[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for atum0:AAK87597.2

[Show Plain Result]


## Summary of Sequence Search
    1::417
    1::417       0.0 100%  417 aa  SYY_AGRT5 RecName: Full=Tyrosyl-tRNA synthetase;       
    1::417     e-174  73%  417 aa  SYY_BRUSU RecName: Full=Tyrosyl-tRNA synthetase;       
    1::417     e-173  72%  417 aa  SYY_BRUME RecName: Full=Tyrosyl-tRNA synthetase;       
    1::417     e-173  72%  417 aa  SYY_BRUAB RecName: Full=Tyrosyl-tRNA synthetase;       
    1::417     e-173  72%  417 aa  SYY_BRUA2 RecName: Full=Tyrosyl-tRNA synthetase;       
    1::416     e-172  74%  417 aa  SYY_RHIME RecName: Full=Tyrosyl-tRNA synthetase;       
    1::417     e-165  66%  417 aa  SYY_RHILO RecName: Full=Tyrosyl-tRNA synthetase;       
    1::416     e-157  63%  417 aa  SYY_BARHE RecName: Full=Tyrosyl-tRNA synthetase;       
    1::416     e-153  63%  417 aa  SYY_BARQU RecName: Full=Tyrosyl-tRNA synthetase;       
    1::417     e-150  60%  417 aa  SYY_NITWN RecName: Full=Tyrosyl-tRNA synthetase;       
    1::418     e-142  58%  418 aa  SYY_RHOPA RecName: Full=Tyrosyl-tRNA synthetase;       
    1::417     e-140  61%  417 aa  SYY_BRAJA RecName: Full=Tyrosyl-tRNA synthetase;       
    6::417     e-138  59%  419 aa  SYY_METSB RecName: Full=Tyrosyl-tRNA synthetase;       
    6::415     e-137  59%  416 aa  SYY_XANP2 RecName: Full=Tyrosyl-tRNA synthetase;       
    1::413     e-133  58%  415 aa  SYY_MAGSA RecName: Full=Tyrosyl-tRNA synthetase;       
    9::419     e-133  60%  421 aa  SYY_BEII9 RecName: Full=Tyrosyl-tRNA synthetase;       
    6::414     e-130  59%  417 aa  SYY_SILST RecName: Full=Tyrosyl-tRNA synthetase;       
    6::416     e-128  58%  417 aa  SYY_DINSH RecName: Full=Tyrosyl-tRNA synthetase;       
    6::416     e-126  59%  416 aa  SYY_RHOS5 RecName: Full=Tyrosyl-tRNA synthetase;       
    6::413     e-125  58%  415 aa  SYY_SILPO RecName: Full=Tyrosyl-tRNA synthetase;       
    6::414     e-125  59%  416 aa  SYY_RHOS4 RecName: Full=Tyrosyl-tRNA synthetase;       
    4::412     e-125  58%  414 aa  SYY_PARDP RecName: Full=Tyrosyl-tRNA synthetase;       
    6::414     e-124  58%  416 aa  SYY_RHOSK RecName: Full=Tyrosyl-tRNA synthetase;       
    6::414     e-124  58%  416 aa  SYY_RHOS1 RecName: Full=Tyrosyl-tRNA synthetase;       
    1::414     e-124  52%  418 aa  SYY_RHORT RecName: Full=Tyrosyl-tRNA synthetase;       
    6::414     e-123  55%  416 aa  SYY_ROSDO RecName: Full=Tyrosyl-tRNA synthetase;       
    1::409     e-121  57%  409 aa  SYY_NOVAD RecName: Full=Tyrosyl-tRNA synthetase;       
    7::418     e-120  55%  419 aa  SYY_CAUSK RecName: Full=Tyrosyl-tRNA synthetase;       
    1::407     e-111  55%  409 aa  SYY_ZYMMO RecName: Full=Tyrosyl-tRNA synthetase;       
    3::415     e-109  52%  416 aa  SYY_GLUOX RecName: Full=Tyrosyl-tRNA synthetase;       
    2::413     e-108  46%  420 aa  SYY_WOLPP RecName: Full=Tyrosyl-tRNA synthetase;       
    2::413     e-107  47%  416 aa  SYY_WOLTR RecName: Full=Tyrosyl-tRNA synthetase;       
    3::410     e-107  46%  411 aa  SYY_RICBR RecName: Full=Tyrosyl-tRNA synthetase;       
    5::418     e-106  51%  419 aa  SYY_CAUCR RecName: Full=Tyrosyl-tRNA synthetase;       
    5::418     e-106  51%  419 aa  SYY_CAUCN RecName: Full=Tyrosyl-tRNA synthetase;       
    5::413     e-106  46%  416 aa  SYY_WOLWR RecName: Full=Tyrosyl-tRNA synthetase;       
    5::413     e-106  46%  416 aa  SYY_WOLPM RecName: Full=Tyrosyl-tRNA synthetase;       
    3::410     e-104  45%  411 aa  SYY_RICAH RecName: Full=Tyrosyl-tRNA synthetase;       
    3::410     e-102  44%  411 aa  SYY_RICFE RecName: Full=Tyrosyl-tRNA synthetase;       
    3::410     e-102  45%  411 aa  SYY_RICTY RecName: Full=Tyrosyl-tRNA synthetase;       
    3::410     e-101  44%  411 aa  SYY_RICRS RecName: Full=Tyrosyl-tRNA synthetase;       
    3::410     e-101  44%  411 aa  SYY_RICRO RecName: Full=Tyrosyl-tRNA synthetase;       
    3::410     e-101  44%  411 aa  SYY_RICCN RecName: Full=Tyrosyl-tRNA synthetase;       
    3::410     e-101  44%  411 aa  SYY_RICPU RecName: Full=Tyrosyl-tRNA synthetase;       
    3::410     e-101  44%  411 aa  SYY_RICM5 RecName: Full=Tyrosyl-tRNA synthetase;       
    2::412     e-101  44%  418 aa  SYY_EHRCJ RecName: Full=Tyrosyl-tRNA synthetase;       
    3::410     e-100  43%  411 aa  SYY_RICAE RecName: Full=Tyrosyl-tRNA synthetase;       
    3::410     e-100  43%  411 aa  SYY_RICCK RecName: Full=Tyrosyl-tRNA synthetase;       
    2::412     e-100  45%  418 aa  SYY_EHRRW RecName: Full=Tyrosyl-tRNA synthetase;       
    3::410     e-100  44%  411 aa  SYY_RICPR RecName: Full=Tyrosyl-tRNA synthetase;       
    4::384     e-100  46%  409 aa  SYY_PELUB RecName: Full=Tyrosyl-tRNA synthetase;       
    2::412     3e-99  45%  418 aa  SYY_EHRRG RecName: Full=Tyrosyl-tRNA synthetase;       
    3::408     1e-97  45%  412 aa  SYY_ANAPZ RecName: Full=Tyrosyl-tRNA synthetase;       
    7::424     4e-97  47%  433 aa  SYY_DESOH RecName: Full=Tyrosyl-tRNA synthetase;       
    9::401     9e-97  47%  407 aa  SYY_CLOTE RecName: Full=Tyrosyl-tRNA synthetase;       
    7::409     1e-95  48%  412 aa  SYY_PSEA7 RecName: Full=Tyrosyl-tRNA synthetase;       
   10::400     3e-94  48%  406 aa  SYY_CLOK5 RecName: Full=Tyrosyl-tRNA synthetase;       
   10::400     3e-94  48%  406 aa  SYY_CLOK1 RecName: Full=Tyrosyl-tRNA synthetase;       
    2::401     5e-93  42%  407 aa  SYY1_CLOAB RecName: Full=Tyrosyl-tRNA synthetase 1;       
    2::406     1e-92  42%  408 aa  SYY_CLOTH RecName: Full=Tyrosyl-tRNA synthetase;       
    2::412     2e-92  42%  418 aa  SYY_EHRCR RecName: Full=Tyrosyl-tRNA synthetase;       
    2::400     2e-92  47%  406 aa  SYY_CLOBA RecName: Full=Tyrosyl-tRNA synthetase;       
    2::400     3e-92  46%  406 aa  SYY_CLOBB RecName: Full=Tyrosyl-tRNA synthetase;       
   11::408     5e-92  44%  410 aa  SYY_CLOPH RecName: Full=Tyrosyl-tRNA synthetase;       
   12::380     7e-92  48%  406 aa  SYY_FUSNN RecName: Full=Tyrosyl-tRNA synthetase;       
    4::399     1e-89  48%  406 aa  SYY_THETN RecName: Full=Tyrosyl-tRNA synthetase;       
    7::409     1e-89  45%  412 aa  SYY_PSEAB RecName: Full=Tyrosyl-tRNA synthetase;       
    2::306     1e-89  52%  430 aa  SYY_DESAA RecName: Full=Tyrosyl-tRNA synthetase;       
    7::409     2e-89  45%  412 aa  SYY_PSEA8 RecName: Full=Tyrosyl-tRNA synthetase;       
    7::409     2e-89  45%  412 aa  SYY1_PSEAE RecName: Full=Tyrosyl-tRNA synthetase 1;       
   12::426     2e-89  44%  428 aa  SYY_SYNAS RecName: Full=Tyrosyl-tRNA synthetase;       
    3::410     1e-88  45%  414 aa  SYY_ANAMM RecName: Full=Tyrosyl-tRNA synthetase;       
    2::400     2e-87  45%  406 aa  SYY_CLOPE RecName: Full=Tyrosyl-tRNA synthetase;       
    2::400     3e-87  45%  406 aa  SYY_CLOPS RecName: Full=Tyrosyl-tRNA synthetase;       
    2::400     3e-87  45%  406 aa  SYY_CLOP1 RecName: Full=Tyrosyl-tRNA synthetase;       
    5::403     1e-86  45%  406 aa  SYY_TREDE RecName: Full=Tyrosyl-tRNA synthetase;       
    2::421     1e-86  43%  424 aa  SYY_DECAR RecName: Full=Tyrosyl-tRNA synthetase;       
    8::399     2e-86  45%  407 aa  SYY_CLOB6 RecName: Full=Tyrosyl-tRNA synthetase;       
    8::399     3e-86  45%  407 aa  SYY_CLOBM RecName: Full=Tyrosyl-tRNA synthetase;       
    3::412     5e-85  38%  413 aa  SYY_ORITI RecName: Full=Tyrosyl-tRNA synthetase;       
    8::399     1e-84  46%  407 aa  SYY_CLOBK RecName: Full=Tyrosyl-tRNA synthetase;       
    3::412     2e-84  38%  413 aa  SYY_ORITB RecName: Full=Tyrosyl-tRNA synthetase;       
    8::399     3e-84  46%  407 aa  SYY_CLOBH RecName: Full=Tyrosyl-tRNA synthetase;       
    8::399     3e-84  46%  407 aa  SYY_CLOB1 RecName: Full=Tyrosyl-tRNA synthetase;       
    8::399     4e-84  46%  407 aa  SYY_CLOBL RecName: Full=Tyrosyl-tRNA synthetase;       
    8::399     4e-84  46%  407 aa  SYY_CLOBJ RecName: Full=Tyrosyl-tRNA synthetase;       
    2::400     1e-83  44%  406 aa  SYY_CLOB8 RecName: Full=Tyrosyl-tRNA synthetase;       
    3::419     6e-83  41%  420 aa  SYY2_ENTFA RecName: Full=Tyrosyl-tRNA synthetase 2;       
    7::421     2e-82  42%  424 aa  SYY_CHRVO RecName: Full=Tyrosyl-tRNA synthetase;       
    2::427     1e-81  40%  430 aa  SYY_BACV8 RecName: Full=Tyrosyl-tRNA synthetase;       
    5::403     3e-80  40%  405 aa  SYY_BORAP RecName: Full=Tyrosyl-tRNA synthetase;       
    4::383     4e-79  43%  431 aa  SYY_NEIMB RecName: Full=Tyrosyl-tRNA synthetase;       
    2::427     5e-79  41%  430 aa  SYY_BACFR RecName: Full=Tyrosyl-tRNA synthetase;       
    2::427     5e-79  41%  430 aa  SYY_BACFN RecName: Full=Tyrosyl-tRNA synthetase;       
    4::383     9e-79  42%  431 aa  SYY_NEIMA RecName: Full=Tyrosyl-tRNA synthetase;       
    4::383     1e-78  43%  431 aa  SYY_NEIMF RecName: Full=Tyrosyl-tRNA synthetase;       
    2::419     2e-78  38%  422 aa  SYY1_BACSU RecName: Full=Tyrosyl-tRNA synthetase 1;       
    4::417     2e-78  40%  418 aa  SYY1_BACC1 RecName: Full=Tyrosyl-tRNA synthetase 1;       
    6::418     2e-78  40%  419 aa  SYY1_VIBPA RecName: Full=Tyrosyl-tRNA synthetase 1;       
    4::417     2e-78  40%  418 aa  SYY1_BACHK RecName: Full=Tyrosyl-tRNA synthetase 1;       
    4::417     2e-78  40%  418 aa  SYY1_BACCZ RecName: Full=Tyrosyl-tRNA synthetase 1;       
    4::417     2e-78  40%  418 aa  SYY1_BACAN RecName: Full=Tyrosyl-tRNA synthetase 1;       
   10::435     3e-78  39%  438 aa  SYY_RHOBA RecName: Full=Tyrosyl-tRNA synthetase;       
    4::383     3e-78  42%  431 aa  SYY_NEIM0 RecName: Full=Tyrosyl-tRNA synthetase;       
    5::403     4e-78  39%  405 aa  SYY_BORBZ RecName: Full=Tyrosyl-tRNA synthetase;       
    5::403     4e-78  39%  405 aa  SYY_BORBU RecName: Full=Tyrosyl-tRNA synthetase;       
    2::419     4e-78  39%  421 aa  SYY_BACA2 RecName: Full=Tyrosyl-tRNA synthetase;       
    3::418     6e-78  39%  420 aa  SYY_STACT RecName: Full=Tyrosyl-tRNA synthetase;       
    4::383     7e-78  42%  431 aa  SYY_NEIG2 RecName: Full=Tyrosyl-tRNA synthetase;       
    4::383     7e-78  42%  431 aa  SYY_NEIG1 RecName: Full=Tyrosyl-tRNA synthetase;       
    4::417     7e-78  40%  418 aa  SYY1_BACCR RecName: Full=Tyrosyl-tRNA synthetase 1;       
    5::403     9e-78  40%  405 aa  SYY_BORGA RecName: Full=Tyrosyl-tRNA synthetase;       
    2::419     9e-78  40%  419 aa  SYY_BACST RecName: Full=Tyrosyl-tRNA synthetase;       
    5::378     2e-77  43%  406 aa  SYY_BORHD RecName: Full=Tyrosyl-tRNA synthetase;       
    5::418     2e-77  39%  421 aa  SYY1_BACLD RecName: Full=Tyrosyl-tRNA synthetase 1;       
    2::419     4e-77  40%  419 aa  SYY_GEOKA RecName: Full=Tyrosyl-tRNA synthetase;       
    2::419     4e-77  40%  419 aa  SYY_BACCA RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     5e-77  38%  425 aa  SYY_PECCP RecName: Full=Tyrosyl-tRNA synthetase;       
    5::400     5e-77  40%  426 aa  SYY_ALISL RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     6e-77  38%  424 aa  SYY_YERPY RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     6e-77  38%  424 aa  SYY_YERPS RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     6e-77  38%  424 aa  SYY_YERPP RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     6e-77  38%  424 aa  SYY_YERPN RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     6e-77  38%  424 aa  SYY_YERPG RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     6e-77  38%  424 aa  SYY_YERPE RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     6e-77  38%  424 aa  SYY_YERPB RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     6e-77  38%  424 aa  SYY_YERPA RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     6e-77  38%  424 aa  SYY_YERP3 RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     6e-77  38%  424 aa  SYY_SALEP RecName: Full=Tyrosyl-tRNA synthetase;       
    2::427     6e-77  38%  430 aa  SYY_BACTN RecName: Full=Tyrosyl-tRNA synthetase;       
    5::400     8e-77  39%  426 aa  SYY_VIBFM RecName: Full=Tyrosyl-tRNA synthetase;       
    5::400     8e-77  39%  426 aa  SYY_VIBF1 RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     8e-77  38%  424 aa  SYY_SALTY RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     8e-77  38%  424 aa  SYY_SALTI RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     8e-77  38%  424 aa  SYY_SALSV RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     8e-77  38%  424 aa  SYY_SALPK RecName: Full=Tyrosyl-tRNA synthetase;       
