE     VLWPEYTFWNLCEAILQF---QRNHGAL---------
UPPS_SULSO      AYWPEFRKIDLWRAIRSFQKRKRNFGA----------
UPPS2_TROWT     ALGPDLRKVDFLRAIRDFSIRRRSFGA----------
UPPS2_STRCO     TYWPDFREIDFLRALRSYSLRERRYG-----------
UPPS1_TROW8     ALGPDLRKVDFLRAIRDFSIRRRSFGA----------
UPPS_BORBU      VLWPEYYDTRYSKDLECFQFRRRNFG-----------
DDPS6_ARATH     ALWPEIGLRHLLWAI----------------------
RER2_YEAST      CLWPEF-------------------------------
SRT1_YEAST      TLWPNFSKWSFFSTIQKY-------------------
DDPS8_ARATH     ALWPE--------------------------------
DDPS7_ARATH     ALWPELGLWHLFQRMQDYLTKKKK-------------
UPPS_AERPE      KLWPDFTREDLDRAVQWFSTRRRPMG-----------
RER2_ENCCU      ALWPELTTAHLF-------------------------
NGBR_HUMAN      SHL-NISYEDFFSALRQYAACEQRLG-----------
NGBR_MOUSE      SHL-NISYEDFFSALRQYAACEQRLG-----------
UPPS_SCHPO      ILYTT-NYLTFFKALVHYSNAEMRLG-----------
NGBR_DANRE      SH-IDASYDDLYDALQRFAGCEQRLG-----------
UPPS_YEAST      -YWEKDNNEVIYSGLRQYA------------------