[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for atum0:AAK87429.2

[Show Plain Result]


## Summary of Sequence Search
    1::228
    3::203     2e-27  36%  207 aa  BLUB_RHOCA RecName: Full=Putative cob(II)yrinic acid a,c-diamide
    5::172     1e-10  30%  172 aa  Y226_ARCFU RecName: Full=Putative NADH dehydrogenase/NAD(P)H
    2::149     1e-09  35%  174 aa  Y2267_ARCFU RecName: Full=Putative NADH dehydrogenase/NAD(P)H
   25::160     1e-09  34%  191 aa  Y120_METTH RecName: Full=Putative NADH dehydrogenase/NAD(P)H
  145::200     1e-06  36%  344 aa  YKH5_CAEEL RecName: Full=Uncharacterized protein C02C2.5;
   75::146     1e-06  35%  289 aa  IYD1_PIG RecName: Full=Iodotyrosine dehalogenase 1;       
   71::138     2e-06  35%  285 aa  IYD1_MOUSE RecName: Full=Iodotyrosine dehalogenase 1;       
   72::138     3e-06  33%  285 aa  IYD1_RAT RecName: Full=Iodotyrosine dehalogenase 1;       
   75::145     5e-06  34%  289 aa  IYD1_PONAB RecName: Full=Iodotyrosine dehalogenase 1;       
   75::146     2e-05  32%  289 aa  IYD1_HUMAN RecName: Full=Iodotyrosine dehalogenase 1;       
   25::176     8e-05  26%  194 aa  YFHC_BACSU RecName: Full=Putative NAD(P)H nitroreductase yfhC;     
  276::398     2e-04  27%  429 aa  COFE_STRAU RecName: Full=F420-0:gamma-glutamyl ligase;       
    7::134     3e-04  27%  184 aa  Y1542_HAEIN RecName: Full=Putative NAD(P)H nitroreductase HI1542;  
    8::181     3e-04  30%  240 aa  FRP_VIBHA RecName: Full=NADPH-flavin oxidoreductase;       
  226::402     5e-04  25%  423 aa  COFE_STRAW RecName: Full=F420-0:gamma-glutamyl ligase;       
  290::411     8e-04  30%  443 aa  COFE_STRCO RecName: Full=F420-0:gamma-glutamyl ligase;       
    1::228

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxPFDHALSPARPFSGAEREAIYRAIETRRDVRDQFLPDPLPEELVERLLKAAHSAPSVGFMQPWNFT
BLUB_RHOCA      ---------------FEQTHRDALTEVLRWRRDVR-HFRPDPIDEAVIDRLRAVMDMAPSVGNARPWRVI
Y226_ARCFU      ---------------------DLLFRRVSIRK-----FTQDDVDDEILMKILEAGNAAPSAGNLQARDFV
Y2267_ARCFU     ---------------------EECLKMIYTRRSIR-VYSDRQISDEDIEKILKAAMLAPSAGNEQPWHFI
Y120_METTH      -----------------------VLEAIKTRRSIR-KYQDREVPEELIDKILDAAMCGPSAVDERPWHFI
YKH5_CAEEL      ---------------------QIFYEEMKMRRSCR-QFSSRDVPLKVIQNLLKTAGTSPSVGNLQPWTFC
IYD1_PIG        ----PFSHTRYPEKEMVRRSQE-FYELLNKRRSVR--FISNEVPMEVIDNVIKAAGTAPSGAHTEPWTFV
IYD1_MOUSE      ----PFSHTRYPEQEMRMRSQE-FYELLNKRRSVRF-ISSEHVPMEVIENVIKAAGTAPSGAHTEPWTFV
IYD1_RAT        -----FSHTRYPEQEMRMRSQE-FYELLSKRRSIRF-ISSEPVPMEVIDNVIKAAGTAPSGAHTEPWTFV
IYD1_PONAB      ----PFSHTHYPEKEMVKRSRE-FYELLNKRRSVR--FISEQVPMEVIDNVIRTAGTAPSGAHTEPWTFV
IYD1_HUMAN      ----PFSHNHYPEKEMVKRSQE-FYELLNKRRSVR--FISEQVPMEVIDNVIRTAGTAPSGAHTEPWTFV
YFHC_BACSU      ------------------------------------KFKQEPVPSAVILDMLETAKYAPNHRVTEPWRFI
COFE_STRAU      ------------------------------------------------------------------WRFV
Y1542_HAEIN     ---------------------------LTTRKSNKKLTAPAPNAEQL-ERIFEAAMRAPDHGKLHPYHFI
FRP_VIBHA       ---------------------------ILAHRSIR-KFTAVPITDEQRQTIIQAGLAASSSSMLQVVSIV
COFE_STRAW      ---------------------EAVREAVTQRRTVR-AFTDEPVDPGXXXXXXXXXXXXXXXXXXXXWRFV
COFE_STRCO      ------------------------------------------------------------------WRFV