    8::425     8e-77  38%  428 aa  SYY_SALPC RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     8e-77  38%  424 aa  SYY_SALPB RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     8e-77  38%  424 aa  SYY_SALPA RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     8e-77  38%  424 aa  SYY_SALNS RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     8e-77  38%  424 aa  SYY_SALHS RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     8e-77  38%  424 aa  SYY_SALG2 RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     8e-77  38%  424 aa  SYY_SALDC RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     8e-77  38%  424 aa  SYY_SALCH RecName: Full=Tyrosyl-tRNA synthetase;       
    8::425     8e-77  38%  428 aa  SYY_SALAR RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     8e-77  38%  424 aa  SYY_SALA4 RecName: Full=Tyrosyl-tRNA synthetase;       
    8::425     8e-77  39%  428 aa  SYY_CITK8 RecName: Full=Tyrosyl-tRNA synthetase;       
    6::417     2e-76  39%  420 aa  SYY_STAHJ RecName: Full=Tyrosyl-tRNA synthetase;       
    7::416     3e-76  37%  418 aa  SYY_STRP4 RecName: Full=Tyrosyl-tRNA synthetase;       
    7::416     4e-76  37%  418 aa  SYY_STRPS RecName: Full=Tyrosyl-tRNA synthetase;       
    7::416     4e-76  38%  418 aa  SYY_STRGC RecName: Full=Tyrosyl-tRNA synthetase;       
    8::425     4e-76  39%  428 aa  SYY_KLEP7 RecName: Full=Tyrosyl-tRNA synthetase;       
    7::416     5e-76  37%  418 aa  SYY_STRZT RecName: Full=Tyrosyl-tRNA synthetase;       
    7::416     5e-76  37%  418 aa  SYY_STRPI RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     5e-76  37%  424 aa  SYY_SHIDS RecName: Full=Tyrosyl-tRNA synthetase;       
    4::423     5e-76  39%  425 aa  SYY_OPITP RecName: Full=Tyrosyl-tRNA synthetase;       
    4::425     5e-76  37%  428 aa  SYY_ENTS8 RecName: Full=Tyrosyl-tRNA synthetase;       
    7::413     7e-76  37%  418 aa  SYY_STRS2 RecName: Full=Tyrosyl-tRNA synthetase;       
    2::418     7e-76  38%  420 aa  SYY_DESHY RecName: Full=Tyrosyl-tRNA synthetase;       
    7::416     9e-76  37%  418 aa  SYY_STRZP RecName: Full=Tyrosyl-tRNA synthetase;       
    7::416     9e-76  37%  418 aa  SYY_STRZJ RecName: Full=Tyrosyl-tRNA synthetase;       
    7::416     9e-76  37%  418 aa  SYY_STRR6 RecName: Full=Tyrosyl-tRNA synthetase;       
    7::416     9e-76  37%  418 aa  SYY_STRPN RecName: Full=Tyrosyl-tRNA synthetase;       
    7::416     9e-76  37%  418 aa  SYY_STRPJ RecName: Full=Tyrosyl-tRNA synthetase;       
    7::416     9e-76  37%  418 aa  SYY_STRP2 RecName: Full=Tyrosyl-tRNA synthetase;       
    7::416     9e-76  38%  418 aa  SYY1_STRT2 RecName: Full=Tyrosyl-tRNA synthetase 1;       
    7::416     9e-76  38%  418 aa  SYY1_STRT1 RecName: Full=Tyrosyl-tRNA synthetase 1;       
    7::416     1e-75  37%  418 aa  SYY_STRP7 RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     1e-75  37%  424 aa  SYY_SHISS RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     1e-75  37%  424 aa  SYY_SHIB3 RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     1e-75  37%  424 aa  SYY_ESCF3 RecName: Full=Tyrosyl-tRNA synthetase;       
    8::425     1e-75  37%  428 aa  SYY_ECOUT RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     1e-75  37%  424 aa  SYY_ECOSM RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     1e-75  37%  424 aa  SYY_ECOSE RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     1e-75  37%  424 aa  SYY_ECOLU RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     1e-75  37%  424 aa  SYY_ECOLI RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     1e-75  37%  424 aa  SYY_ECOLC RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     1e-75  37%  424 aa  SYY_ECOL6 RecName: Full=Tyrosyl-tRNA synthetase;       
    8::425     1e-75  37%  428 aa  SYY_ECOK1 RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     1e-75  37%  424 aa  SYY_ECOHS RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     1e-75  37%  424 aa  SYY_ECODH RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     1e-75  37%  424 aa  SYY_ECOBW RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     1e-75  37%  424 aa  SYY_ECO8A RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     1e-75  37%  424 aa  SYY_ECO81 RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     1e-75  37%  424 aa  SYY_ECO7I RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     1e-75  37%  424 aa  SYY_ECO5E RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     1e-75  37%  424 aa  SYY_ECO57 RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     1e-75  37%  424 aa  SYY_ECO55 RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     1e-75  37%  424 aa  SYY_ECO45 RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     1e-75  37%  424 aa  SYY_ECO27 RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     1e-75  37%  424 aa  SYY_ECO24 RecName: Full=Tyrosyl-tRNA synthetase;       
    2::418     1e-75  38%  420 aa  SYY_DESHD RecName: Full=Tyrosyl-tRNA synthetase;       
    5::400     1e-75  41%  406 aa  SYY_BORT9 RecName: Full=Tyrosyl-tRNA synthetase;       
    7::416     2e-75  37%  418 aa  SYY_STRPG RecName: Full=Tyrosyl-tRNA synthetase;       
    6::417     2e-75  39%  421 aa  SYY_STAES RecName: Full=Tyrosyl-tRNA synthetase;       
    6::417     2e-75  39%  421 aa  SYY_STAEQ RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     3e-75  38%  424 aa  SYY_YERE8 RecName: Full=Tyrosyl-tRNA synthetase;       
    7::416     3e-75  38%  418 aa  SYY_STRTD RecName: Full=Tyrosyl-tRNA synthetase;       
    5::403     6e-75  39%  409 aa  SYY_TREPA RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     7e-75  37%  425 aa  SYY_ERWCT RecName: Full=Tyrosyl-tRNA synthetase;       
    4::422     1e-74  37%  426 aa  SYY_KLEP3 RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     2e-74  37%  424 aa  SYY_ENT38 RecName: Full=Tyrosyl-tRNA synthetase;       
    6::417     2e-74  38%  420 aa  SYY_STAAW RecName: Full=Tyrosyl-tRNA synthetase;       
    6::417     2e-74  38%  420 aa  SYY_STAAT RecName: Full=Tyrosyl-tRNA synthetase;       
    6::417     2e-74  38%  420 aa  SYY_STAAS RecName: Full=Tyrosyl-tRNA synthetase;       
    6::417     2e-74  38%  420 aa  SYY_STAAR RecName: Full=Tyrosyl-tRNA synthetase;       
    6::417     2e-74  38%  420 aa  SYY_STAAN RecName: Full=Tyrosyl-tRNA synthetase;       
    6::417     2e-74  38%  420 aa  SYY_STAAM RecName: Full=Tyrosyl-tRNA synthetase;       
    6::417     2e-74  38%  420 aa  SYY_STAAE RecName: Full=Tyrosyl-tRNA synthetase;       
    6::417     2e-74  38%  420 aa  SYY_STAAC RecName: Full=Tyrosyl-tRNA synthetase;       
    6::417     2e-74  38%  420 aa  SYY_STAAB RecName: Full=Tyrosyl-tRNA synthetase;       
    6::417     2e-74  38%  420 aa  SYY_STAA9 RecName: Full=Tyrosyl-tRNA synthetase;       
    6::417     2e-74  38%  420 aa  SYY_STAA8 RecName: Full=Tyrosyl-tRNA synthetase;       
    6::417     2e-74  38%  420 aa  SYY_STAA3 RecName: Full=Tyrosyl-tRNA synthetase;       
    6::417     2e-74  38%  420 aa  SYY_STAA2 RecName: Full=Tyrosyl-tRNA synthetase;       
    6::417     2e-74  38%  420 aa  SYY_STAA1 RecName: Full=Tyrosyl-tRNA synthetase;       
    3::425     2e-74  39%  427 aa  SYY_CYTH3 RecName: Full=Tyrosyl-tRNA synthetase;       
    2::419     2e-74  38%  422 aa  SYY_BACP2 RecName: Full=Tyrosyl-tRNA synthetase;       
    6::417     3e-74  40%  420 aa  SYY_STAS1 RecName: Full=Tyrosyl-tRNA synthetase;       
    7::416     4e-74  37%  418 aa  SYY_STRPD RecName: Full=Tyrosyl-tRNA synthetase;       
    7::416     4e-74  37%  418 aa  SYY_STRPC RecName: Full=Tyrosyl-tRNA synthetase;       
    7::416     4e-74  37%  418 aa  SYY_STRPB RecName: Full=Tyrosyl-tRNA synthetase;       
    7::416     4e-74  38%  418 aa  SYY_STREM RecName: Full=Tyrosyl-tRNA synthetase;       
    7::416     5e-74  37%  418 aa  SYY_STRE4 RecName: Full=Tyrosyl-tRNA synthetase;       
    7::416     6e-74  37%  418 aa  SYY_STRP6 RecName: Full=Tyrosyl-tRNA synthetase;       
    7::416     6e-74  36%  418 aa  SYY_STRMU RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     6e-74  38%  424 aa  SYY_SERP5 RecName: Full=Tyrosyl-tRNA synthetase;       
    7::417     6e-74  36%  419 aa  SYY_LACLS RecName: Full=Tyrosyl-tRNA synthetase;       
    7::416     8e-74  37%  418 aa  SYY_STRPM RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     1e-73  37%  424 aa  SYY1_PHOLL RecName: Full=Tyrosyl-tRNA synthetase 1;       
    7::416     1e-73  37%  418 aa  SYY_STRS7 RecName: Full=Tyrosyl-tRNA synthetase;       
    7::416     1e-73  36%  418 aa  SYY_STRP3 RecName: Full=Tyrosyl-tRNA synthetase;       
    7::416     2e-73  36%  418 aa  SYY_STRP8 RecName: Full=Tyrosyl-tRNA synthetase;       
    7::417     2e-73  36%  419 aa  SYY_LACLM RecName: Full=Tyrosyl-tRNA synthetase;       
    2::427     2e-73  37%  430 aa  SYY_PORG3 RecName: Full=Tyrosyl-tRNA synthetase;       
    3::428     2e-73  36%  431 aa  SYY_FLAPJ RecName: Full=Tyrosyl-tRNA synthetase;       
   10::420     4e-73  38%  422 aa  SYY1_VIBVY RecName: Full=Tyrosyl-tRNA synthetase 1;       
    4::421     5e-73  37%  425 aa  SYY_ERWT9 RecName: Full=Tyrosyl-tRNA synthetase;       
    2::427     7e-73  37%  430 aa  SYY_PORGI RecName: Full=Tyrosyl-tRNA synthetase;       
    7::416     1e-72  37%  418 aa  SYY_STRPZ RecName: Full=Tyrosyl-tRNA synthetase;       
    7::416     1e-72  37%  418 aa  SYY_STRPF RecName: Full=Tyrosyl-tRNA synthetase;       
    7::416     1e-72  37%  418 aa  SYY_STRP1 RecName: Full=Tyrosyl-tRNA synthetase;       
    3::429     1e-72  35%  431 aa  SYY_FLAJ1 RecName: Full=Tyrosyl-tRNA synthetase;       
    3::425     1e-72  36%  427 aa  SYY_AMOA5 RecName: Full=Tyrosyl-tRNA synthetase;       
   10::385     2e-72  39%  422 aa  SYY1_VIBVU RecName: Full=Tyrosyl-tRNA synthetase 1;       
    7::416     2e-72  36%  419 aa  SYY_STRA3 RecName: Full=Tyrosyl-tRNA synthetase;       
    3::392     2e-72  37%  420 aa  SYY1_PSEHT RecName: Full=Tyrosyl-tRNA synthetase 1;       
    2::421     3e-72  37%  425 aa  SYY_PARUW RecName: Full=Tyrosyl-tRNA synthetase;       
    7::416     5e-72  36%  419 aa  SYY_STRA5 RecName: Full=Tyrosyl-tRNA synthetase;       
    7::416     5e-72  36%  419 aa  SYY_STRA1 RecName: Full=Tyrosyl-tRNA synthetase;       
    7::416     1e-71  36%  418 aa  SYY_STRU0 RecName: Full=Tyrosyl-tRNA synthetase;       
    2::418     2e-71  41%  428 aa  SYY_CORJK RecName: Full=Tyrosyl-tRNA synthetase;       
    7::417     3e-71  36%  419 aa  SYY_LACLA RecName: Full=Tyrosyl-tRNA synthetase;       
    7::416     9e-71  39%  419 aa  SYY_LISW6 RecName: Full=Tyrosyl-tRNA synthetase;       
    7::416     9e-71  39%  419 aa  SYY_LISIN RecName: Full=Tyrosyl-tRNA synthetase;       
    2::427     1e-70  36%  430 aa  SYY_PARD8 RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     1e-70  37%  424 aa  SYY_SODGM RecName: Full=Tyrosyl-tRNA synthetase;       
    2::423     4e-70  36%  428 aa  SYY_OCEIH RecName: Full=Tyrosyl-tRNA synthetase;       
    7::416     6e-70  38%  419 aa  SYY_LISMH RecName: Full=Tyrosyl-tRNA synthetase;       
    5::378     6e-70  40%  406 aa  SYY_BORRA RecName: Full=Tyrosyl-tRNA synthetase;       
    5::378     6e-70  40%  406 aa  SYY_BORDL RecName: Full=Tyrosyl-tRNA synthetase;       
    3::415     7e-70  38%  417 aa  SYY_MACCJ RecName: Full=Tyrosyl-tRNA synthetase;       
    7::416     7e-70  38%  419 aa  SYY_LISMO RecName: Full=Tyrosyl-tRNA synthetase;       
    7::416     7e-70  38%  419 aa  SYY_LISMF RecName: Full=Tyrosyl-tRNA synthetase;       
    7::416     9e-70  38%  419 aa  SYY_LISMC RecName: Full=Tyrosyl-tRNA synthetase;       
    7::386     9e-70  39%  422 aa  SYY_AERHH RecName: Full=Tyrosyl-tRNA synthetase;       
    5::407     2e-69  36%  411 aa  SYY_MYCPE RecName: Full=Tyrosyl-tRNA synthetase;       
    7::312     3e-69  44%  425 aa  SYY_LARHH RecName: Full=Tyrosyl-tRNA synthetase;       
    7::312     6e-69  41%  424 aa  SYY_BUCBP RecName: Full=Tyrosyl-tRNA synthetase;       
