[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for atum0:AAK87211.2

[Show Plain Result]


## Summary of Sequence Search
    1::306
  161::293     5e-05  29%  656 aa  MTHR_HUMAN RecName: Full=Methylenetetrahydrofolate reductase;      
  169::292     1e-04  31%  654 aa  MTHR_MOUSE RecName: Full=Methylenetetrahydrofolate reductase;      
  161::293     1e-04  29%  656 aa  MTHR_MACFA RecName: Full=Methylenetetrahydrofolate reductase;      
  160::292     1e-04  32%  655 aa  MTHR_BOVIN RecName: Full=Methylenetetrahydrofolate reductase;      
    1::306

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTHR_HUMAN      ----------------------------------------------------------------------
MTHR_MOUSE      ----------------------------------------------------------------------
MTHR_MACFA      ----------------------------------------------------------------------
MTHR_BOVIN      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLGGGQKQPAGSFSSSIDMIETGLFDKMGF
MTHR_HUMAN      -----------------------------------------IGDQWEEEEGGFNYAVDLVKHIRSEFGDY
MTHR_MOUSE      --------------------------------------------------GGFSYATDLVKHIRTEFADY
MTHR_MACFA      -----------------------------------------IGDQWEEEEGGFNYAVDLVKHIRSEFGDY
MTHR_BOVIN      -----------------------------------------IGDQWEEEEGGFNYATDLVKHIRNEFGDY


                         +         .         .         .         .         *         .:210
query           THLHLAGHPEGNRDIDSDGSSRGVDQALLWKQDFASRTDARLALTTQFAFEAKVVIEWAKRIGNMGVTIP
MTHR_HUMAN      FDICVAGYPKGHPEAGSEADLKHLKEKVSAGADF---------IITQLFFEADTFFRFVKACTDMGITCP
MTHR_MOUSE      FDICVAGYPRGHPDAESEDDLKHLKEKVSAGADF---------IITQLFFEASTFFSFVKACTEIGISCP
MTHR_MACFA      FDLCVAGYPKGHPEAGSEADLKHLKEKVSAGADF---------IITQLFFEADTFFRFVKACTDMGITCP
MTHR_BOVIN      FDVCVAGYPKGH----PEGESFEADLKHL-KEKVAAGADF---IITQLFFEAETFFRFVKACSEIGITCP


                         .         .         .         +         .         .         .:280
query           VHVGIAGPTKLQTLIKFAIACGVGPSLKVLQKRALDLSRLFVPYEPTDFIAELIDHKAAxxxxxxxxxxx
MTHR_HUMAN      IVPGIQGYHSLRQLVK--------------------LSKLEVPQEIKDVIEPIKDNDAA-----------
MTHR_MOUSE      ILPGIQGYTSLRQLVK--------------------LSKLEVPQKIKDVIEPIKDNDAA-----------
MTHR_MACFA      IVPGIQGYHSLRQLVK--------------------QSKLEVPQEIKDVIEPIKDNDAA-----------
MTHR_BOVIN      VLPGIQGYHSLRQLVK--------------------LSKLEVPQQIKDVIEPIKDNDAA-----------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxx
MTHR_HUMAN      --------------------------
MTHR_MOUSE      --------------------------
MTHR_MACFA      --------------------------
MTHR_BOVIN      --------------------------