                         .         .         *         .         .         .         .:140
query           LVTDGGVRQAAWVAFSRANEEAAAMFEGEKQALYRSLKLEGIRKAPLSICVTCDPTRGGKVVLGRTHNPR
BLUB_RHOCA      RVDSPALRAEVLXXXXXXXXXXXXXXXXXXXXXXXTLKLQGIDQAPLQLAVFTDPAAGHG--LGRASMPV
Y226_ARCFU      VIRNP---------------------ETKKRLAMAALKQMFIAEAPVVIVVCANYPRSMRV-----YGER
Y2267_ARCFU     VVRDREMLKKMSEAFTFG---------------------QMLPNASAAIVVCADP---------KLSKYP
Y120_METTH      VV--------------RNREMLEKIPEVHPYGAM-------VKDAPVAIIVCCDSS--------LEKIPG
YKH5_CAEEL      VVSSDSIK--------------------------------------------------------------
IYD1_PIG        VVKDPDVK--------------------------------------------------------------
IYD1_MOUSE      VVKD------------------------------------------------------------------
IYD1_RAT        VVKD------------------------------------------------------------------
IYD1_PONAB      VVKDPDV---------------------------------------------------------------
IYD1_HUMAN      VVKDPDVK--------------------------------------------------------------
YFHC_BACSU      YVSSETGKANLINTFAAFSKKSKPDMTEEKLQNFKNT----LGRVPGFLL----------VVFQEDENER
COFE_STRAU      LLESAGTRVRLLDAMLGAWQRDLRELDGEARIARRTARGDVLRDAPYLVCLVMDGSHDYPDPRRAAAERE
Y1542_HAEIN     VMENESLNKLETLL-----KAAVVEFDLGEEKLMKAENLAHRAPMVIGVVAKIDPTI-AKV------PGW
FRP_VIBHA       RVTDSEKRELAQFAGNQAYVESAAEF--------LVFCIDYQRHATINPDVQADFTE--LTLIGA-----
COFE_STRAW      LLESAESRRDAWIADLRGDRKT------EESIAKRVRRGDVLRNAPYLVCMVMDGSHSYGDARRDAAERE
COFE_STRCO      LLESGESRRDAWIADLRRDGKS------EESVAKRVRRGDVLRNAPYLVCLVMDGSHTYGDVRRDAAERE


                         +         .         .         .         .         *         .:210
query           TDVYSTVCAIQNLWLAARAEGIGVGWVSIFHDSDVRAILDIPEHIEIVAWLCLGRVDALYTEPELAVKGW
BLUB_RHOCA      TLQQSTAMAIHTLWLAARAENLGLGMVSVLDPKAVERLLNAPPDWDFVAWLCIGVPEFTDDTPLLHRAGW
Y226_ARCFU      GRLYAATAAIENILLAVTALNLGAVWVGAFDEEQVSEILELPEYVRPMAIIPIGH-PAENPSP-------
Y2267_ARCFU     YDMWVQDCATENILLAARCLGIGSVWLGVYPREELRELLGIPENIVVFSVVSLG----------------
Y120_METTH      FWVQDCSIASQNILLAAHSLGLGAVWTGVYPLEDIRRLFSIPEHV-------------------------
YKH5_CAEEL      ----------------------------------------------------------------------
IYD1_PIG        ----------------------------------------------------------------------
IYD1_MOUSE      ----------------------------------------------------------------------
IYD1_RAT        ----------------------------------------------------------------------
IYD1_PONAB      ----------------------------------------------------------------------
IYD1_HUMAN      ----------------------------------------------------------------------
YFHC_BACSU      ADFAATSSLIQNLQLLAWEKGIGMVWKSILYDKEVHQAFGLQDNERFAAIIQTGYPD-------------
COFE_STRAU      MFTVAAGAGVQNLLVALTGEGYGSAWVSMFCRDTVREVLDLPE---------------------------
Y1542_HAEIN     EQMLSAGCATYGLQLAAQAQGFDNVWIS------------------------------------------
FRP_VIBHA       --VDSGIMA-QNCLLAAESMGLGGVYIGGLRNSQVDELLGLPENSAVLFGMCLGHPD---QNPEV-----
COFE_STRAW      MFVVATGAGVQNFLVALAGERLGSAWVSMFCRDVVRRALGLPESWEPMGAVAVG----------------
COFE_STRCO      MFVVATGAGVQNLLVALAGERLGSAWVSMFCRDVVREVLGLPD---------------------------


                         .         .         .         +         .         .         .:280
query           RQRVPLEELVFRNRWxxx
BLUB_RHOCA      QENLPTE-----------
Y226_ARCFU      RNRYPVSMLTHFEKW---
Y2267_ARCFU     ------------------
Y120_METTH      ------------------
YKH5_CAEEL      ------------------
IYD1_PIG        ------------------
IYD1_MOUSE      ------------------
IYD1_RAT        ------------------
IYD1_PONAB      ------------------
IYD1_HUMAN      ------------------
YFHC_BACSU      ------------------
COFE_STRAU      ------------------
Y1542_HAEIN     ------------------
FRP_VIBHA       KPRLPAHVVVHENQY---
COFE_STRAW      ------------------
COFE_STRCO      ------------------