   31::431     3e-68  41%  442 aa  SYY_LEIXX RecName: Full=Tyrosyl-tRNA synthetase;       
    7::389     4e-68  39%  420 aa  SYY_CORDI RecName: Full=Tyrosyl-tRNA synthetase;       
    2::411     5e-68  39%  422 aa  SYY_KINRD RecName: Full=Tyrosyl-tRNA synthetase;       
    2::412     7e-68  37%  423 aa  SYY_STRGG RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     9e-68  35%  424 aa  SYY_SHIBS RecName: Full=Tyrosyl-tRNA synthetase;       
   16::432     1e-67  37%  440 aa  SYY_BIFA0 RecName: Full=Tyrosyl-tRNA synthetase;       
    7::417     2e-67  36%  419 aa  SYY2_BACHK RecName: Full=Tyrosyl-tRNA synthetase 2;       
    4::421     2e-67  34%  424 aa  SYY_SHIFL RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     2e-67  34%  424 aa  SYY_SHIF8 RecName: Full=Tyrosyl-tRNA synthetase;       
    4::421     2e-67  34%  424 aa  SYY_HAMD5 RecName: Full=Tyrosyl-tRNA synthetase;       
    7::417     3e-67  36%  419 aa  SYY2_BACCZ RecName: Full=Tyrosyl-tRNA synthetase 2;       
   10::414     4e-67  40%  418 aa  SYY_LACPL RecName: Full=Tyrosyl-tRNA synthetase;       
   11::404     4e-67  37%  426 aa  SYY_ACIC1 RecName: Full=Tyrosyl-tRNA synthetase;       
    7::417     4e-67  36%  420 aa  SYY2_BACCR RecName: Full=Tyrosyl-tRNA synthetase 2;       
    7::417     4e-67  36%  419 aa  SYY2_BACC1 RecName: Full=Tyrosyl-tRNA synthetase 2;       
    5::422     6e-67  37%  424 aa  SYY_ROSS1 RecName: Full=Tyrosyl-tRNA synthetase;       
    7::417     6e-67  36%  419 aa  SYY2_BACAN RecName: Full=Tyrosyl-tRNA synthetase 2;       
   10::313     6e-67  44%  426 aa  SYY1_VIBCH RecName: Full=Tyrosyl-tRNA synthetase 1;       
    6::418     2e-66  38%  428 aa  SYY_MYCFO RecName: Full=Tyrosyl-tRNA synthetase;       
    1::424     2e-66  34%  427 aa  SYY_BLOPB RecName: Full=Tyrosyl-tRNA synthetase;       
    5::422     3e-66  40%  424 aa  SYY_ROSCS RecName: Full=Tyrosyl-tRNA synthetase;       
   16::435     8e-66  36%  435 aa  SYY_BIFAA RecName: Full=Tyrosyl-tRNA synthetase;       
    7::411     1e-65  41%  420 aa  SYY_CORGL RecName: Full=Tyrosyl-tRNA synthetase;       
    7::409     1e-65  37%  412 aa  SYY_CHLMU RecName: Full=Tyrosyl-tRNA synthetase;       
   16::432     1e-65  36%  440 aa  SYY_BIFLO RecName: Full=Tyrosyl-tRNA synthetase;       
   16::432     2e-65  36%  440 aa  SYY_BIFLI RecName: Full=Tyrosyl-tRNA synthetase;       
   16::432     2e-65  36%  440 aa  SYY_BIFLD RecName: Full=Tyrosyl-tRNA synthetase;       
    3::418     9e-65  37%  420 aa  SYY_LACJO RecName: Full=Tyrosyl-tRNA synthetase;       
    8::409     3e-64  37%  412 aa  SYY_CHLTR RecName: Full=Tyrosyl-tRNA synthetase;       
    8::409     3e-64  37%  412 aa  SYY_CHLTB RecName: Full=Tyrosyl-tRNA synthetase;       
    8::409     3e-64  37%  412 aa  SYY_CHLTA RecName: Full=Tyrosyl-tRNA synthetase;       
    8::409     3e-64  37%  412 aa  SYY_CHLT2 RecName: Full=Tyrosyl-tRNA synthetase;       
    3::383     3e-64  39%  420 aa  SYY_ANADE RecName: Full=Tyrosyl-tRNA synthetase;       
   10::414     8e-64  37%  417 aa  SYY_LACF3 RecName: Full=Tyrosyl-tRNA synthetase;       
    3::383     1e-63  38%  420 aa  SYY_ANAD2 RecName: Full=Tyrosyl-tRNA synthetase;       
    2::393     2e-63  38%  423 aa  SYY_MYCSS RecName: Full=Tyrosyl-tRNA synthetase;       
    2::393     2e-63  38%  423 aa  SYY_MYCSK RecName: Full=Tyrosyl-tRNA synthetase;       
    3::419     2e-63  42%  421 aa  SYY_COREF RecName: Full=Tyrosyl-tRNA synthetase;       
    3::409     2e-63  34%  412 aa  SYY_CHLCV RecName: Full=Tyrosyl-tRNA synthetase;       
    3::383     2e-63  38%  420 aa  SYY_ANASK RecName: Full=Tyrosyl-tRNA synthetase;       
    2::393     3e-63  38%  423 aa  SYY_MYCSJ RecName: Full=Tyrosyl-tRNA synthetase;       
   10::415     9e-63  35%  418 aa  SYY_LACBR RecName: Full=Tyrosyl-tRNA synthetase;       
    4::396     1e-62  39%  429 aa  SYY_NOCFA RecName: Full=Tyrosyl-tRNA synthetase;       
    1::313     1e-62  40%  422 aa  SYY_BUCAT RecName: Full=Tyrosyl-tRNA synthetase;       
    1::313     1e-62  40%  422 aa  SYY_BUCAI RecName: Full=Tyrosyl-tRNA synthetase;       
    1::313     1e-62  40%  422 aa  SYY_BUCA5 RecName: Full=Tyrosyl-tRNA synthetase;       
    3::417     3e-62  37%  420 aa  SYY_LACAC RecName: Full=Tyrosyl-tRNA synthetase;       
   10::415     1e-61  37%  417 aa  SYY_PEDPA RecName: Full=Tyrosyl-tRNA synthetase;       
    3::410     2e-61  35%  412 aa  SYY_CHLAB RecName: Full=Tyrosyl-tRNA synthetase;       
    3::418     2e-61  35%  426 aa  SYY_MYCLE RecName: Full=Tyrosyl-tRNA synthetase;       
    3::417     2e-61  37%  420 aa  SYY_LACH4 RecName: Full=Tyrosyl-tRNA synthetase;       
    6::391     4e-61  40%  421 aa  SYY_MYCPA RecName: Full=Tyrosyl-tRNA synthetase;       
    4::393     5e-61  36%  399 aa  SYY_MYCPN RecName: Full=Tyrosyl-tRNA synthetase;       
    2::272     6e-61  41%  422 aa  SYY_STRCO RecName: Full=Tyrosyl-tRNA synthetase;       
    1::414     8e-61  39%  416 aa  SYY_LACS1 RecName: Full=Tyrosyl-tRNA synthetase;       
    2::424     1e-60  36%  432 aa  SYY_THEFY RecName: Full=Tyrosyl-tRNA synthetase;       
    6::415     1e-60  38%  424 aa  SYY_MYCTU RecName: Full=Tyrosyl-tRNA synthetase;       
    6::415     1e-60  38%  424 aa  SYY_MYCBO RecName: Full=Tyrosyl-tRNA synthetase;       
    2::414     1e-60  37%  416 aa  SYY_LACRD RecName: Full=Tyrosyl-tRNA synthetase;       
    2::272     2e-60  41%  422 aa  SYY_STRAW RecName: Full=Tyrosyl-tRNA synthetase;       
    4::409     2e-60  35%  412 aa  SYY_CHLPN RecName: Full=Tyrosyl-tRNA synthetase;       
    2::306     5e-60  39%  418 aa  SYY_PROAC RecName: Full=Tyrosyl-tRNA synthetase;       
   28::462     5e-60  35%  464 aa  SYYM_DROME RecName: Full=Probable tyrosyl-tRNA synthetase,
    2::417     1e-59  34%  419 aa  SYY_LACSS RecName: Full=Tyrosyl-tRNA synthetase;       
    2::415     2e-59  36%  417 aa  SYY_OENOB RecName: Full=Tyrosyl-tRNA synthetase;       
    2::310     3e-59  39%  422 aa  SYY_BUCAP RecName: Full=Tyrosyl-tRNA synthetase;       
   17::314     2e-58  39%  471 aa  SYY_TROWT RecName: Full=Tyrosyl-tRNA synthetase;       
   17::314     2e-58  39%  471 aa  SYY_TROW8 RecName: Full=Tyrosyl-tRNA synthetase;       
   10::415     4e-57  34%  418 aa  SYY1_ENTFA RecName: Full=Tyrosyl-tRNA synthetase 1;       
    9::419     2e-56  32%  422 aa  SYY_BLOFL RecName: Full=Tyrosyl-tRNA synthetase;       
    2::408     2e-56  32%  410 aa  SYY_ACHLI RecName: Full=Tyrosyl-tRNA synthetase;       
    2::390     6e-56  36%  414 aa  SYY_MYCCT RecName: Full=Tyrosyl-tRNA synthetase;       
    2::411     2e-55  36%  415 aa  SYY_LEUCK RecName: Full=Tyrosyl-tRNA synthetase;       
    2::390     4e-55  35%  414 aa  SYY_MYCMS RecName: Full=Tyrosyl-tRNA synthetase;       
   36::357     3e-54  37%  482 aa  SYYM_DICDI RecName: Full=Probable tyrosyl-tRNA synthetase,
    3::313     1e-53  35%  426 aa  SYY_WIGBR RecName: Full=Tyrosyl-tRNA synthetase;       
    2::387     3e-53  33%  413 aa  SYY_MESFL RecName: Full=Tyrosyl-tRNA synthetase;       
    5::417     1e-52  34%  421 aa  SYY_LACDB RecName: Full=Tyrosyl-tRNA synthetase;       
    2::411     2e-52  36%  415 aa  SYY_LEUMM RecName: Full=Tyrosyl-tRNA synthetase;       
    3::411     3e-52  32%  413 aa  SYY_ONYPE RecName: Full=Tyrosyl-tRNA synthetase;       
   55::381     4e-52  39%  492 aa  SYYM_YEAST RecName: Full=Tyrosyl-tRNA synthetase, mitochondrial;   
    5::417     9e-52  34%  421 aa  SYY_LACDA RecName: Full=Tyrosyl-tRNA synthetase;       
    3::411     1e-49  32%  413 aa  SYY_AYWBP RecName: Full=Tyrosyl-tRNA synthetase;       
    3::372     1e-49  31%  396 aa  SYY_MYCGE RecName: Full=Tyrosyl-tRNA synthetase;       
   39::468     2e-49  32%  472 aa  SYYM_MOUSE RecName: Full=Tyrosyl-tRNA synthetase, mitochondrial;   
   34::410     5e-49  36%  415 aa  SYY_UREU1 RecName: Full=Tyrosyl-tRNA synthetase;       
   39::467     5e-49  31%  471 aa  SYYM_RAT RecName: Full=Tyrosyl-tRNA synthetase, mitochondrial;     
   10::414     5e-48  33%  417 aa  SYY_PHYMT RecName: Full=Tyrosyl-tRNA synthetase;       
   49::473     7e-47  31%  477 aa  SYYM_HUMAN RecName: Full=Tyrosyl-tRNA synthetase, mitochondrial;   
    3::412     9e-47  32%  415 aa  SYY_PHYAS RecName: Full=Tyrosyl-tRNA synthetase;       
    5::410     4e-44  32%  415 aa  SYY_UREPA RecName: Full=Tyrosyl-tRNA synthetase;       
    5::410     4e-44  32%  415 aa  SYY_UREP2 RecName: Full=Tyrosyl-tRNA synthetase;       
    7::296     7e-44  35%  302 aa  SYY2_STRT2 RecName: Full=Tyrosyl-tRNA synthetase 2;       
    7::296     7e-44  35%  302 aa  SYY2_STRT1 RecName: Full=Tyrosyl-tRNA synthetase 2;       
    2::380     9e-44  30%  411 aa  SYY_MYCAP RecName: Full=Tyrosyl-tRNA synthetase;       
    7::416     1e-43  31%  420 aa  SYY_MYCGA RecName: Full=Tyrosyl-tRNA synthetase;       
   10::306     6e-43  34%  414 aa  SYY_MYCPU RecName: Full=Tyrosyl-tRNA synthetase;       
    5::409     6e-42  31%  411 aa  SYY_MYCS5 RecName: Full=Tyrosyl-tRNA synthetase;       
   72::402     6e-42  36%  669 aa  SYYM_NEUCR RecName: Full=Tyrosyl-tRNA synthetase, mitochondrial;   
   31::323     5e-41  36%  445 aa  SYYM_SCHPO RecName: Full=Tyrosyl-tRNA synthetase, mitochondrial;   
    2::413     1e-38  28%  415 aa  SYY_MYCMO RecName: Full=Tyrosyl-tRNA synthetase;       
    6::306     4e-37  32%  414 aa  SYY_MYCHJ RecName: Full=Tyrosyl-tRNA synthetase;       
    6::306     4e-37  32%  414 aa  SYY_MYCH2 RecName: Full=Tyrosyl-tRNA synthetase;       
    6::258     6e-37  34%  414 aa  SYY_MYCH7 RecName: Full=Tyrosyl-tRNA synthetase;       
   53::407     1e-36  32%  414 aa  SYY_BACSK RecName: Full=Tyrosyl-tRNA synthetase;       
   45::402     2e-36  31%  405 aa  SYY_DESPS RecName: Full=Tyrosyl-tRNA synthetase;       
   74::399     7e-36  33%  640 aa  SYYM_PODAN RecName: Full=Tyrosyl-tRNA synthetase, mitochondrial;   
   36::393     2e-35  32%  396 aa  SYY_THIDA RecName: Full=Tyrosyl-tRNA synthetase;       
   42::396     2e-34  31%  403 aa  SYY_GEOSL RecName: Full=Tyrosyl-tRNA synthetase;       
   45::400     8e-34  30%  404 aa  SYY_SYNY3 RecName: Full=Tyrosyl-tRNA synthetase;       
   39::374     8e-34  29%  407 aa  SYY_NITOC RecName: Full=Tyrosyl-tRNA synthetase;       
   22::406     8e-34  31%  412 aa  SYY_BACHD RecName: Full=Tyrosyl-tRNA synthetase;       
   43::403     1e-33  32%  408 aa  SYY_PELCD RecName: Full=Tyrosyl-tRNA synthetase;       
   10::388     4e-33  30%  395 aa  SYY_DESDG RecName: Full=Tyrosyl-tRNA synthetase;       
   12::392     5e-33  29%  395 aa  SYY_PASMU RecName: Full=Tyrosyl-tRNA synthetase;       
   40::405     1e-32  27%  412 aa  SYY_SALRD RecName: Full=Tyrosyl-tRNA synthetase;       
   39::396     2e-32  34%  399 aa  SYY_AZOSE RecName: Full=Tyrosyl-tRNA synthetase;       
   44::383     2e-31  27%  411 aa  SYY_CARHZ RecName: Full=Tyrosyl-tRNA synthetase;       
   12::393     2e-31  31%  401 aa  SYY_HAEIN RecName: Full=Tyrosyl-tRNA synthetase;       
   12::392     3e-31  29%  395 aa  SYY_MANSM RecName: Full=Tyrosyl-tRNA synthetase;       
   53::387     1e-30  29%  413 aa  SYY_MOOTA RecName: Full=Tyrosyl-tRNA synthetase;       
   35::378     1e-30  28%  401 aa  SYY_IDILO RecName: Full=Tyrosyl-tRNA synthetase;       
   12::380     1e-30  31%  399 aa  SYY2_PSEAE RecName: Full=Tyrosyl-tRNA synthetase 2;       
   55::409     1e-30  30%  413 aa  SYY_BURS3 RecName: Full=Tyrosyl-tRNA synthetase;       
   11::389     2e-30  27%  401 aa  SYY_THEMA RecName: Full=Tyrosyl-tRNA synthetase;       
   12::392     2e-30  31%  395 aa  SYY_HAEI8 RecName: Full=Tyrosyl-tRNA synthetase;       
   40::388     3e-30  26%  396 aa  SYY_DEHSC RecName: Full=Tyrosyl-tRNA synthetase;       
   32::409     3e-30  29%  413 aa  SYY_BURPS RecName: Full=Tyrosyl-tRNA synthetase;       
   10::369     4e-30  29%  400 aa  SYY_HAHCH RecName: Full=Tyrosyl-tRNA synthetase;       
   42::396     4e-30  28%  403 aa  SYY_GEOMG RecName: Full=Tyrosyl-tRNA synthetase;       
   29::409     4e-30  30%  413 aa  SYY_BURMA RecName: Full=Tyrosyl-tRNA synthetase;       
   29::409     6e-30  30%  413 aa  SYY_BURTA RecName: Full=Tyrosyl-tRNA synthetase;       
   13::393     7e-30  29%  396 aa  SYY_HAEDU RecName: Full=Tyrosyl-tRNA synthetase;       
   12::388     1e-29  27%  395 aa  SYY_PHOPR RecName: Full=Tyrosyl-tRNA synthetase;       
   32::409     1e-29  29%  413 aa  SYY_BURP1 RecName: Full=Tyrosyl-tRNA synthetase;       
   51::403     2e-29  36%  413 aa  SYY_SYNJB RecName: Full=Tyrosyl-tRNA synthetase;       
   50::406     2e-29  33%  409 aa  SYY_BORPE RecName: Full=Tyrosyl-tRNA synthetase;       
   50::406     2e-29  33%  409 aa  SYY_BORBR RecName: Full=Tyrosyl-tRNA synthetase;       
   38::395     2e-29  31%  398 aa  SYY_SHEON RecName: Full=Tyrosyl-tRNA synthetase;       
   12::382     2e-29  28%  399 aa  SYY_COXBU RecName: Full=Tyrosyl-tRNA synthetase;       
   50::406     2e-29  33%  409 aa  SYY_BORPA RecName: Full=Tyrosyl-tRNA synthetase;       
   41::399     5e-29  29%  406 aa  SYY_WOLSU RecName: Full=Tyrosyl-tRNA synthetase;       
   44::398     1e-28  32%  402 aa  SYY_SYNP6 RecName: Full=Tyrosyl-tRNA synthetase;       
   44::398     1e-28  32%  402 aa  SYY_SYNE7 RecName: Full=Tyrosyl-tRNA synthetase;       
   44::395     1e-28  33%  402 aa  SYY_HELPJ RecName: Full=Tyrosyl-tRNA synthetase;       
   13::376     1e-28  32%  404 aa  SYY_ACIAD RecName: Full=Tyrosyl-tRNA synthetase;       
   14::400     2e-28  28%  403 aa  SYY_PSYA2 RecName: Full=Tyrosyl-tRNA synthetase;       
   35::394     2e-28  33%  402 aa  SYY_GLOVI RecName: Full=Tyrosyl-tRNA synthetase;       
   42::395     2e-28  27%  400 aa  SYY2_CLOAB RecName: Full=Tyrosyl-tRNA synthetase 2;       
   36::394     2e-28  27%  397 aa  SYY_METCA RecName: Full=Tyrosyl-tRNA synthetase;       
   15::392     3e-28  29%  399 aa  SYY_SULDN RecName: Full=Tyrosyl-tRNA synthetase;       
   39::379     4e-28  30%  403 aa  SYY_PSESM RecName: Full=Tyrosyl-tRNA synthetase;       
   42::397     4e-28  30%  400 aa  SYY_HELHP RecName: Full=Tyrosyl-tRNA synthetase;       
   20::403     4e-28  29%  411 aa  SYY_DEIRA RecName: Full=Tyrosyl-tRNA synthetase;       
   39::392     4e-28  32%  399 aa  SYY_COLP3 RecName: Full=Tyrosyl-tRNA synthetase;       
   38::385     4e-28  32%  392 aa  SYY_AQUAE RecName: Full=Tyrosyl-tRNA synthetase;       
   40::397     5e-28  26%  403 aa  SYY_NITMU RecName: Full=Tyrosyl-tRNA synthetase;       
   39::391     7e-28  29%  398 aa  SYY_DESVH RecName: Full=Tyrosyl-tRNA synthetase;       
   21::398     9e-28  30%  403 aa  SYY_XANOR RecName: Full=Tyrosyl-tRNA synthetase;       
   21::398     9e-28  30%  403 aa  SYY_XANOM RecName: Full=Tyrosyl-tRNA synthetase;       
   55::407     9e-28  32%  417 aa  SYY_SYNJA RecName: Full=Tyrosyl-tRNA synthetase;       
   40::388     9e-28  28%  396 aa  SYY_DEHE1 RecName: Full=Tyrosyl-tRNA synthetase;       
   39::370     1e-27  29%  403 aa  SYY_PSEU2 RecName: Full=Tyrosyl-tRNA synthetase;       
   44::395     1e-27  31%  402 aa  SYY_HELPY RecName: Full=Tyrosyl-tRNA synthetase;       
   39::370     2e-27  29%  403 aa  SYY_PSE14 RecName: Full=Tyrosyl-tRNA synthetase;       
   39::355     3e-27  34%  399 aa  SYY_PSEPK RecName: Full=Tyrosyl-tRNA synthetase;       
   39::389     3e-27  29%  396 aa  SYY_FRATT RecName: Full=Tyrosyl-tRNA synthetase;       
   39::398     6e-27  30%  403 aa  SYY_XANCP RecName: Full=Tyrosyl-tRNA synthetase;       
   39::398     6e-27  30%  403 aa  SYY_XANC8 RecName: Full=Tyrosyl-tRNA synthetase;       
   19::402     8e-27  28%  405 aa  SYY_BDEBA RecName: Full=Tyrosyl-tRNA synthetase;       
   35::389     1e-26  29%  392 aa  SYY_RALSO RecName: Full=Tyrosyl-tRNA synthetase;       
   54::408     1e-26  26%  413 aa  SYY2_BACSU RecName: Full=Tyrosyl-tRNA synthetase 2;       
   49::411     1e-26  29%  417 aa  SYY2_BACLD RecName: Full=Tyrosyl-tRNA synthetase 2;       
   39::372     1e-26  28%  401 aa  SYY_LEGPH RecName: Full=Tyrosyl-tRNA synthetase;       
   10::355     2e-26  32%  399 aa  SYY_PSEPF RecName: Full=Tyrosyl-tRNA synthetase;       
   12::392     2e-26  27%  395 aa  SYY2_VIBCH RecName: Full=Tyrosyl-tRNA synthetase 2;       
   39::372     2e-26  27%  401 aa  SYY_LEGPL RecName: Full=Tyrosyl-tRNA synthetase;       
   44::388     2e-26  28%  406 aa  SYY_CHLTE RecName: Full=Tyrosyl-tRNA synthetase;       
   44::402     3e-26  31%  405 aa  SYY_PELLD RecName: Full=Tyrosyl-tRNA synthetase;       
   39::372     3e-26  28%  401 aa  SYY_LEGPA RecName: Full=Tyrosyl-tRNA synthetase;       
   12::388     4e-26  28%  395 aa  SYY2_VIBVY RecName: Full=Tyrosyl-tRNA synthetase 2;       
   43::396     5e-26  28%  407 aa  SYY_THIFE RecName: Full=Tyrosyl-tRNA synthetase;       
   56::410     5e-26  28%  413 aa  SYY_RALEJ RecName: Full=Tyrosyl-tRNA synthetase;       
   12::389     5e-26  28%  396 aa  SYY2_VIBVU RecName: Full=Tyrosyl-tRNA synthetase 2;       
   12::372     5e-26  28%  395 aa  SYY2_VIBPA RecName: Full=Tyrosyl-tRNA synthetase 2;       
   50::408     6e-26  27%  409 aa  SYY_BORA1 RecName: Full=Tyrosyl-tRNA synthetase;       
   10::355     1e-25  32%  399 aa  SYY_PSEF5 RecName: Full=Tyrosyl-tRNA synthetase;       
   11::397     2e-25  28%  409 aa  SYY_NITEU RecName: Full=Tyrosyl-tRNA synthetase;       
   38::392     5e-25  29%  399 aa  SYY2_PSEHT RecName: Full=Tyrosyl-tRNA synthetase 2;       
   38::217     7e-25  34%  405 aa  SYY_LEPIN RecName: Full=Tyrosyl-tRNA synthetase;       
   38::217     7e-25  34%  405 aa  SYY_LEPIC RecName: Full=Tyrosyl-tRNA synthetase;       
   44::400     9e-25  28%  402 aa  SYY_CHLCH RecName: Full=Tyrosyl-tRNA synthetase;       
   45::394     9e-25  31%  398 aa  SYY_ANAVT RecName: Full=Tyrosyl-tRNA synthetase;       
   40::373     4e-24  27%  398 aa  SYY_THICR RecName: Full=Tyrosyl-tRNA synthetase;       
   45::398     1e-23  30%  398 aa  SYY_ANASP RecName: Full=Tyrosyl-tRNA synthetase;       
   39::399     2e-23  28%  418 aa  SYY_XYLFT RecName: Full=Tyrosyl-tRNA synthetase;       
   49::408     2e-23  30%  408 aa  SYY_THEEB RecName: Full=Tyrosyl-tRNA synthetase;       
   21::218     2e-23  34%  403 aa  SYY_XANC5 RecName: Full=Tyrosyl-tRNA synthetase;       
   21::218     2e-23  34%  403 aa  SYY_XANAC RecName: Full=Tyrosyl-tRNA synthetase;       
   39::399     3e-23  29%  418 aa  SYY_XYLFA RecName: Full=Tyrosyl-tRNA synthetase;       
   50::408     4e-23  27%  415 aa  SYY_SYNS9 RecName: Full=Tyrosyl-tRNA synthetase;       
   50::408     9e-23  32%  415 aa  SYY_PROMM RecName: Full=Tyrosyl-tRNA synthetase;       
   42::393     1e-22  27%  401 aa  SYY_CAMJE RecName: Full=Tyrosyl-tRNA synthetase;       
   50::408     3e-22  27%  415 aa  SYY_SYNPX RecName: Full=Tyrosyl-tRNA synthetase;       
   23::311     1e-21  28%  412 aa  SYY_PROM9 RecName: Full=Tyrosyl-tRNA synthetase;       
   42::393     1e-21  27%  401 aa  SYY_CAMJR RecName: Full=Tyrosyl-tRNA synthetase;       
   50::408     2e-21  27%  415 aa  SYY_SYNSC RecName: Full=Tyrosyl-tRNA synthetase;       
   46::402     2e-21  26%  408 aa  SYY_SYMTH RecName: Full=Tyrosyl-tRNA synthetase;       
   43::413     1e-20  26%  415 aa  SYY_PROMT RecName: Full=Tyrosyl-tRNA synthetase;       
   12::237     4e-20  30%  412 aa  SYY_PROMP RecName: Full=Tyrosyl-tRNA synthetase;       
   51::409     4e-20  26%  416 aa  SYY_PROMA RecName: Full=Tyrosyl-tRNA synthetase;       
   16::405     5e-20  31%  432 aa  SYY_THET8 RecName: Full=Tyrosyl-tRNA synthetase;       
   16::405     5e-20  31%  432 aa  SYY_THET2 RecName: Full=Tyrosyl-tRNA synthetase;       
   35::219     2e-17  27%  399 aa  SYY2_PHOLL RecName: Full=Tyrosyl-tRNA synthetase 2;       
   24::197     4e-07  27%  316 aa  SYY2_PYRAE RecName: Full=Tyrosyl-tRNA synthetase 2;       
   27::177     1e-05  29%  317 aa  SYY_METMA RecName: Full=Tyrosyl-tRNA synthetase;       
   32::177     2e-05  28%  317 aa  SYY_METBF RecName: Full=Tyrosyl-tRNA synthetase;       
   30::180     2e-05  30%  323 aa  SYY_ARCFU RecName: Full=Tyrosyl-tRNA synthetase;       
   27::177     4e-05  28%  317 aa  SYY_METAC RecName: Full=Tyrosyl-tRNA synthetase;       
   13::85      1e-04  30%  306 aa  SYY_METJA RecName: Full=Tyrosyl-tRNA synthetase;       
    9::62      2e-04  39%  319 aa  SYY_METS3 RecName: Full=Tyrosyl-tRNA synthetase;       
   28::94      7e-04  35%  319 aa  SYY_METVS RecName: Full=Tyrosyl-tRNA synthetase;       
    1::417

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSRFKSDFLRTLDERGFIHQISDEAGLDELFAKETVTAYIGYDPTASSLHVGHLTQIMMLHWMQKTGHQP
SYY_AGRT5       MSRFKSDFLRTLDERGFIHQISDEAGLDELFAKETVTAYIGYDPTASSLHVGHLTQIMMLHWMQKTGHQP
SYY_BRUSU       MSGFKSDFLRTLSERGFIHQISDESGLDELLAKETVTAYIGFDPTAPSLHAGGLIQIMMLYWLQQTGHKP
SYY_BRUME       MSGFKSDFLRTLSERGFIHQISDESGLDELLAKETVTAYIGFDPTAPSLHAGGLIQIMMLYWLQQTGHKP
SYY_BRUAB       MSGFKSDFLRTLSERGFIHQISDESGLDELLAKETVTAYIGFDPTAPSLHAGGLIQIMMLYWLQQTGHKP
SYY_BRUA2       MSGFKSDFLRTLSERGFIHQISDESGLDELLAKETVTAYIGFDPTAPSLHAGGLIQIMMLYWLQQTGHKP
SYY_RHIME       MSEFKSDFLHTLSERGFIHQTSDDAGLDQLFRTETVTAYIGFDPTAASLHAGGLIQIMMLHWLQATGHRP
SYY_RHILO       MPAFKSDFLRTMSERGFIHQISDETGLDQLFAKETVTAYVGYDATATSLHIGNLISATMLYWLQETGHRP
SYY_BARHE       MLAFKSDFLNIMSERGFIHQISDEKGLDALFSKEVVSAYIGFDPTASSLHAGSLLQIMMLYWLQKTGHRP
SYY_BARQU       MLAFKSDFLHIMSERGFIHQISDEKGLDALFSKEVVSAYIGFDPTASSLHAGSLLQIMMLHWLQKTGHRP
SYY_NITWN       MVAFKSDFLNTLQERGFIHQCSDFEGLDALASRNQVTAYTGYDCTAPSLHVGHLLSIMMMHWLQQTGNKP
SYY_RHOPA       MTAFKSDFMNVLQSRGFIHQISDPDSLDALAAKGEVVAYVGYDCTAASLHVGHLLSIMMLHWLQATGNKP
SYY_BRAJA       MTAFKSDFLNILQERGFIHQCSDFEGLDALAAKGEATAYVGYDCTARSLHIGNYLTMMMLHWLQQSGNKP
SYY_METSB       --RPRSDFLQTLLLRGYVHQCSDLEGIDAKAQSGELVAYIGFDCTAPSLHVGSLVQIMMLRWLQKTGGKP
SYY_XANP2       ---FRSDFLRTLHERGYIHQCSDLERLDAKAAEGPITAYIGFDATASSLHAGHLLSIMMLRTLQRTGHNP
SYY_MAGSA       MTSLKSDFLRIVTERGYMHQCTDLEALDKRLTEGCQAAYIGFDCTATSLHVGGLMQIMLLRWWQKTGHKP
SYY_BEII9       -----SDFLAILTERGFLHQCSDPAGLDEKAKSGGLIAYIGFDCTAPSLHVGSLVQIMMLRWLQKTGGKP
SYY_SILST       ----KSDFIAIMMERGFLADCTDYQGLDEALVSGTQTAYIGYDATAQSLHVGHLLNIMMLRWLQKTGHRP
SYY_DINSH       ----KSDFMRVMMERGFLADCTDYQGLDEAMSKGVVPTYIGYDATAASLHVGHLLNIMMLRWLQKTGHKP
SYY_RHOS5       ----KSDFLRVMQERGYLADCTDMQALDEAMSKGVVPAYIGYDATAASLHVGHLLNIMMLRWLQKTGHKP
SYY_SILPO       ----KSDFIAVMMERGFLADCTDYQGLDEALMKGCQPGYIGFDATAKSLHVGSLIQIMMLRWLQKTGHKP
SYY_RHOS4       ----KSDFLRVMQERGYLADCTDMQALDEALSKGVVPAYIGYDATAASLHVGHLLNIMMLRWLQKTGHKP
SYY_PARDP       --RAKSDFLNVMIERGYLADCTDMQALDDALIDGPVTAYIGYDATAASLHVGHLLNIMMLRWFQKTGNRP
SYY_RHOSK       ----KSDFLRVMQERGYLADCTDKQALDEALSKGVVPAYIGYDATAASLHVGHLLNIMMLRWLQKTGHKP
SYY_RHOS1       ----KSDFLRVMQERGYLADCTDMQALDEALSNGVVPAYIGYDATAASLHVGHLLNIMMLRWLQKTGHKP
SYY_RHORT       MTAPKSEFLAVVRDRGFIHQCTXXXXXXXXXXKGPVSAYIGFDCTADSLHVGSLIQIMLLHWLQRTGHRP
SYY_ROSDO       ----KSDFMAVMMARGFMADCTDYQGLDEALLKGVQPAYIGFDATAKSLHVGSLIQIMMLRWFQKTGHKP
SYY_NOVAD       MTEYASSLLRLLSERGYIHQMTXXXXXXXXXXKQVIPGYIGFDPTAPSLHVGSMVQIMLLRRLQQAGHKP
SYY_CAUSK       ---FKSEFLQTLQARGYIHQITHPDELDAAAAGGIVTAYIGFDATAPSLHVGSLIQIMMLRRLQQAGHKP
SYY_ZYMMO       MTQFRSDFLRLLETRGYIHQITDAKSLDEKASQSVIAAYIGFDPTAASLHVGSXXXXXXXXXXXXAGHKP
SYY_GLUOX       ----KSPFLLEAQARGLIFQCTDLDALDEAMLAGPITAYVGFDPTADSLHVGNALTIMALRLLQKHGHRP
SYY_WOLPP       --KHKSEFLNFIQERGYLYQCTNIDRLDQLLSQDNIIAYIGFDCTAPSLHIGSLIQIMMLRHLQKFGYKP
SYY_WOLTR       --KHKSEFLNFIQERGYLCQCTNIEGLDQLLLQNNVVAYIGFDCTASSLHVGSLIQIMMLRHLQKFGYKP
SYY_RICBR       -------FIEEFINKGYFHQCTDLERLTSITKESKIAAYIGFDCTATSLHIGSLMQIMILRLLQKHGHKP
SYY_CAUCR       -SSFKSEFLRTLEARGYIHQITHADELDTAAQGGPIVAYIGFDATAPSLHVGSXXXXXXXXXXXXAGHKP
SYY_CAUCN       -SSFKSEFLRTLEARGYIHQITHADELDTAAQGGPIVAYIGFDATAPSLHVGSXXXXXXXXXXXXAGHKP
SYY_WOLWR       -----SEFLNFIQERGYLYQCTNIEGLDQLLLQSNIVAYIGFDCTAPSLHAGHLIQIMMLCHLQKFGYKP
SYY_WOLPM       -----SEFLNFIQERGYLYQCTNIEGLDQLLLQSNIVAYIGFDCTAPSLHAGHLIQIMMLCHLQKFGYKP
SYY_RICAH       -------FIEEFINKGYFHQCTDLDRLTTITKETKIAAYIGFDCTATSLHIGSLMQIMILRLLQRHGHKP
SYY_RICFE       -------FIEEFINKGYFHQCTDLDRLTTITKETKIAAYIGFDCTATSLHIGSXXXXXXXXXXXXHGHKP
SYY_RICTY       -------FIEEFIYKGYLHQCTDLDQLTAITQEVKIAAYIGFDCTATSLHIGSLMQIMILRLLQKHGHTP
SYY_RICRS       -------FIEEFINKGYFHQCTDLDRLTAITKETKIAAYIGFDCTATSLHIGSXXXXXXXXXXXXHGHKP
SYY_RICRO       -------FIEEFINKGYFHQCTDLDRLTAITKETKIAAYIGFDCTATSLHIGSXXXXXXXXXXXXHGHKP
SYY_RICCN       -------FIEEFINKGYFHQCTDLDRLTAITKETKIAAYIGFDCTATSLHIGSXXXXXXXXXXXXHGHKP
SYY_RICPU       -------FIEEFINKGYFHQCTDLDRLTAITKETKIAAYIGFDCTATSLHIGSXXXXXXXXXXXXHGHKP
SYY_RICM5       -------FIEEFINKGYFHQCTDLDRLTAITKETKIAAYIGFDCTATSLHIGSXXXXXXXXXXXXHGHKP
SYY_EHRCJ       --KLESQFLSFLYSRGYFNQCTNVSALDQLMSKQCVPTYIGFDCTAKSLHVGSLVQIMILRYLQKFGHKP
SYY_RICAE       -------FIEEFINKGYFHQCTDLDRLTAITKETKIAAYIGFDCTATSLHIGSXXXXXXXXXXXXHGHKP
SYY_RICCK       -------FIKEFRNKGYFHQCTNLDRLTSITKETKIAAYIGFDCTATSLHIGSXXXXXXXXXXXXHGHKP
SYY_EHRRW       --KLKSDFLGLLYSRGYFNQCTDLAELDQLMSKECVIAYIGFDCTARSLHIGSLMQIMILRYLQKCGHKP
SYY_RICPR       -------FIEEFIYKGYLNQCTDLARLSAITQEAKIAAYIGFDCTATSLHIGSLMQIMILRLLQKHGHTP
SYY_PELUB       -------FLKEFKDRGFFYQCTGEENLSQLLDKEKIRAYIGFDCTAESLHVGSLLQIMCLRLLQKHGHQP
SYY_EHRRG       --KLKSGFLGLLYSRGYFNQCTDLAELDQLMSKECVIAYIGFDCTARSLHIGSLMQIMILRYLQKCGHKP
SYY_ANAPZ       ---FNSEFLATLCARGYLHQLTDATALDGIMSSGAVTAYIGFDCTANSLHIGSLMQIMLLRYLQRFGHKP
SYY_DESOH       -----------LSERGFVEAFTHEQELRDLAAESAVTCYIGFDPTASSLHVGSLVPIMALAHMQRNGHRP
SYY_CLOTE       -----------LKERGYIKQTTHEEEIRDLINKDKITFYIGFDPTADSLHIGHFLPLMMMAHMQKAGHRP
SYY_PSEA7       ----QQDLIALLEERGFVHQCTDREGLAAHLAAGPVTAYLGFDATADSLHVGHLQGLMLMRWLQKAGHRP
SYY_CLOK5       -------------ERGYIKQITHEDEVRELLGKEKVTFYIGFDPTADSLHIGHFLQMMVMSHMQKAGHKP
SYY_CLOK1       -------------ERGYIKQITHEDEVRELLGKEKVTFYIGFDPTADSLHIGHFLQMMVMSHMQKAGHKP
SYY1_CLOAB      -----SNVLDELIERGYAKQFTHEEETRKLLSEEKVTFYIGFDPTGDSLHVGHFIALMLMARMQKAGHRP
SYY_CLOTH       -----SSVFETLKERGYIAQLTHXXXXXXXXXXXXXTFYIGFDPTADSLHVGHFLQMMVMAHMQKAGHRP
SYY_EHRCR       --KLESQFLSFLYSRGYCSQCTNISMLDQLMSQQCVHAYIGFDCTAKSLHVGSLIQVMILRHLQKFGHKP
SYY_CLOBA       -----ANVLDELLDRGYIKQFTHEEETRKLLENEKVTFYIGFDPTADSLHVGHFIAMMFMAHMQRAGHRP
SYY_CLOBB       -----ANVLDELLDRGYIKQFTHEEETRKLLENEKVTFYIGFDPTADSLHVGHFIAMMFMAHMQRAGHRP
SYY_CLOPH       -------------ERGFIEQATHEAETKELLGKEKVTFYIGFDATADSLTAGHFLTVMAMMHMQRAGHRP
SYY_FUSNN       -----------LKERGYLKQLTHEEEIREILGKEKVTFYIGFDPTADSLHVGHFIAMMFMAHMQQHGHRP
SYY_THETN       --------LEVLKERGYIAQMTHXXXXXXXXXXXXXTFYIGFDPTADSLHVGHLIQIMTMAHMQRAGHRP
SYY_PSEAB       ----QQDLIALLEERGFVHQCTDRDGXXXXXXXXXXXXXXGFDATADSLHIGHLQGLMLMRWLQKAGHRP
SYY_DESAA       ----KMNVLQTLKERGFIEQTTHDQELEDLLSGEQVSCYIGFDPTASSLHVGSLVPIMSLAHMQRAGHRP
SYY_PSEA8       ----QQDLIALLEERGFVHQCTDRDGXXXXXXXXXXXXXXGFDATADSLHVGHLQGLMLMRWLQKAGHRP
SYY1_PSEAE      ----QQDLIALLEERGFVHQCTDRDGXXXXXXXXXXXXXXGFDATADSLHVGHLQGLMLMRWLQKAGHRP
SYY_SYNAS       -------------ERGFIEQVTDENAVRKAL-EAPLACYIGFDPTARSLHIGSLVPIMALIHLQRHGHTS
SYY_ANAMM       ---FKSGFLNTLQVRGYLHQCTDDVALDELMALQPITAYIGFDCTARSLHIGSLMQIMVMRYLQKFGHKI
SYY_CLOPE       -----ANVLDTLMERGYIKQFTHEAETRELLEKEKVTFYIGFDPTADSLHVGHFIAMMFMAHMQKAGHRP
SYY_CLOPS       -----ANVLDTLMERGYIKQFTHEAETRELLEKEKVTFYIGFDPTADSLHVGHFIAMMFMAHMQKAGHRP
SYY_CLOP1       -----ANVLDTLMERGYIKQFTHEAETRELLEKEKVTFYIGFDPTADSLHVGHFIAMMFMAHMQKAGHRP
SYY_TREDE       --------LKILQERGFIQQCTDLQALSDRMDKGQIAFYTGTDPTGPSLHIGHMVPIFALKHLCREGHKG
SYY_DECAR       ---YQSPLIQDLHDRGLIAQITDAAALDKLLTEESVTLYCGFDPTADSLHLGHLVPVLILKRFQEAGHKP
SYY_CLOB6       -----------LKERGYIKQLTHEEEIRELLGKEKISFYIGFDPTADSLHVGHFLQMMVMAHMQKAGHRP
SYY_CLOBM       -----------LKERGYIKQLTHEEEIRELLGKEKISFYIGFDPTADSLHVGHFLQMMVMAHMQKAGHRP
SYY_ORITI       -------FINEFINRGYFYQSTDLTRLTQISNSSQIVAYIGFDCTAQSLHVGNXXXXXXXXXXXXCGHKS
SYY_CLOBK       -----------LKERGYIKQLTHEEEIRELLGKEKISFYIGFDPTADSLHVGHFLQMMVMAHMQKAGHRP
SYY_ORITB       -------FINEFINRGYFYQSTDLTRLTQISNSSQIVAYIGFDCTAQSLHVGNXXXXXXXXXXXXCGHKS
SYY_CLOBH       -----------LKERGYIKQLTHEEEIRELLGKEKISFYIGFDPTADSLHVGHFLQMMVMAHMQKAGHRP
SYY_CLOB1       -----------LKERGYIKQLTHEEEIRELLGKEKISFYIGFDPTADSLHVGHFLQMMVMAHMQKAGHRP
SYY_CLOBL       -----------LKERGYIKQLTHEEEIRELLGKEKISFYIGFDPTADSLHVGHFLQMMVMAHMQKAGHRP
SYY_CLOBJ       -----------LKERGYIKQLTHEEEIRELLGKEKISFYIGFDPTADSLHVGHFLQMMVMAHMQKAGHRP
SYY_CLOB8       -----ANVLDELLERGYIKQFTHEEETRKLLENEKITFYIGFDPTADSLHVGHFIAMMFMAHMQRAGHRP
SYY2_ENTFA      -----SAFFEELKARGLVYQVTDEEALQKQLNEESVKLYIGFDPTADSLHIGHLLPILMLRRFQQNGHVP
SYY_CHRVO       --------LQDLEARGLIAQTTDMAALQELLNKESVTLYCGFDPTADSLHIGSLVPILMLKRFQQAGHRP
SYY_BACV8       ------NFVEELTWRGMVHTMMP--GTEELLAKEQVTAYLGIDPTADSLHIGHLCGVMMLRHFQRCGHKP
SYY_BORAP       --------LNLLHKRGFLKQCTSLKVLSDLMDREKIVFYAGVDATSSSLHIGHLIPFLAMMHLRQHGHIP
SYY_NEIMB       --------IQDLQSRGLIAQTTDIEALDALLNEQKIALYCGFDPTADSLHIGHLLPVLALRRFQQAGHTP
SYY_BACFR       ------NFVEELRWRGMVHDMMP--GTEELLAKEQVTAYVGIDPTADSLHIGHLCGVMILRHFQRCGHKP
SYY_BACFN       ------NFVEELRWRGMVHDMMP--GTEELLAKEQVTAYVGIDPTADSLHIGHLCGVMILRHFQRCGHKP
SYY_NEIMA       --------IQDLQSRGLIAQTTDIEALDALLNEQKIALYCGFDPTADSLHIGHLLPVLALRRFQQAGHTP
SYY_NEIMF       --------IQDLQSRGLIAQTTDIEALDALLNEQKISLYCGFDPTADSLHIGHLLPVLALRRFQQAGHTP
SYY1_BACSU      -----TNLLEDLSFRGLIQQMTDEEGLNKQLNEEKIRLYSGFDPTADSLHIGHLLPILTLRRFQLAGHHP
SYY1_BACC1      --------LQDLEFRGLINQQTDAEGLEQLLEKESVKLYCGFDPTADSLHIGHMLPVLMLRRFQLAGHQP
SYY1_VIBPA      --------LQDLQDRGLIAQASDLEEIQTLLSQPQ-TVYCGFDPTAGSLHIGHLVPLIMLKRFQDAGHQA
SYY1_BACHK      --------LQDLEFRGLINQQTDAEGLEQLLEKESVKLYCGFDPTADSLHIGHMLPVLMLRRFQLAGHQP
SYY1_BACCZ      --------LQDLEFRGLINQQTDAEGLEQLLEKESVKLYCGFDPTADSLHIGHMLPVLMLRRFQLAGHQP
SYY1_BACAN      --------LQDLEFRGLINQQTDAEGLEQLLEKESVKLYCGFDPTADSLHIGHMLPVLMLRRFQLAGHQP
SYY_RHOBA       -SNATNSLIEDLRWRGLLNQTTDENGIAELLNSGPQTIYIGFDPTATSLHVGGXXXXXXXXXXXXAGHNP
SYY_NEIM0       --------IQDLQSRDLIAQTTDIEALDALLNEQKIALYCGFDPTADSLHIGHLLPVLALRRFQQAGHTP
SYY_BORBZ       --------LSLLHKRGFLKQCTSLKVLSDLMDREKIVFYAGVDATSSSLHIGHLIPFLAMMHLRQHGHMP
SYY_BORBU       --------LSLLHKRGFLKQCTSLKVLSDLMDREKIVFYAGVDATSSSLHIGHLIPFLAMMHLRQHGHMP
SYY_BACA2       -----TNLLEDLSFRGLIQQMTDEEGLNKQLNEEKIRLYSGFDPTADSLHIGHLLPILTLRRFQLAGHHP
SYY_STACT       -----NELLKDLEWRGLIYQQTDAEGLENILNKEQVTLYCGVDPTADSMHIGHLLPLLTLRRFQNHGHKP
SYY_NEIG2       --------IQDLQSRGLIAQTTDIEALDALLNEQKIALYCGFDPTADSLHIGHLLPVLALRRFQQAGHTP
SYY_NEIG1       --------IQDLQSRGLIAQTTDIEALDALLNEQKIALYCGFDPTADSLHIGHLLPVLALRRFQQAGHTP
SYY1_BACCR      --------LQDLEFRGLINQQTDDEGFEQLLEKESVKLYCGFDPTADSLHIGHMYPVLMLRRFQLAGHQP
SYY_BORGA       --------LNLLYKRGFLKQCTSLKVLSDLMDREKIVFYAGVDTTSSSLHIGHLIPFLAMMHLRQHGHMP
SYY_BACST       ------DLLAELQWRGLVNQTTDEDGLRKLLNEERVTLYCGFDPTADSLHIGHLATILTMRRFQQAGHRP
SYY_BORHD       --------LGILEKRGFLKQCTNLEALSVLMDREKMVFYVGVDATSTSLHIGHLIPFMAMAHLQRQGHIP
SYY1_BACLD      --------LDDLSFRGLIQQQTDEAGLRELLDKEKISLYSGFDPTADSLHIGHLLPILMLRRFQLAGHRP
SYY_GEOKA       ------DLLAELQWRGLVNQTTDEDGLRKLLNEERVTLYCGFDPTADSLHIGNLAAILTLRRFQQAGHRP
SYY_BACCA       ------DLLAELQWRGLVNQTTDEDGLRKLLNEERVTLYCGFDPTADSLHIGNLAAILTLRRFQQAGHRP
SYY_PECCP       -----SNLIKQLQERGLIAQVTDEGALAERLAQGPIALYCGFDPTADSXXXXXXXXXXXXKRFQLAGHKP
SYY_ALISL       -----NELLQDLKARGLIAQCTADEELAEHLSTDCRTLYCGFDPTADSLHIGSLVPLLVLKRFQQAGHKP
SYY_YERPY       -----SNLIKQLQERGLVAQVTDEDALAERLAQGPISLYCGFDPTADSXXXXXXXXXXXXKRFQLAGHRP
SYY_YERPS       -----SNLIKQLQERGLVAQVTDEDALAERLAQGPISLYCGFDPTADSXXXXXXXXXXXXKRFQLAGHRP
SYY_YERPP       -----SNLIKQLQERGLVAQVTDEDALAERLAQGPISLYCGFDPTADSXXXXXXXXXXXXKRFQLAGHRP
SYY_YERPN       -----SNLIKQLQERGLVAQVTDEDALAERLAQGPISLYCGFDPTADSXXXXXXXXXXXXKRFQLAGHRP
SYY_YERPG       -----SNLIKQLQERGLVAQVTDEDALAERLAQGPISLYCGFDPTADSXXXXXXXXXXXXKRFQLAGHRP
SYY_YERPE       -----SNLIKQLQERGLVAQVTDEDALAERLAQGPISLYCGFDPTADSXXXXXXXXXXXXKRFQLAGHRP
SYY_YERPB       -----SNLIKQLQERGLVAQVTDEDALAERLAQGPISLYCGFDPTADSXXXXXXXXXXXXKRFQLAGHRP
SYY_YERPA       -----SNLIKQLQERGLVAQVTDEDALAERLAQGPISLYCGFDPTADSXXXXXXXXXXXXKRFQLAGHRP
SYY_YERP3       -----SNLIKQLQERGLVAQVTDEDALAERLAQGPISLYCGFDPTADSXXXXXXXXXXXXKRFQLAGHRP
SYY_SALEP       -----SNLIKQLQERGLVAQVTDEDALAERLAQGPVALYCGFDPTADSXXXXXXXXXXXXKRFQQAGHKP
SYY_BACTN       ------NFVEELRWRGMLQDIMP--GTEELLNKEQVTAYLGIDPTADSLHIGHLCGVMILRHLQRCGHKP
SYY_VIBFM       -----NELLQDLKARGLIAQCTADEELAEHLSTDCRTLYCGFDPTADSLHIGSLVPLLVLKRFQQAGHKP
SYY_VIBF1       -----NELLQDLKARGLIAQCTADEELAEHLSTDCRTLYCGFDPTADSLHIGSLVPLLVLKRFQQAGHKP
SYY_SALTY       -----SNLIKQLQERGLVAQVTDEDALAERLAQGPIALYCGFDPTADSXXXXXXXXXXXXKRFQQAGHKP
SYY_SALTI       -----SNLIKQLQERGLVAQVTDEDALAERLAQGPIALYCGFDPTADSXXXXXXXXXXXXKRFQQAGHKP
SYY_SALSV       -----SNLIKQLQERGLVAQVTDEDALAERLAQGPIALYCGFDPTADSXXXXXXXXXXXXKRFQQAGHKP
SYY_SALPK       -----SNLIKQLQERGLVAQVTDEDALAERLAQGPIALYCGFDPTADSXXXXXXXXXXXXKRFQQAGHKP
SYY_SALPC       -----SNLIKQLQERGLVAQVTDEDALAERLAQGPIALYCGFDPTADSXXXXXXXXXXXXKRFQQAGHKP
SYY_SALPB       -----SNLIKQLQERGLVAQVTDEDALAERLAQGPIALYCGFDPTADSXXXXXXXXXXXXKRFQQAGHKP
SYY_SALPA       -----SNLIKQLQERGLVAQVTDEDALAERLAQGPIALYCGFDPTADSXXXXXXXXXXXXKRFQQAGHKP
SYY_SALNS       -----SNLIKQLQERGLVAQVTDEDALAERLAQGPIALYCGFDPTADSXXXXXXXXXXXXKRFQQAGHKP
SYY_SALHS       -----SNLIKQLQERGLVAQVTDEDALAERLAQGPIALYCGFDPTADSXXXXXXXXXXXXKRFQQAGHKP
SYY_SALG2       -----SNLIKQLQERGLVAQVTDEDALAERLAQGPIALYCGFDPTADSXXXXXXXXXXXXKRFQQAGHKP
SYY_SALDC       -----SNLIKQLQERGLVAQVTDEDALAERLAQGPIALYCGFDPTADSXXXXXXXXXXXXKRFQQAGHKP
SYY_SALCH       -----SNLIKQLQERGLVAQVTDEDALAERLAQGPIALYCGFDPTADSXXXXXXXXXXXXKRFQQAGHKP
SYY_SALAR       -----SNLIKQLQERGLVAQVTDEDALAERLAQGPIALYCGFDPTADSXXXXXXXXXXXXKRFQQAGHKP
SYY_SALA4       -----SNLIKQLQERGLVAQVTDEDALAERLAQGPIALYCGFDPTADSXXXXXXXXXXXXKRFQQAGHKP
SYY_CITK8       -----SNLIKQLQERGLVAQVTDEEALAERLAQGPIALYCGFDPTADSXXXXXXXXXXXXKRFQQAGHKP
SYY_STAHJ       --------IEELQWRGLIYQQTDESSIEELLNKEQISLYCGADPTADSLHIGHLLPFMTLRRFQEHGHRP
SYY_STRP4       -----------LKERGLIFQTTDEEALRKALEEGQVSYYTGYDPTADSLHLGHLVAILTSRRLQLAGHKP
SYY_STRPS       -----------LKERGLIFQTTDEEALRKALEEGQVSYYTGYDPTADSLHLGHLVAILTSRRLQLAGHKP
SYY_STRGC       -----------LKERGLIFQTTDEEALRQELEEGQVSYYTGYDPTADSLHLGHLVAILTSRRLQLAGHKP
SYY_KLEP7       -----SNLIKQLQERGLVAQVTDEEALAERLAQGPIALYCGFDPTADSXXXXXXXXXXXXKRFQQAGHKP
SYY_STRZT       -----------LKERGLIFQTTDEEALRKALEEGQVSYYTGYDPTADSLHLGHLVAILTSRRLQLAGHKP
SYY_STRPI       -----------LKERGLIFQTTDEEALRKALEEGQVSYYTGYDPTADSLHLGHLVAILTSRRLQLAGHKP
SYY_SHIDS       -----SNLIKQLQERGLVAQVTDEEALAERLAQGPIALYCGFDPTADSXXXXXXXXXXXXKRFQQAGHKP
SYY_OPITP       --------LDDLQWRGLYADCTDLAALTQRLGQGPVTLYCGFDPTADSLHVGNLVPLLALRRFQLHGHHP
SYY_ENTS8       -SMASSNLIKQLQERGLVAQVTDEEALAQRLAQGPIALYCGFDPTADSXXXXXXXXXXXXKRFQMAGHKP
SYY_STRS2       -----------LKARGLVFQTTDEEALVKALTEGQVSYYTGYDPTADSLHLGHLVAILTSRRLQLAGHKP
SYY_DESHY       ------NILDDLKARGLVYQTTDEEALYKRL-ESPMTLYCGFDPTADSLHIGHLLPVLMLRRFQLAGHCP
SYY_STRZP       -----------LKERGLIFQTTDEEALRKALEEGQVSYYTGYDPTADSLHLGHLVAILTSRRLQLAGHKP
SYY_STRZJ       -----------LKERGLIFQTTDEEALRKALEEGQVSYYTGYDPTADSLHLGHLVAILTSRRLQLAGHKP
SYY_STRR6       -----------LKERGLIFQTTDEEALRKALEEGQVSYYTGYDPTADSLHLGHLVAILTSRRLQLAGHKP
SYY_STRPN       -----------LKERGLIFQTTDEEALRKALEEGQVSYYTGYDPTADSLHLGHLVAILTSRRLQLAGHKP
SYY_STRPJ       -----------LKERGLIFQTTDEEALRKALEEGQVSYYTGYDPTADSLHLGHLVAILTSRRLQLAGHKP
SYY_STRP2       -----------LKERGLIFQTTDEEALRKALEEGQVSYYTGYDPTADSLHLGHLVAILTSRRLQLAGHKP
SYY1_STRT2      -----------LKARGLIFQTTDEEALVKAFEEGPVSFYTGYDPTADSLHLGHLVAILTSRRLQLAGHKP
SYY1_STRT1      -----------LKARGLIFQTTDEEALVKAFEEGPVSFYTGYDPTADSLHLGHLVAILTSRRLQLAGHKP
SYY_STRP7       -----------LKDRGLIFQTTDEEALRKALEEGQVSYYTGYDPTADSLHLGHLVAILTSRRLQLAGHKP
SYY_SHISS       -----SNLIKQLQERGLVAQVTDEEALAERLAQGPIALYCGFDPTADSXXXXXXXXXXXXKRFQQAGHKP
SYY_SHIB3       -----SNLIKQLQERGLVAQVTDEEALAERLAQGPIALYCGFDPTADSXXXXXXXXXXXXKRFQQAGHKP
SYY_ESCF3       -----SNLIKQLQERGLVAQVTDEEALAERLAQGPIALYCGFDPTADSXXXXXXXXXXXXKRFQQAGHKP
SYY_ECOUT       -----SNLIKQLQERGLVAQVTDEEALAERLAQGPIALYCGFDPTADSXXXXXXXXXXXXKRFQQAGHKP
SYY_ECOSM       -----SNLIKQLQERGLVAQVTDEEALAERLAQGPIALYCGFDPTADSXXXXXXXXXXXXKRFQQAGHKP
SYY_ECOSE       -----SNLIKQLQERGLVAQVTDEEALAERLAQGPIALYCGFDPTADSXXXXXXXXXXXXKRFQQAGHKP
SYY_ECOLU       -----SNLIKQLQERGLVAQVTDEEALAERLAQGPIALYCGFDPTADSXXXXXXXXXXXXKRFQQAGHKP
SYY_ECOLI       -----SNLIKQLQERGLVAQVTDEEALAERLAQGPIALYCGFDPTADSXXXXXXXXXXXXKRFQQAGHKP
SYY_ECOLC       -----SNLIKQLQERGLVAQVTDEEALAERLAQGPIALYCGFDPTADSXXXXXXXXXXXXKRFQQAGHKP
SYY_ECOL6       -----SNLIKQLQERGLVAQVTDEEALAERLAQGPIALYCGFDPTADSXXXXXXXXXXXXKRFQQAGHKP
SYY_ECOK1       -----SNLIKQLQERGLVAQVTDEEALAERLAQGPIALYCGFDPTADSXXXXXXXXXXXXKRFQQAGHKP
SYY_ECOHS       -----SNLIKQLQERGLVAQVTDEEALAERLAQGPIALYCGFDPTADSXXXXXXXXXXXXKRFQQAGHKP
SYY_ECODH       -----SNLIKQLQERGLVAQVTDEEALAERLAQGPIALYCGFDPTADSXXXXXXXXXXXXKRFQQAGHKP
SYY_ECOBW       -----SNLIKQLQERGLVAQVTDEEALAERLAQGPIALYCGFDPTADSXXXXXXXXXXXXKRFQQAGHKP
SYY_ECO8A       -----SNLIKQLQERGLVAQVTDEEALAERLAQGPIALYCGFDPTADSXXXXXXXXXXXXKRFQQAGHKP
SYY_ECO81       -----SNLIKQLQERGLVAQVTDEEALAERLAQGPIALYCGFDPTADSXXXXXXXXXXXXKRFQQAGHKP
SYY_ECO7I       -----SNLIKQLQERGLVAQVTDEEALAERLAQGPIALYCGFDPTADSXXXXXXXXXXXXKRFQQAGHKP
SYY_ECO5E       -----SNLIKQLQERGLVAQVTDEEALAERLAQGPIALYCGFDPTADSXXXXXXXXXXXXKRFQQAGHKP
SYY_ECO57       -----SNLIKQLQERGLVAQVTDEEALAERLAQGPIALYCGFDPTADSXXXXXXXXXXXXKRFQQAGHKP
SYY_ECO55       -----SNLIKQLQERGLVAQVTDEEALAERLAQGPIALYCGFDPTADSXXXXXXXXXXXXKRFQQAGHKP
SYY_ECO45       -----SNLIKQLQERGLVAQVTDEEALAERLAQGPIALYCGFDPTADSXXXXXXXXXXXXKRFQQAGHKP
SYY_ECO27       -----SNLIKQLQERGLVAQVTDEEALAERLAQGPIALYCGFDPTADSXXXXXXXXXXXXKRFQQAGHKP
SYY_ECO24       -----SNLIKQLQERGLVAQVTDEEALAERLAQGPIALYCGFDPTADSXXXXXXXXXXXXKRFQQAGHKP
SYY_DESHD       ------NILDDLKARGLVYQTTDEEALYKRL-ESPMTLYCGFDPTADSLHIGHLLPVLMLRRFQLAGHCP
SYY_BORT9       --------LEILEKRGFLKQCTNLEALSTLMDKERVVFYVGVDATSTSLHIGHLIPFMVMAHLQRQGHIP
SYY_STRPG       -----------LKARGLVFQTTDEQALVKALTEGQVSYYTGYDPTADSLHLGHLVAILTSRRLQLAGHKP
SYY_STAES       --------IEDLKWRGLIYQQTDEEGIEELLNKEQVTLYCGADPTADSLHIGHLLPFLTLRRFQEHGHRP
SYY_STAEQ       --------IEDLKWRGLIYQQTDEEGIEELLNKEQVTLYCGADPTADSLHIGHLLPFLTLRRFQEHGHRP
SYY_YERE8       -----SNLIKQLQERGLVAQVTDEDALAERLAQGPISLYCGFDPTADSXXXXXXXXXXXXKRFQLAGHRP
SYY_STRTD       -----------LKARGLIFQTTDEEALVKAFEEGPVSFYTGYDPTADSLHLGHLVAILTSRRLQLAGHKP
SYY_TREPA       --------LARLQARGFIRQCTDLSALSARMDAGPLTFYVGVDPTGSSLHVGHMLPMFALKHLCDAGHRG
SYY_ERWCT       -----SNLIKQLQERGLIAQVTDEEALAERLAQGPIALYCGFDPTADSXXXXXXXXXXXXKRFQLSGHKP
SYY_KLEP3       -----SNLIKQLQERGLVAQVTDEEALAERLAQGPIALYCGFDPTADSXXXXXXXXXXXXKRFQQAGHKP
SYY_ENT38       -----SNLIKQLQERGLVAQVTDEEALAERLAQGPIALYCGFDPTADSXXXXXXXXXXXXKRFQEMGHKP
SYY_STAAW       --------IEDLKWRGLIYQQTDEQGIEDLLNKEQVTLYCGADPTADSLHIGHLLPFLTLRRFQEHGHRP
SYY_STAAT       --------IEDLKWRGLIYQQTDEQGIEDLLNKEQVTLYCGADPTADSLHIGHLLPFLTLRRFQEHGHRP
SYY_STAAS       --------IEDLKWRGLIYQQTDEQGIEDLLNKEQVTLYCGADPTADSLHIGHLLPFLTLRRFQEHGHRP
SYY_STAAR       --------IEDLKWRGLIYQQTDEQGIEDLLNKEQVTLYCGADPTADSLHIGHLLPFLTLRRFQEHGHRP
SYY_STAAN       --------IEDLKWRGLIYQQTDEQGIEDLLNKEQVTLYCGADPTADSLHIGHLLPFLTLRRFQEHGHRP
SYY_STAAM       --------IEDLKWRGLIYQQTDEQGIEDLLNKEQVTLYCGADPTADSLHIGHLLPFLTLRRFQEHGHRP
SYY_STAAE       --------IEDLKWRGLIYQQTDEQGIEDLLNKEQVTLYCGADPTADSLHIGHLLPFLTLRRFQEHGHRP
SYY_STAAC       --------IEDLKWRGLIYQQTDEQGIEDLLNKEQVTLYCGADPTADSLHIGHLLPFLTLRRFQEHGHRP
SYY_STAAB       --------IEDLKWRGLIYQQTDEQGIEDLLNKEQVTLYCGADPTADSLHIGHLLPFLTLRRFQEHGHRP
SYY_STAA9       --------IEDLKWRGLIYQQTDEQGIEDLLNKEQVTLYCGADPTADSLHIGHLLPFLTLRRFQEHGHRP
SYY_STAA8       --------IEDLKWRGLIYQQTDEQGIEDLLNKEQVTLYCGADPTADSLHIGHLLPFLTLRRFQEHGHRP
SYY_STAA3       --------IEDLKWRGLIYQQTDEQGIEDLLNKEQVTLYCGADPTADSLHIGHLLPFLTLRRFQEHGHRP
SYY_STAA2       --------IEDLKWRGLIYQQTDEQGIEDLLNKEQVTLYCGADPTADSLHIGHLLPFLTLRRFQEHGHRP
SYY_STAA1       --------IEDLKWRGLIYQQTDEQGIEDLLNKEQVTLYCGADPTADSLHIGHLLPFLTLRRFQEHGHRP
SYY_CYTH3       ------NFVEELKWRGMLHDIMP--GTEEYLLKNQTTAYVGFDPTASSLTIGNLVTIMMLVHFQHAGHIP
SYY_BACP2       -----SQLMEELSFRGLIQQQTDEEGLTKLLAEEKIKLYSGFDPTADSLHIGHLLPILTLRRFQEAGHHP
SYY_STAS1       --------LEDLKWRGLIYQQTDESGIENILNKEQVTLYCGADPTADSLHIGHLLPFLTLRRFQEHGHRP
SYY_STRPD       -----------LKARGLVFQTTDEQALVKALTEGQVSYYTGYDPTADSLHLGHLVAILTSRRLQLAGHKP
SYY_STRPC       -----------LKARGLVFQTTDEQALVKALTEGQVSYYTGYDPTADSLHLGHLVAILTSRRLQLAGHKP
SYY_STRPB       -----------LKARGLVFQTTDEQALVKALTEGQVSYYTGYDPTADSLHLGHLVAILTSRRLQLAGHKP
SYY_STREM       -----------LKARGLVFQTTDEEALVKALTEGQVSYYTGYDPTADSLHLGHLVAILTSRRLQLAGHKP
SYY_STRE4       -----------LKARGLVFQTTDEEALVKALTEGQVSYYTGYDPTADSLHLGHLVAILTSRRLQLAGHKP
SYY_STRP6       -----------LKARGLVFQTTDEQALVKALTEGQVSYYTGYDPTADSLHLGHLVAILTSRRLQLAGHKP
SYY_STRMU       -----------LKARGLVFQTTDEEALKKSLDDGQVSFYTGYDPTADSLHLGHLVPILVMRHLQLAGHKP
SYY_SERP5       -----SNLIKQLQERGLVAQVTDEEALAERLAQGPIALYCGFDPTADSXXXXXXXXXXXXKRFQLAGHKP
SYY_LACLS       -----------LKARGLVFQTTDEAALSKALTEDMVSYYVGYDPTADSLHLGNLVLILTMKRLQMAGHKP
SYY_STRPM       -----------LKARGLVFQTTDEQALVKALTEGQVSYYTGYDPTADSLHLGHLVAILTSRRLQLAGHKP
SYY1_PHOLL      -----NNLIKQLQERGLIAQVTDENALAERLAQGPVSLYCGFDPTADSXXXXXXXXXXXXKRFQLAGHKP
SYY_STRS7       -----------LKARGLVFQTTDEEALVKALTEGQVSYYTGYDPTADSLHLGHLVAILTSRRLQLAGHKP
SYY_STRP3       -----------LKARGLVFQTTDEQALVKALTEGQVSYYTGYDPTADSLHLGHLVAILTSRRLQLAGHKP
SYY_STRP8       -----------LKARGLVFQTTDEQALVKALTEGQVSYYTGYDPTADSLHLGHLVAILTSRRLQLAGHKP
SYY_LACLM       -----------LKARGLVFQTTDEAALSKALTEDMVSYYVGYDPTADSLHLGNLVLILTMKRLQMAGHKP
SYY_PORG3       ------NFVEELRWRGMIHDIMP--GTEEHLNKGMTSAYVGIDPTADSLHIGHLVGVMMLRHFQRAGHRP
SYY_FLAPJ       ------NLVEELKWRGLFHDMMP--GTEEQLTKESTTAYIGFDPTADSLHIGSMVQIILLVHLKNFGHKP
SYY1_VIBVY      -----------LAQRGLIAQTTDLEQLIALF-RQPQTLYCGFDPTAGSLHIGHLVPLIMLKRFQDAGHQG
SYY_ERWT9       -----SNLIKQLQERGLVAQVTDENALAERLAQGPIALYCGFDPTADSXXXXXXXXXXXXKRFQDAGHKP
SYY_PORGI       ------NFVEELRWRGMIHDIMP--GTEEHLNKGMTSAYVGIDPTADSLHIGHLVGVMMLRHFQRAGHRP
SYY_STRPZ       -----------LKTRGLVFQTTDEQALVKALTEGQVSYYTGYDPTADSLHLGHLVAILTSRRLQLAGHKP
SYY_STRPF       -----------LKARGLVFQTTDEQALVKALTEGQVSYYTGYDPTADSLHLGHLVAILTSRRLQLAGHKP
SYY_STRP1       -----------LKARGLVFQTTDEQALVKALTEGQVSYYTGYDPTADSLHLGHLVAILTSRRLQLAGHKP
SYY_FLAJ1       ------NLVEELKWRGLYHD--SMPGTEEQLLKEVTSAYIGFDPTADSLHIGSMVQIILLVHLKNFGHQP
SYY_AMOA5       ------DFIANLRWRGMIHDITP--GLEAQLQKEMITGYIGFDPTAPSLHVGNLATIMLLKHFQLAGHKP
SYY1_VIBVU      -----------LAQRGLIAQTTDLEQLIALF-RQPQTLYCGFDPTAGSLHIGHLVPLIMLKRFQDAGHQG
SYY_STRA3       -----------LKERGLVFQTTDEDALRKALEEGSVSYYTGYDPTADSLHLGHLVAILTSRRLQLAGHKP
SYY1_PSEHT      -----TQLLEDITHRGLVSQVSDLAQLEQLLATSQVV-YCGFDPTAGSLHIGHLVPLLMLKRFNDAGHKA
SYY_PARUW       -----TNVMDVLRERGFIDAVTSEE--IRQLTNQPIKVYCGFDPTADSLHLGNLVAIMGLAWFQRFGHTP
SYY_STRA5       -----------LKERGLVFQTTDEDALRKALEEGSVSYYTGYDPTADSLHLGHLVAILTSRRLQLAGHKP
SYY_STRA1       -----------LKERGLVFQTTDEDALRKALEEGFVSYYTGYDPTADSLHLGHLVAILTSRRLQLAGHKP
SYY_STRU0       -----------LKARGLVFQTTDEEALVKALTEGQVSYYTGYDPTADSLHLGHLVAILTSRRLQLAGHKP
SYY_CORJK       -----SDNMNIIDERGLINQSTDLEALKEA-TQNPITLYCGFDPTGSSLHAGHLVPLIMLKRFQQFGHRP
SYY_LACLA       -----------LKARGLVFQTTDEAALSKALTEDMVSYYVGYDPTADSLHLGNLVLILTMKRLQMAGHKP
SYY_LISW6       -----------LEWRGAIYQQTDEEGLRKWVEEKQISLYCGIDPSGDSMHIGHLIPFMILRRFQNAGHRP
SYY_LISIN       -----------LEWRGAIYQQTDEEGLRKWVEEKQISLYCGIDPSGDSMHIGHLIPFMILRRFQNAGHRP
SYY_PARD8       ------NFVEELRWRGMIADMMP--GTEEQLQKELTSAYVGIDPTADSLHIGHLVSVMMLKHFQRAGHRP
SYY_SODGM       -----SNLIQQLQERGLIAQVTDEKALAERLAAGPIALYCGFDPTADSXXXXXXXXXXXXKRFQLAGHRP
SYY_OCEIH       ------DILQDLESRGLIHQTTDRERLEKHLQNNQVTLYCGFDPTADSLHIGHLVPLTMLKRFQQAGHKP
SYY_LISMH       -----------LEWRGAIYQQTDEEGLRKWVDEKQISLYCGIDPSGDSMHIGHLIPFMILRRFQNAGHRP
SYY_BORRA       --------LKVLDKRGFLKQCTNLEELSTLMDREKIVFYVGVDATSASLHIGHLIPFMVMLHLQRQXXXX
SYY_BORDL       --------LKVLDKRGFLKQCTNLEELSTLMDREKIVFYVGVDATSASLHIGHLIPFMVMLHLQRQXXXX
SYY_MACCJ       -----SALLEDLRWRGLIYQETHPEEMEALLNKESVSVYCGTDPTADSLHIGHLLPFMTLKRFQAHGHRP
SYY_LISMO       -----------LEWRGAIYQQTDEEGLRKWVEEKQISLYCGIDPSGDSMHIGHLIPFMILRRFQNAGHRP
SYY_LISMF       -----------LEWRGAIYQQTDEEGLRKWVEEKQISLYCGIDPSGDSMHIGHLIPFMILRRFQNAGHRP
SYY_LISMC       -----------LEWRGAIYQQTDEEGLRKWVEEKQISLYCGIDPSGDSMHIGHLIPFMILRRFQNAGHRP
SYY_AERHH       --------LDELTRRGLVAQNSDPVALADHLATPR-TVYCGFDPTAGSLHIGHLVPLLMLRRFQLAGHTP
SYY_MYCPE       ------NILEFLKKRGYIYQGSNFDLIEKELIKGT-SFYIGFDPTADSLHVGHFLTMMAVKHLQKAGNNP
SYY_LARHH       --------IQELEARGLIAQQTDSGALQKLLESESVTLYCGFDPTADSXXXXXXXXXXXXRRFQEAGHRP
SYY_BUCBP       --------IQEFQDRNLISQITNEIDLKNILLHNKISLYCGFDITADSLHVGHILPLLCLRRFQNLGHRP
SYY_LEIXX       --------------RGLVYVSTDEAALKQLLAGEPIAYYCGFDPTAPSLHLGNLVQLLTMRRLQLAGHRP
SYY_CORDI       -----------LQWRGLINQSTDIDALREACEKP-ITLYCGFDPTGDSLHAGHLVPMIMLRRFQEAGHRP
SYY_KINRD       -----NDVWDELQWRGLVAHSTDEAALQEALQTGPLTYYVGFDPTAASLHVGHLVQVLTAKRLQQAGHRP
SYY_STRGG       -----TDIVDELKWRGLFAQSTDEDALRKALADGPVTFYCGFDPTAASLHVGHLVQVLTMRRLQQAGLKP
SYY_SHIBS       -----SNLIKQLQERGLVAQVTDEEALAERLAQGPIALYCGFDPTADSXXXXXXXXXXXXKRFQQAGHKP
SYY_BIFA0       --------LDELEWRGLISQSTDRDRLAHTLNGEPVHYYCGFDPTAPSLHIGNLVQLIIMRHLQEAGHHP
SYY2_BACHK      -----------LEWRGAVNQQTDEEGLRKLVEEKKISLYCGVDPTGDSMHIGHLIPFMMMKRFQLAGHQP
SYY_SHIFL       -----SNLIKQLQERGLVAQVTDEEALAERLAQGPIALYCGFDPTADSXXXXXXXXXXXXKRFQQAGHKP
SYY_SHIF8       -----SNLIKQLQERGLVAQVTDEEALAERLAQGPIALYCGFDPTADSXXXXXXXXXXXXKRFQQAGHKP
SYY_HAMD5       -----NNLIEQLEQRGLIAQVTDKTRLSERLYQGQISLYCGFDPTADSXXXXXXXXXXXXKRFQLVGHKP
SYY2_BACCZ      -----------LEWRGAVNQQTDEEGLRKLVEEKKISLYCGVDPTGDSMHIGHLIPFMMMKRFQLAGHHP
SYY_LACPL       --------------RGAINQQTDEAGLKELTENQSVSLYCGIDPTGDSMHIGHLIPFMILKRFQLAGHHP
SYY_ACIC1       --------------RGLIAQSTDLEALRAAMNTGPITVYCGFDPTAPSLHIGHLVQILTLRRFQDAGHRP
SYY2_BACCR      -----------LEWRGAVNQQTDEEGLRKLVEEKKISLYCGVDPTGDSMHIGHLIPFMMMKRFQLAGHHP
SYY2_BACC1      -----------LEWRGAINQQTDEEGLRKLVEEKKISLYCGVDPTGDSMHIGHLIPFMMMKRFQLAGHHP
SYY_ROSS1       -----------LDERGLLYESSD--GLDELLTRERVTLYIGFDPSADSXXXXXXXXXXXXARFQRWGHXX
SYY2_BACAN      -----------LEWRGAVNQQTDEEGLRKLVEEKKISLYCGVDPTGDSMHIGHLIPFMMMKRFQLAGHHP
SYY1_VIBCH      -----------LQQRGLIAQSTPLEALVERFATPQVL-YCGFDPTAGSLHIGHLVPLLMLKRFQNAGHQA
SYY_MYCFO       --------LDELDWRGLIAQSTDRETLANDLANGPMTVYSGFDPTAPSLHAGHLVPLLTLRRFQRAGHRP
SYY_BLOPB       MNNKNIDIIQLLYERDLIAQITNQEALIKILKSKSITLYCGFDPTSDSLHIGHLVPLLCLRQFQIFGHRP
SYY_ROSCS       -----------LDERGLLYESSD--GLDDLLERERVTLYIGFDPSADSXXXXXXXXXXXXARFQRWGHXX
SYY_BIFAA       --------LDELEWRGLISQSTDRDRLAEALNGEPITYYCGFDPTAASLHIGNLVQLINMRHLQAAGHHP
SYY_CORGL       -----------LSWRGLINQSTDLEALREE-ASTPITLYCGFDPTGPSLHAGHLVPLLMLRRFQQAGHNP
SYY_CHLMU       ----------SLQKRGILDNSS--AGLESLTAP--VSAYLGFDPTAPSLHIGHWIGICFLRRLSAYGITP
SYY_BIFLO       --------LEELEWRGLISQSTDRDRLAEALNGEPITYYCGFDPTAASLHIGNLVQLINMRHLQLAGHHP
SYY_BIFLI       --------LEELEWRGLISQSTDRDRLAEALNGEPITYYCGFDPTAASLHIGNLVQLINMRHLQLAGHHP
SYY_BIFLD       --------LEELEWRGLISQSTDRDRLAEALNGEPITYYCGFDPTAASLHIGNLVQLINMRHLQLAGHHP
SYY_LACJO       ----KFDILEDLKWRGAINQETDEEGLRKYLAEDDLALYCGTDPTGDSLHIGHLIPFMILKRFQMAGYHP
SYY_CHLTR       -----------LKKRGILDNSS--AGLESLTVP--VSAYLGFDPTAPSLHIGHWIGICFLRRLAAYGITP
SYY_CHLTB       -----------LKKRGILDNSS--AGLESLTVP--VSAYLGFDPTAPSLHIGHWIGICFLRRLAAYGITP
SYY_CHLTA       -----------LKKRGILDNSS--AGLESLTVP--VSAYLGFDPTAPSLHIGHWIGICFLRRLAAYGITP
SYY_CHLT2       -----------LKKRGILDNSS--AGLESLTVP--VSAYLGFDPTAPSLHIGHWIGICFLRRLAAYGITP
SYY_ANADE       ------NLLEALVPRSLVHD--QTPGLQARLAQGPITGYVGFDPTADSLHVGHLLAVMSLAWLQRCXXXX
SYY_LACF3       --------------RGALNQATDEEGLRELTEEKKIALYCGTDPSGDSLHIGHLIPFMMLKRFQLAGHKP
SYY_ANAD2       ------NLLEALVSRSLVHD--QTPGLQARLAQGPITGYVGFDPTADSLHVGHLLAVMSLAWLQRCXXXX
SYY_MYCSS       -----SSILDELDWRGLIAQSTDRDALAAELAAGPMTLYSGFDPTAPSLHAGHLVPLLTLRRFQQAGHRP
SYY_MYCSK       -----SSILDELDWRGLIAQSTDRDALAAELAAGPMTLYSGFDPTAPSLHAGHLVPLLTLRRFQQAGHRP
SYY_COREF       -----TNIIDELSWRGLINQSTDLDALREA-TQEPITLYCGFDPTGPSLHAGHLVPLLMLRRFQQAGHNP
SYY_CHLCV       ------DFIKHLKDRGILEDFSH--GLDSV--ESPISAYLGFDPTAASLHIGHWIGICFLRRMASFGITP
SYY_ANASK       ------NLLEALVSRSLVHD--QTPGLQARLAQGPITGYVGFDPTADSLHVGHLLAVMSLAWLQRCXXXX
SYY_MYCSJ       -----SSILDELDWRGLIAQSTDRDALAAELAAGPMTLYSGFDPTAPSLHAGHLVPLLTLRRFQQAGHRP
SYY_LACBR       --------------RGAINQQTDAEGLKKLTSEKKISLYCGVDPTGDSMHIGHLIPFMMMKRFELAGHHP
SYY_NOCFA       ------DIIDELTWRGLIAQSTDXXXXXXXXXXXXXXXYAGFDPTAASLHAGHLVPLLALKRFQRAGHRP
SYY_BUCAT       MSEF--NFISRLHNRGLISHITNEDNLSKLIENKSISLYCGFDPTEESLHIGHLLPLIMLKRFQIAGHRP
SYY_BUCAI       MSEF--NFISRLHNRGLISHITNEDNLSKLIENKSISLYCGFDPTEESLHIGHLLPLIMLKRFQIAGHRP
SYY_BUCA5       MSEF--NFISRLHNRGLISHITNEDNLSKLIENKSISLYCGFDPTEESLHIGHLLPLIMLKRFQIAGHRP
SYY_LACAC       ----KFDILEDLKWRGAINQETDEEGLRKYLAEDDLALYCGTDPTGDSLHIGHLIPFMILKRFQMAGYHP
SYY_PEDPA       --------------RGAVNQQTDEEGLKKLTDEKKIGLYAGIDPTGDSMHIGHLIPFMVLKRFQQAGHKP
SYY_CHLAB       ------DFIQHLQDRGILENFS--SGLDNV--STPVSAYLGFDPTAPSLHIGHWIGICFLRRMAHFGLTP
SYY_MYCLE       -----SSILNELGWRGLVAQSTDLDALADELRRGPMTVYAGFDPTAPSXXXXXXXXXXXXRRFQRAGHRP
SYY_LACH4       ----KFDILEDLKWRGAINQETDEEGLRKYLAEDDLALYCGTDPTGDSLHIGHLIPFMILKRFQMAGYHP
SYY_MYCPA       -----------LDELGWRGLIAQSTDLDALAAERPMTVYAGFDPTAPSLHAGHLVPLLALRRFQRAGHRP
SYY_MYCPN       ------DLLALLKERGLFVQANFEKELKQLLNQGSFAFYVGFDPTAPSLHIGNYVLLHVAQIFQAMGHIP
SYY_STRCO       -----TDIVDELKWRGLFAQSTDEDALRKALADGPVTFYCGFDPTAPSLHVGHLVQVLTVRRLQQAGHRP
SYY_LACS1       --------MNILDERGAINQVSDEEGLRKLLDKKSVGLYCGVDPTGDSLHIGHLIPFMMLKRFQEAGHRA
SYY_THEFY       -----TDIIDDLQWRGLIAQTTDLDDLRKALADGPVTLYCGFDPTAGSLHVGHLTQALTLARFQRAGHRP
SYY_MYCTU       --------LDELSWRGLIAQSTDLDTLAAEAQRGPMTVYAGFDPTAPSLHAGHLVPLLTLRRFQRAGHRP
SYY_MYCBO       --------LDELSWRGLIAQSTDLDTLAAEAQRGPMTVYAGFDPTAPSLHAGHLVPLLTLRRFQRAGHRP
SYY_LACRD       ------DILNELEWRGAINQVTDEEGLRKLTSEDKIALYCGTDPTGDSLHIGHLIPFMILKRFQLAGHHP
SYY_STRAW       -----TDIVDELKWRGLVALSTDEDALRKAFADGPVTFYCGFDPTAPSLHLGNLVQILTMRRIQQAGNRP
SYY_CHLPN       -------WLQSLQERNILENFT--AGLESV--EGPIAAYLGFDPTAPALHIGHWIGICFLKRLAALGITP
SYY_PROAC       -----SDLLDDLEWRGLVADSTDREALEAHLAQGPVTFYVGFDPTAKSLHIGHLVQLMLVRALQERGHKP
SYYM_DROME      --------LLELTDRGFFHGIFPDTAMKQLFTRGQQSIYAGFDPTADSLHVGNLLVIMGLIHCQRAGHRP
SYY_LACSS       ----QKNIIDELTWRDAINQQTDADGLRELTEKKSISLYCGVDPTGDSMHIGHLIPFMMMKRFQLAGHHP
SYY_OENOB       ------DIIEDLKWRGSIKQTTDESGLANLLKHKKISLYVGVDPTAKSIHIGNLIPLTILKRFQNAGHRP
SYY_BUCAP       ------DLINELHQRNLIFHITXXXXXXXXXXXXYISLYCGFDPTEDSLHVGHLLPLITLKRFQVLGHKP
SYY_TROWT       --------------RGLVCVSTDQGALKELLDGPPIRFYCGFDPTAPSLHVGNLAQILIMRRLQLAGHRP
SYY_TROW8       --------------RGLVCVSTDQGALKELLDGPPIRFYCGFDPTAPSLHVGNLAQILIMRRLQLAGHRP
SYY1_ENTFA      --------------RDAINQQTNEEGLRELTENTSISLYCGVDPTGDSMHIGHLIPFMMMKRFQLAGHHP
SYY_BLOFL       -----------LYERGSIAQITDRKKLNAVLNSQPITLYCGFDPTADSLHIGHLAPLLCLKRFQKAGHRP
SYY_ACHLI       ------DLFKQLEYRGMVKDVSDLELAKQLLNEQKIKFYVGYDPTGESLTVGHLVQIVRMLYLQKHGHXX
SYY_MYCCT       ----KNNILEELKWRGLIKQVTNEQKLDAQNSNDAV--YCGFDPTADSLHVGHLMMIITLKRFALQGFKP
SYY_LEUCK       ------NFIEDLKWRGALNQITDEAGLLEAMASGKVGAYVGTDPTADSLHLGHLIPFMVLKRFQKXXXXX
SYY_MYCMS       ----KNSILEELKWRGLIKQITNESKILDA-QNNNDAVYCGFDPTADSLHVGHLMMIITLKRFADYNFKP
SYYM_DICDI      ----KNNVINILKKRGFIHQMT-ASDIEMIKMTSTVSLYAGFDPTADSLHIGNLLTLMVMLHFKRHGHNP
SYY_WIGBR       ------DLIQELKNRKLISKLTDXXXXXXXXXXXXXXXYCGFDPTADSLHIGHLIPLLFLKRFSNFGHIP
SYY_MESFL       ------NIIKELEWRGLVKQITNEERLLKA-QNDGAAVYCGFDPTADSLHVGHLMMIVTLKRFDKAXXXX
SYY_LACDB       ------DILEDLKWRGAINQETDEEGLRDYLAKDDLALYCGTDPTGDSLHIGHLIPFMILKRFQLAGYKX
SYY_LEUMM       ------NFIEDLKWRGALNQVTDEAGLIEAMASGEIGAYVGTDPTADSLHLGHLIPFMVLKRFQNXXXXX
SYY_ONYPE       -------FYEELKWRNLIKDCSNETQVKELLDNNQVKFYCGFDPTSHSLTVGHLVQITMILLMQRQGHLP
SYYM_YEAST      ------NILDELKQRGLVSQVSQPESFTKLNGNDKIKLYCGVDPTAQSLHLGNLVPLMVLLHFYVKGHDI
SYY_LACDA       ------DILEDLKWRGAINQETDEEGLRDYLAKDDLALYCGTDPTGDSLHIGHLIPFMILKRFQLAGYKX
SYY_AYWBP       -------FYEELKWRNLIKDCNNEIQVKELLDNNQVKFYCGFDPTSHSLTVGHLIQITMILLMQRQGHLP
SYY_MYCGE       -----NNILQFLKERELYSQANFETELDNHLKEKKNNFYVGFDPTANSLHIGNYVLIHIAKLLKDMGHTP
SYYM_MOUSE      --------------RGLFKEFFPESGLPELFDRRRATVYCGFDPTGDSXXXXXXXXXXXXXXXQRAGHNV
SYY_UREU1       --------------------------------------YVGFDPSADSLHLGNYIMIMLLKRFRLHNIKT
SYYM_RAT        --------------RGLFKEFFPESGLPELFDRRRATVYCGFDPTGDSXXXXXXXXXXXXXXXQRAGHNV
SYY_PHYMT       --------------RNLITECSDEKRAKLLLGNKKIKFYCGFDATAGSLTVGHLVQIITFLLIQKKGHFP
SYYM_HUMAN      --------------KDFFPETGTKIELPELFDRGTATIYCGFDPTADSXXXXXXXXXXXXXXXQRAGHNV
SYY_PHYAS       -------FYEELKWRNLIKDSSDEKELKNLLDCKKIKFYCGFDPTSDSLTVGHLVQLTMMSLLEKQGHSP
SYY_UREPA       --------IKDLKARNLINNITNEEKLIKALEKNK-GIYVGFDPSADSLHLGNYIMIMLLKRFRLYNIKT
SYY_UREP2       --------IKDLKARNLINNITNEEKLIKALEKNK-GIYVGFDPSADSLHLGNYIMIMLLKRFRLYNIKT
SYY2_STRT2      -----------LQWRGLVKQYSSDSLIEKL-NNGKLTFYIGTDPTADSLHLGHYSSFLIAKRLAKYGHQP
SYY2_STRT1      -----------LQWRGLVKQYSSDSLIEKL-NNGKLTFYIGTDPTADSLHLGHYSSFLIAKRLAKYGHQP
SYY_MYCAP       ------NILKDLEERLILKDISNKDKFANL-SPSTTGVYVGFDPTAESLHLGNYILISVLLRFKEYGFKT
SYY_MYCGA       ------DFISELKKRNIIKQISNEEKL-ALALKNQKGVYVGFDPSGESLHLGNLIPIIVLRYLKKVGFKT
SYY_MYCPU       --------IEELKKRKVFNNITSEEKVDLITLDHGI--YVGFDPTAISLHLGNYIQMVNLKRFQNVGFKT
SYY_MYCS5       --------LTELRDREILKDISNEEKFLSLPKNSGV--YVGFDPTADSLHLGNYVQIVNLIRFKKHNWNA
SYYM_NEUCR      ------------EERGYV---KDTAGIAELMRTRRIGAYVGIDPTAPSLHVGHLLPLMPLFWMYLEGYKA
SYYM_SCHPO      ------------------------------------SVYLGADPTAASLHVGNLVALMPLVHFFLNGFPV
SYY_MYCMO       -----NSFLKELQEKNLIQDISNIEKIENSL-KNKMGIYVGFDPSAKSIHLGNFVVINVLLIAKKHRIPT
SYY_MYCHJ       ----KQEFLTELKTRNILKDISSPEKFFNLKPDQGI--YIGFDPTATSLHLGNYISISLLKRLQKIGIKV
SYY_MYCH2       ----KQEFLTELKTRNILKDISSPEKFFNLKPDQGI--YIGFDPTATSLHLGNYISISLLKRLQKIGIKV
SYY_MYCH7       ----KQEFLAELKTRNILKDISSPEKFFNLKPDQGI--YIGFDPTATSLHLGNYISISLLKRLQKIGIKV
SYY_BACSK       ---------------------------------------LGMDPSAPDVHIGHTVVLQKLRQFQEYGHHI
SYY_DESPS       ----------------------------------------GFDPTAPDLHLGHTVLLQKLKQFQDLGHQV
SYYM_PODAN      -------------ERGYV---KDTAGSHETIRKKRIGAYTGIDPTAPSLHIGHLLPLMPIFWMYMHGYAG
SYY_THIDA       ----------------------------------------GFDPTAPDLHLGHTVLLNKLRQFQVLGHRI
SYY_GEOSL       ----------------------------------------GFDPTAPDLHLGHTVLLHKMRQFQQLGHEV
SYY_SYNY3       ---------------------------------------LGIDPTGTDIHLGHSIPFRKLRAFQDAGHTA
SYY_NITOC       ----------------------------------------GFDPTAPELHLGHTVLLNKLRQFQEFGHEV
SYY_BACHD       -------------KRGVVEIVPEEA-LREKIEKSVRTGKLGMDPSAPDVHIGHTVVLHKLRQFQDLGHEV
SYY_PELCD       ----------------------------------------GFDPTAPDLHVGHTVLIQKLKQFQDLGHEV
SYY_DESDG       --------------RGSAEFIDEEELKKKLAKGRPLRVKAGFDPTAPDLHLGHTVLIHKLRHFQELGHTV
SYY_PASMU       -------------KRGVDEILSEADLIEKLKENRPLRVKLGADPTAPDIHLGHTVVLNKLRQFQQFGHEV
SYY_SALRD       -----------------------------------LTVKLGCDPSRPDLHLGHTVVLRKLRQFQDFGHRA
SYY_AZOSE       ----------------------------------------GFDPTAPDLHLGHTVLLNKLRHFQELGHQV
SYY_CARHZ       ---------------------------------------LGLDPTAPDIHLGHTVVLQKLKQFQSLGHEV
SYY_HAEIN       -------------KRGTDEILSEADLIEKLKENRPLKVKLGADPTAPDIHLGHTVVLNKLRQFQQLGHEV
SYY_MANSM       -------------KRGVDEVLSEADLIEKLKENRPLKIKLGADPTAPDIHLGHTVVLNKLRQFQNFGHEV
SYY_MOOTA       ---------------------------------------LGLDPTAPDIHLGHTVVLQKLRQFQELGHQV
SYY_IDILO       -----------------------------------LTVKAGFDPTAPDLHLGHTVLINKLRVFQDFGHKV
SYY2_PSEAE      -----------------------QRGADEILVEAELVAKLGFDPTAPDLHLGHTVLINKLRQFQDLGHQV
SYY_BURS3       ---------------------------------------LGLDPTAPDIHIGHTVVLNKMRQLQDLGHTV
SYY_THEMA       -------------KRNVVDLISEEELLDRIKRKGKLRVKLGVDPSRPDLHLGHAVVLRKLREFQDLGHTV
SYY_HAEI8       -------------KRGTDEILSEADLIEKLKENRPLKVKLGADPTAPDIHLGHTVVLNKLRQFQQLGHEV
SYY_DEHSC       ----------------------------------------GFDPSSPDIHLGHMVALRKLRQLQDLGHQV
SYY_BURPS       -----------LIEEEFAQKLAKSAATDK-----PLRIKLGLDPTAPDIHLGHTVVLNKMRQLQDLGHTV
SYY_HAHCH       -----------LIKRGAEEIIQEEGLIEKLKRGEPLRIKAGFDPTAPDLHLGHTVLINKLRQFQDLGHQV
SYY_GEOMG       ----------------------------------------GFDPTAPDLHLGHTVLLHKMRQFQQLGHEV
SYY_BURMA       ----------------------DELLIEEEFAQKLAKSALGLDPTAPDIHLGHTVVLNKMRQLQDLGHTV
SYY_BURTA       ----------------------DELLIEEEFAQKLARSALGLDPTAPDIHLGHTVVLNKMRQLQDLGHTV
SYY_HAEDU       -------------KRGVENIYSEEDLIAKLKENRPLRIKLGADPTAPDIHLGHTVVINKLRQFQQLGHEV
SYY_PHOPR       -------------KRGIDELIPEEELIAKLKENRPLRIKLGADPTAPDIHLGHTVILNKLRTFQELGHDV
SYY_BURP1       -----------LIEEEFAQKLAKSAATDK-----PLRIKLGLDPTAPDIHLGHTVVLNKMRQLQDLGHTV
SYY_SYNJB       ---------------------------------------LGIDPTRPDLHLGHSVVLRKLRQFQDAGHVA
SYY_BORPE       ---------------------------------------LGLDPTAPDIHLGHTVVLNKMRQLQDLGHNV
SYY_BORBR       ---------------------------------------LGLDPTAPDIHLGHTVVLNKMRQLQDLGHNV
SYY_SHEON       ---------------------------------------LGADPTAPDIHLGHTVILNKLRLFQELGHEV
SYY_COXBU       -------------KRGAVEIIHEDELLSRLAEEKPLRIKLGFDPTAPDIHLGHTVVLNKLRQFQTLGHEV
SYY_BORPA       ---------------------------------------LGLDPTAPDIHLGHTVVLNKMRQLQDLGHNV
SYY_WOLSU       ---------------------------------ETFSIKAGFDPTAPDLHLGHTVLIQKMATFQKHGAIV
SYY_SYNP6       ---------------------------------------LGIDPTGSDIHLGHSIIFRKLRQFQDAGHTA
SYY_SYNE7       ---------------------------------------LGIDPTGSDIHLGHSIIFRKLRQFQDAGHTA
SYY_HELPJ       ----------------------------------------GFDPTAPDLHLGHTVLIQKLALLQQYGARV
SYY_ACIAD       -----------LIQRGTHEIISEEDLLKKLKENRPLRIKAGFDPTAPDLHLGHTVLINKLKAFQDLGHEV
SYY_PSYA2       -----------LIQRGAQEILSEEDLVKKLKLNRPLRIKAGFDPTAPDLHLGHTVLINKLKHFQDLGHEI
SYY_GLOVI       -------------------------------ARMPLRVKLGIDPTRPDLHLGHTVVLRKLREFQDLGHTA
SYY2_CLOAB      ---------------------------------------LGLDPSAPDIHLGHAVVLRKLKQLQDLGHKI
SYY_METCA       ----------------------------------------GFDPTAPDLHLGHTVLLNKLKQFQDLGHET
SYY_SULDN       -------------------EIIDEPRVEKLFEKETYTVKAGFDPTAPDLHLGHTVLLQKLAIFQKYGARV
SYY_PSESM       ----------------------------------------GFDPTAPDLHLGHTVLINKLRQFQDLGHQV
SYY_HELHP       ----------------------------------------GFDPTAPDLHLGHTVLLQKLATFQRYGGDV
SYY_DEIRA       -------------KRGVVDLVSEEDLKRKIEKGEPLRVKLGADPTRPDLHLGHAVILRKMRQFQDLGHKV
SYY_COLP3       ----------------------------------------GFDPTAPDLHLGHTVLINKLRQFQQLGHEV
SYY_AQUAE       ----------------------------------------GFDPTAPDLHLGHVVLLQKLRQFQQLGHEV
SYY_NITMU       ----------------------------------------GFDPTAPDLHLGHTVLLNKMRHLQDLGHHA
SYY_DESVH       ----------------------------------------GFDPTAPDLHLGHTVLIHKLRHFQELGHTV
SYY_XANOR       --------------------------LDQLEARLTLRVKAGFDPTAPDLHLGHTVLLNKMRQFQQLGHQV
SYY_XANOM       --------------------------LDQLEARLTLRVKAGFDPTAPDLHLGHTVLLNKMRQFQQLGHQV
SYY_SYNJA       ---------------------------------------LGIDPTRPDLHLGHAVVLRKLRQFQDAGHVA
SYY_DEHE1       ----------------------------------------GFDPSSPDIHLGHMVALRKLRQLQDLGHQV
SYY_PSEU2       ----------------------------------------GFDPTAPDLHLGHTVLINKLRQFQDLGHQI
SYY_HELPY       ----------------------------------------GFDPTAPDLHLGHTVLIQKLALLQQYGARV
SYY_PSE14       ----------------------------------------GFDPTAPDLHLGHTVLINKLRQFQDLGHQI
SYY_PSEPK       ----------------------------------------GFDPTAPDLHLGHTVLINKLRQFQDLGHQV
SYY_FRATT       ----------------------------------------GCDPTAPDIHLGHTVVINKLKQLQDLGHKI
SYY_XANCP       ----------------------------------------GFDPTAPDLHLGHTVLLNKMRQFQELGHQV
SYY_XANC8       ----------------------------------------GFDPTAPDLHLGHTVLLNKMRQFQELGHQV
SYY_BDEBA       --------------------INDEDMLKKLKTKKPLNIKLGADPTRPDIHLGHTVVINKLKTFQDLGHKV
SYY_RALSO       ---------------------------------------LGLDPTAPDIHIGHTVVLNKMRQLQDLGHQV
SYY2_BACSU      ---------------------------------------LGLDPSAPDVHLGHTVVLNKLRQFQENGHIV
SYY2_BACLD      ---------------------------------EPLKIKLGLDPSAPDVHLGHTVVLNKLRQFQENGHIV
SYY_LEGPH       ----------------------------------------GFDPTAPDLHLGHTVLLNKLRQFQQFGHEV
SYY_PSEPF       -----------LIKRGAEELLVESELIEKLKRGQPLRIKAGFDPTAPDLHLGHTVLINKLRQFQELGHQV
SYY2_VIBCH      -------------KRGVEELIPEEELIAKLKENRPLRIKLGADPTAPDIHLGHTVILNKLRTFQDLGHDV
SYY_LEGPL       ----------------------------------------GFDPTAPDLHLGHTVLLNKLRQFQQFGHEV
SYY_CHLTE       ---------------------------------------LGADPSRPDLHLGHSVVLRKLREFQDLGHEA
SYY_PELLD       ---------------------------------------LGADPSRPDLHLGHSVVLRKLREFQDLGHEA
SYY_LEGPA       ----------------------------------------GFDPTAPDLHLGHTVLLNKLRQFQQFGHEV
SYY2_VIBVY      -------------KRGVEELIPEEELIAKLKEGRPLRIKLGADPTAPDIHLGHTVILNKLRAFQDLGHDV
SYY_THIFE       ---------------------------------------LGMDPTAPDLHLGAYVLLHKARQFQDLGHRL
SYY_RALEJ       ---------------------------------------LGLDPTAPDIHIGHTVVLNKLRQLQDLGHQV
SYY2_VIBVU      -------------KRGVEELIPEEELIAKLKEGRPLRIKLGADPTAPDIHLGHTVILNKLRAFQDLGHDV
SYY2_VIBPA      -------------KRGVEELIPEEELIAKLKEGRPLRIKLGADPTAPDIHLGHTVIFNKLRLFQELGHEV
SYY_BORA1       ---------------------------------------LGLDPTAPDIHLGHTVVLNKMRQLQDLGHTV
SYY_PSEF5       -----------LIKRGAEELLVESELIEKLKRGEPLRIKAGFDPTAPDLHLGHTVLINKLRQFQDLGHQV
SYY_NITEU       -----------LIRRGCQELLIEEEFAQKLAQGRPLRVKAGFDPTAPDLHLGHTVLLNKLRQLQDLGHHI
SYY2_PSEHT      ----------------------------------------GFDPTAPDLHLGHTVLINKMKTFQDLGHEV
SYY_LEPIN       ----------------------------------------GFDPTAPDLHLGHFVQLKKLKHFQDLGHEV
SYY_LEPIC       ----------------------------------------GFDPTAPDLHLGHFVQLKKLKHFQDLGHEV
SYY_CHLCH       ---------------------------------------LGADPSRPDLHLGHSVVLRKLRDFQDLGHHA
SYY_ANAVT       ----------------------------------------GIDPTGADIHLGHSIPMRKLRGFQDAGHTA
SYY_THICR       ----------------------------------------GFDPTAPDLHLGHTVLINKLRQFQDLGHEI
SYY_ANASP       ----------------------------------------GIDPTGADIHLGHSIPMRKLRGFQDAGHTA
SYY_XYLFT       ----------------------------------------GFDPTSPDLHLGHTVLLNKMRQFQDLGHQV
SYY_THEEB       ----------------------------------------GIDPTGSEIHLGHSIVLRKLRQFQDAGHCA
SYY_XANC5       --------------------------LDQLQARKPLRVKAGFDPTAPDLHLGHTVLLNKMRQFQQLGHQV
SYY_XANAC       --------------------------LDQLQARKPLRVKAGFDPTAPDLHLGHTVLLNKMRQFQQLGHQV
SYY_XYLFA       ----------------------------------------GFDPTAPDLHLGHTVLLNKMRQFQELGHQV
SYY_SYNS9       ---------------------------------------LGIDPTGSNIHLGHSILFRKLRAFQDAGHIA
SYY_PROMM       ---------------------------------------LGIDPTGRDIHLGHSILFRKLRAFQDAGHTA
SYY_CAMJE       ----------------------------------------GFDPTAPDLHLGHSVVLTKMAFLQKHGAIV
SYY_SYNPX       ---------------------------------------LGIDPTGSNIHLGHSILFRKLRAFQDAGHTA
SYY_PROM9       -------------------------GIDQTFSEKKLRVKLGIDPTGTDIHLGHSILFKKLRAFQDNGHIA
SYY_CAMJR       ----------------------------------------GFDPTAPDLHLGHSVVLTKMAFLQKHGAIV
SYY_SYNSC       ---------------------------------------LGIDPTGSNIHLGHSILFRKLRAFQDGGHTA
SYY_SYMTH       ---------------------------------------LGIDPTGKDLTLGHTVPLRKLRDFVECGHQG
SYY_PROMT       --------------------------------KKPLRVKLGIDPTGTDIHIGHSILFRKLRAFQDAGHTA
SYY_PROMP       --------LRGIEERNFDQTLSSKIN-DANKSKSKLRVKLGIDPTGTDIHLGHSILFKKLRAFQDNGHVA
SYY_PROMA       ---------------------------------------LGIDPTGSEIHLGHSIIFRKLRAFQDAGHTA
SYY_THET8       -------------KRGAEEIVPEEELLAKLKEGRPLTVKLGADPTRPDLHLGHAVVLRKMRQFQELGHKV
SYY_THET2       -------------KRGAEEIVPEEELLAKLKEGRPLTVKLGADPTRPDLHLGHAVVLRKMRQFQELGHKV
SYY2_PHOLL      -----------------------------------LTIKLGFDPTAPDLHLGHAVVLQKLKDFQDEGHRI
SYY2_PYRAE      ------------------------------------SAYLGFEPLWP-IHIGWLIWAYKLAELKEAGFDV
SYY_METMA       --------------------------------KETPRAYVGYEP-SGKIHMGHVLTVNKLIDLQKAGFKI
SYY_METBF       -------------------------------------AYVGYEPSGK-IHMGHVLTVNKLIDLQKAGFEI
SYY_ARCFU       --------------------------------KEKPRAYVGYEPSGE-IHLGHMMTVQKLMDLQEAGFEI
SYY_METAC       --------------------------------KEAPRAYVGYEPSGK-IHMGHVLTVNKLIDLQKAGFKI
SYY_METJA       -------------------EIISEEELREVLKKDEKSAYIGFEP-SGKIHLGHYLQIKKMIDLQNAGFDI
SYY_METS3       -----------LIEKGTLEVIDTEE-LKEVLKKEQPIAYTGYEP-SGKIHLGHAVTVQKLKTLQKLG---
SYY_METVS       --------------------------MNELLKKEEKIAYIGFEPSGK-IHLGHYLQIKKMIDLQKAGFKI


                         .         .         *         .         .         .         .:140
query           ISLMGGGTGMVGDPSFKEEARKLMTIDMIEDNITSLKHVFANYLDYDRAENPALMINNADWLRGLNYLEF
SYY_AGRT5       ISLMGGGTGMVGDPSFKEEARKLMTIDMIEDNITSLKHVFANYLDYDRAENPALMINNADWLRGLNYLEF
SYY_BRUSU       VALMGGGTGMVGDPSFKDEARKLMTEDTIAENMASIKRVFANYLTFGDGANDALMVNNGEWLRNINYLEF
SYY_BRUME       VALMGGGTGMVGDPSFKDEARKLMTEDTIAENMASIKRVFANYLTFGDGANDALMVNNGEWLRNINYLEF
SYY_BRUAB       VALMGGGTGMVGDPSFKDEARKLMTEDTIAENMASIKRVFANYLTFGDGANDALMVNNGEWLRNINYLEF
SYY_BRUA2       VALMGGGTGMVGDPSFKDEARKLMTEDTIAENMASIKRVFANYLTFGDGANDALMVNNGEWLRNINYLEF
SYY_RHIME       ISLMGGGTGMVGDPSFKDEARQLMTPETIAANIASIKTVFSNYLRYGDGPKDALMINNADWLLGINYLEF
SYY_RHILO       IALMGGGTSMIGDPSFRDDQRSLLTPEAIATNIEGIKRIFGRILRFGDGPNDAIMVNNADWLMKLNYVEF
SYY_BARHE       IVLMGGGTGLIGDPSFKDEARRLLTQDDIAANIADIKKVFARYLTFGERETDSCIVNNAEWLCTLNYLEF
SYY_BARQU       IALMGGGTGLIGDPSFKDEARPLLTQDDIATNIVSIKKVFANYLTFGEKETDACIINNAEWLCKLNYLEF
SYY_NITWN       IALMGGGTTRVGDPSGRDETRKILSYDQIDANKESIKGTFLKFLVFGDGKNDAIMTDNAEWLTRLNYIEM
SYY_RHOPA       IALMGGGTTRVGDPSGRDETRKILTYEQIDANKESIKGTFSKFIKFGDGHSDALMADNAEWLTKLNYIEM
SYY_BRAJA       ITLMGGGTTMVGDPSGKDETRAMRTVAEIEANKESIRGVFAKVLRYGDGKSDAVMLDNAEWLTKLNWIEM
SYY_METSB       IALMGGGTTQVGDPSGKDESRKILSLETIEANKAGIASVFSKFIAFGDGKTQALMVDNAEWLTALKYVDF
SYY_XANP2       IALMGGGTTKIGDPSGKDEARKMLTDQQIEDNIASIRKVFARFLDFGAG---AKMENNASWLDELKYIPL
SYY_MAGSA       IVLMGGGTTRIGDPTGKDESRKMLTDEVIATNMAGIKTVFTKYLTFGEGKTDALMVNNADWLDKLNYIDF
SYY_BEII9       IVLMGGGTTRVGDPSGKDESRKILTLEEIEANKQGIKQVFSKFVHFGEGKTDALMADNAEWLTALHYIDF
SYY_SILST       ITLMGGGTTKVGDPSFRSDERPLLGPEQIDANIAGMQKVFAKYLDYSDAKNGAMMLNNAEWLDGLNYLEF
SYY_DINSH       ITLMGGGTTKVGDPSFRSDERPLLGAEQIDANIAGMKQVFSSYLTYGDGPTDALMLNNAEWLDGLNYLEF
SYY_RHOS5       ITLMGGGTTKVGDPSFRSEERPLLTPEKIDANIAGMKQVFARYLDYSDGATGALMLNNAEWLDSLNYLDF
SYY_SILPO       ITLMGGGTTKVGDPSFRADERPLLTPAQIDDNIAGIRKVFAAYIDYDSAENAALMLNNEEWLDDLNYLDF
SYY_RHOS4       ITLMGGGTTKVGDPSFRSEERPLLTPDRIDENIEGMRKVFARYLSYGEGATDALMLNNAEWLDQLNYLDF
SYY_PARDP       ITLMGGGTTKVGDPSFRSEERPLLTPDKIDENIAGMKQVFARYLDY--GDQGAMMLNNAEWLDSLNYLDF
SYY_RHOSK       ITLMGGGTTKVGDPSFRSEERPLLTPDKIDENIEGMRKVFARYLSYGEGATDALMLNNAEWLDHLNYLDF
SYY_RHOS1       ITLMGGGTTKVGDPSFRSEERPLLTPDRIDENIEGMRKVFARYLSYGEGATDALMLNNAEWLDQLNYLDF
SYY_RHORT       VVLMGGGTTRIGDPSFRDEARPLLTDEKIGQNMAGIRQVFSRFLSFGEGATDAVMVNNADWLDGLAYIPF
SYY_ROSDO       LTLMGGGTTKVGDPSFRADERPLLGPEAIDDNIAGIKQVFSAYIDYSDAPTGALMLNNAEWLDNLNYLDF
SYY_NOVAD       IVLMGGGTGKIGDPSFKDEARKLMTNDVIAANVASIKTVFERFLTFGDGPTDAVMVDNADWLDRLEYIPF
SYY_CAUSK       IVLMGGGTTKVGDPTGKDESRKLLSDADIAANIAGIKQVFAKFLTFGDGPTDAIMVDNDVWLSKFGYVQF
SYY_ZYMMO       IVLMGGGTGKIGDPSFKDEARKLLDEDTIKANIASIKRVFEHFLHFGDGENDAVMVDNAEWLDRLEYIPF
SYY_GLUOX       IALMGGGTAKIGDPSFRDEARSLITNETIAHNIAGIEKSLRQFITFSDEDSGAILANNADWLDKLSYINL
SYY_WOLPP       IVLLGGGTTKIGDPSGKDKARSVLPIEDINQNILGIKKTLEKMISFDYGKTGAIIVNNADWLDNIKYIDF
SYY_WOLTR       IVLLGGSTTKIGDPSGKDKARSVLPIEDINQNISGIKKALKKMVYFNDGKAGAIIVNNADWLDSIKYIDF
SYY_RICBR       IVIIGGGTSKIGDPSGKDEARKTITKEDIARNAEGIKKSLSKFIKFGDGESDAIMLDNAEWLDSLYYLDF
SYY_CAUCR       IVLMGGGTTKVGDPTGKDESRKLLSDADIQANIAGIKTVFSKFLTFGDGPTDAIMVDNDVWLSKFGYVQF
SYY_CAUCN       IVLMGGGTTKVGDPTGKDESRKLLSDADIQANIAGIKTVFSKFLTFGDGPTDAIMVDNDVWLSKFGYVQF
SYY_WOLWR       IVLLGGGTTKIGDPSFKDKARSILPVENINQNTSSIRRILEKMVSFNDSKTGAMIVNNADWLDNIKYIDF
SYY_WOLPM       IVLLGGGTTKIGDPSFKDKARSILPVENINQNTSSIRRILEKMVSFNDSKTGAMIVNNADWLDNIKYIDF
SYY_RICAH       IVIIGGGTSKIGDPTWKDEARKILSKEDIAKNAKGIKKSLSKFIKFGDGKSDAIMFDNVEWLDSLNYLEF
SYY_RICFE       IVIIGGGTSKIGDPTWKDEARKILSKEDIAKNAEGIKKSLSKFIKFGEGESDAIMLDNAEWLDSLNYLDF
SYY_RICTY       IVIIGGGTSKIGDPSGKEVTRKALTQEDIKRNTAGIKKSLSKFIKFGKDQGDAIILDNAEWLDSLNYLDF
SYY_RICRS       IVIIGGGTSKIGDPTWKDEVRKILSKEDIAKNAEGIKKSLSKFIKFGDGKSDAIMLDNAEWLDSFNYLDF
SYY_RICRO       IVIIGGGTSKIGDPTWKDEVRKILSKEDIAKNAEGIKKSLSKFIKFGDGKSDAIMLDNAEWLDSFNYLDF
SYY_RICCN       IVIIGGGTSKIGDPTWKDEVRKILSKEDIAKNAEGIKKSLSKFIKFGDGKSDAIMLDNAEWLDSFNYLDF
SYY_RICPU       IVIIGGGTSKIGDPTWKDEVRKILSKEDIAKNAEGIKKSLSKFIKFGDGKSDAIMLDNAEWLDSFNYLDF
SYY_RICM5       IVIIGGGTSKIGDPTWKDEVRKILSKEDIAKNAEGIKKSLSKFIKFGDGKSDAIMLDNAEWLDSFNYLDF
SYY_EHRCJ       IVLLGNGTTKIGDPSGKDKSRTMLCSDEIEENALGIYDVLKKFIKFGSGSTDGLLVCNAEWLDDLNYIEF
SYY_RICAE       IVIIGGGTSKIGDPTWKDEVRKIVSKEDIAKNAEGIKKSLSKFIKFGDGKSDAIMLDNAEWLDSFNYLDF
SYY_RICCK       IVIIGGGTSKIGDPTWKDEARKILSKEEIAKNAEGIKKSLSKFIKFGEESSDAIMLDNSEWLDSLNYLDF
SYY_EHRRW       IVLLGNGTTKIGDPSGKDKSRTLLSSSDIQENTLGIRKVLEKFIVCGGGVSDALLVYNAEWLDKLNYIDF
SYY_RICPR       IVIIGGGTSKIGDPAGKDVTRKALTQEDIKRNAEGIKKSLSKFIKFGKDQGDAIILDNAEWLDSLNYLDF
SYY_PELUB       IVLLGGGTTRIGDPSGKDKTRTILSXXXXXXXXXXXXXXXXXFLDDKDPETKPIFVNNYTWLKNLNYISF
SYY_EHRRG       IVLLGNGTTKIGDPSGKDKSRTLLSSSDIQENTLGIRKVLEKFIVCGDGVSDALLVYNAEWLDKLNYIDF
SYY_ANAPZ       IVLLGGATTKVGDPSGKEKTRAMLSEDNISANKEGILRVIKKFLSED-----VVVVDNAEWLGNYGYLDF
SYY_DESOH       IALVGGGTGLVGDPSGKTEMRQLITPETVEANIEGIQRQLSRFIDFDGGK--ALLVNNADWLTGLEYIPF
SYY_CLOTE       IALVGGGTVRIGDPSGKSEMRKMLSKEAIDKNVSSIKSQISRFIDF--SDDKAILVDNADWLLNLNYLEF
SYY_PSEA7       LLLIGGATTRIGDPSFRDSSRPILGEAQIQANIDGIVRVFSRYVALDEGS----LVNNAEWLDGVGYLEF
SYY_CLOK5       IALLGGGTAMIGDPTGKTDMRKMLSREQIQHNADCFKKQFSKFIDFE--DEKAIMANNADWLMNLNYVNF
SYY_CLOK1       IALLGGGTAMIGDPTGKTDMRKMLSREQIQHNADCFKKQFSKFIDFE--DEKAIMANNADWLMNLNYVNF
SYY1_CLOAB      IVLIGGGTAMVGDPTGKTDMRKMLTREEINHNVECLKKQMSRFIDF--SDDKAIIVNNAEWLMGQNYIEF
SYY_CLOTH       IALIGGGTAMVGDPTGRTDMRKMMTREEIKHNADCFKKQLSKFIEF--GEGKAIMVDNADWLLDLNYIEF
SYY_EHRCR       IILLGDGTTKIGDPSGKDKSRAMLSASEIEENALGIYEVLKKFIVFGDGPHDALLVRNAEWLNGLNYIEF
SYY_CLOBA       IALLGGGTAMVGDPSGKTDMRKMLTKEQIQHNVDSIKKQMERFIDF--SDDKALIVNNADWLLDLNYVDF
SYY_CLOBB       IALLGGGTAMVGDPSGKTDMRKMLTKEQIQHNVDSIKKQMERFIDF--SDDKALIVNNADWLLDLNYVDF
SYY_CLOPH       IALLGGGTTMIGDPTGKSDMRSMMTRETIDHNAQCFQEQLSKFIDF--SDDKAIIANNADWLLNLNYVEF
SYY_FUSNN       IALAGGGTGMIGDPSGRSDMRTMMTVEMIDHNVECIKKQMQKFIDF--SEDKAILANNADWLRNLNYIEF
SYY_THETN       IVLLGGGTALIGDPSGRTDMRKMLTKEEIDRNAEAFKKQMERFIDF--SEGKAIMENNAKWLLGLNYIEF
SYY_PSEAB       LLLIGGATTRIGDPSFRDSSRPILTEAQIQANIDGIARVFSRYVEL----HDDSLVNNAEWLDGVGYLEF
SYY_DESAA       IALVGGGTGLVGDPSGKTEMRKLLTLEDVNNNAEGIRAQLARFIDFDKG---AVQENNANWLVGLKYIEF
SYY_PSEA8       LLLIGGATTRIGDPSFRDSSRPILTEAQIQANIDGIARVFSRYVEL----HDDSLVNNAEWLDGVGYLEF
SYY1_PSEAE      LLLIGGATTRIGDPSFRDSSRPILTEAQIQANIDGIARVFSRYVEL----HDDSLVNNAEWLDGVGYLEF
SYY_SYNAS       IALVGGGTALIGDPSGKTEMRQILTREKIELNATCMRRQFARYLSFE--DKKAMMINNADWLTKLNYISF
SYY_ANAMM       VVLLGGGTTKIGDPSGKDKARAMLSEAEIAANKAGILATINKFLNQG---DGVVIADNAEWLGEVRYLEF
SYY_CLOPE       XXXXXXXXXXXXDPSGKTDMRKMMTNETIAHNVACIKKQMEKFIDF--SDDKAILVNNADWLLNQNYVEF
SYY_CLOPS       XXXXXXXXXXXXDPSGKTDMRKMMTNETIAHNVACIKKQMEKFIDF--SDDKAILVNNADWLLNQNYVEF
SYY_CLOP1       XXXXXXXXXXXXDPSGKTDMRKMMTNETIAHNVACIKKQMEKFIDF--SDDKAILVNNADWLLNQNYVEF
SYY_TREDE       VVLVGGGTSRIGDPSGKTEMRKMLSYDELDKNAASIQKQIEKFLAKDIKN--VRFVNNKDWLADLNYIDF
SYY_DECAR       IALVGGATGMIGDPSFKATERKLNTPDVIASWVGKIRGQVEPFLKFDGA-NAAIMANNYDWFGGMNCLEF
SYY_CLOB6       IALVXXXXXXXXXXXXKTDMRKMMTKEQIEYNCNCFKKQLAKIIDF--SEDKAIMVNNADWLLNLNYIEF
SYY_CLOBM       IALVXXXXXXXXXXXXKTDMRKMMTKEQIEYNCNCFKKQLAKIIDF--SEDKAIMVNNADWLLNLNYIEF
SYY_ORITI       IVVIGGATTKIGDPSEKDKLRRIITNDEIQQNISGIKRSLKKFIKFDETKNDVLLLNNQEWLDSINYINF
SYY_CLOBK       IALVXXXXXXXXXXXXKTDMRKMMTKEQIEHNCNCFKKQLAKIIDF--SEDKAIMVNNADWLLNLNYIEF
SYY_ORITB       IVVIGGATTKIGDPSEKDKLRRIITNDEIQQNISGIKRSLQKFIKFDETKNDVLLLNNQEWLDSINYINF
SYY_CLOBH       IALVXXXXXXXXXXXXKTDMRKMMTKEQIEHNCNCFKKQLAKIIDF--SEDKAIMVNNADWLLNLNYIEF
SYY_CLOB1       IALVXXXXXXXXXXXXKTDMRKMMTKEQIEHNCNCFKKQLAKIIDF--SEDKAIMVNNADWLLNLNYIEF
SYY_CLOBL       IALVXXXXXXXXXXXXKTDMRKMMTKEQIEHNCNCFKKQLAKIIDF--SEDKAIMVNNADWLLNLNYIEF
SYY_CLOBJ       IALVXXXXXXXXXXXXKTDMRKMMTKEQIEHNCNCFKKQLAKIIDF--SEDKAIMVNNADWLLNLNYIEF
SYY_CLOB8       IALIGGGTAMVGDPSGKTDMRKMLTKEDIQHNVDSIKKQMERFIDF--SDGKXXXXXXXXXXXXXXYVDF
SYY2_ENTFA      IALVGGGTGMIGDPSFKDAERSLNTLDTVKAWSESIKGQLSRFIDFEDEKNPAILANNYDWLGELSLIDF
SYY_CHRVO       VALVGGATGMIGDPSFKAAERKLNTPDVIEGWVEKIRKQVEPFLSFE-GENAAVMANNYDWFGKMNALEF
SYY_BACV8       LALVGGATGMIGDPSGKSQERNLLTEETLRHNVACIKKQLAKFLDFESAPNKAELVNNYDWMKDFTFLDF
SYY_BORAP       IVLIGDSTTKIGDPSGKSEMRKILSLEEISNNAFSIK----NQLQRITKFSSKCFIHNSNWLDNLNYIEF
SYY_NEIMB       IALVGGATGMIGDPSFKAAERSLNSAETVAGWVESIRNQLTPFLSFEGG-NAAIMANNADWFGSMNCLDF
SYY_BACFR       LALIGGATGMIGDPSGKSAERNLLDEETLRHNQACIKKQLAKFLDFESAPNRAELVNNYDWMKEFTFLDF
SYY_BACFN       LALIGGATGMIGDPSGKSAERNLLDEETLRHNQACIKKQLAKFLDFESAPNRAELVNNYDWMKEFTFLDF
SYY_NEIMA       IALVGGATGMIGDPSFKAAERSLNSAETVAGWVESIRNQLTPFLSFEGG-NAAIMANNADWFGKMNCLDF
SYY_NEIMF       IALVGGATGMIGDPSFKAAERSLNSAETVAGWVESIRSQLTPFLSFEGG-NAAIMANNADWFGKMNCLDF
SYY1_BACSU      IALVGGATGLIGDPSGKKAERTLNTADIVSEWSQKIKNQLSRFLDFEAAENPAVIANNFDWIGKMNVIDF
SYY1_BACC1      IALVGGGTGMIGDPSGKKAERTLNTKDTVAYYTESIKNQLSNFLEFENVDNPATMANNYDWLGNLDVISF
SYY1_VIBPA      VALIGGATGMIGDPSFKATERSLNSAEIVSGWVNDLSNQIQQLMNHQLSK-PMIMVNNADWMRAINVIDF
SYY1_BACHK      IALVGGGTGMIGDPSGKKAERTLNTKDTVAYYTESIKNQLSNFLEFENVENPATMANNYDWLGNLDVISF
SYY1_BACCZ      IALVGGGTGMIGDPSGKKAERTLNTKDTVAYYTESIKNQLSNFLEFENVENPATMANNYDWLGNLDVISF
SYY1_BACAN      IALVGGGTGMIGDPSGKKAERTLNTKDTVAYYTESIKNQLSNFLEFENVENPATMANNYDWLGNLDVISF
SYY_RHOBA       IALVGGATGMIGDPSGKSEERNLLSADQLQKNVDGVAAQMRHFLDFE-GDNAAKLLNNFDWMKDYSYLEF
SYY_NEIM0       IALVGGATGMIGDPSFKAAERSLNSAETVAGWVESIRNQLTPFLSFEGG-NAAIMANNADWFGKMNCLDF
SYY_BORBZ       IVLIGDSTAKIGDPSGKSEMRKILSSEEIGNNALLIK----NQLQRITKFTSECFIHNSNWLDNLNYIEF
SYY_BORBU       IVLIGDSTAKIGDPSGKSEMRKILSSEEIGNNALLIK----NQLQRITKFTSECFIHNSNWLDNLNYIEF
SYY_BACA2       IALVGGATGLIGDPSGKKAERTLNTQDIVVEWSQKIKNQLSRFLDFEAGENPAVIANNFDWIGKLSIIEF
SYY_STACT       IVLIGGGTGMIGDPSGKTDERVLQTEEQVEQNVRGIGNQMDKIFDFSGKE-AAQLVNNRDWLGKISLIDF
SYY_NEIG2       IALVGGATGMIGDPSFKAAERSLNSAETVAGWVGSIRSQLTPFLSFEGG-NAAIMANNADWFGSMNCLDF
SYY_NEIG1       IALVGGATGMIGDPSFKAAERSLNSAETVAGWVGSIRSQLTPFLSFEGG-NAAIMANNADWFGSMNCLDF
SYY1_BACCR      IALVGGGTGMIGDPSGKKAERTLNTKDTVAYYTESIKNQLSNFLEFENVDNPATMANNYDWLGNLDVISF
SYY_BORGA       IVLIGDSTTKIGDPSGKSEMRKILSSEVINNNALSIK----NQLQKITRFSSSCFIHNSNWLDNLNYIEF
SYY_BACST       IALVGGATGLIGDPSGKKSERTLNAKETVEAWSARIKEQLGRFLDFEADGNPAKIKNNYDWIGPLDVITF
SYY_BORHD       IALVGGGTTKIGDPSGKDVMRKILPKEDIEANVKAIKEQLLRIIDFSHG----YIIDNSEWLDNINYIEF
SYY1_BACLD      IALVGGATGLIGDPSGKKAERTLNNEEIVREWSQKIKNQLSRFLDFEAEENPAIMANNYDWIGKMNVIDF
SYY_GEOKA       IALVGGATGLIGDPSGKKSERTLNAKETVEAWSARIKEQLGRFLDFEADGNPAKIKNNYDWIGPLDVITF
SYY_BACCA       IALVGGATGLIGDPSGKKSERTLNAKETVEAWSARIKEQLGRFLDFEADGNPAKIKNNYDWIGPLDVITF
SYY_PECCP       VALVGGATGLIGDPSFKATERKLNTADTVGEWVEKIRRQVSPFLDFDCGKNSAIAANNYDWFGGMNVLDF
SYY_ALISL       LALVGGATGLIGDPSFKAAERQLNTSDVVGDWVNKIRAQVSAFVDFNESKNGAEVVNNLDWIGEINVIEF
SYY_YERPY       VALVGGATGMIGDPSFKASERKLNTEDTVNEWVEKIRHQVSPFLDFDCGENSAIAANNYDWFGGMNVLTF
SYY_YERPS       VALVGGATGMIGDPSFKASERKLNTEDTVNEWVEKIRHQVSPFLDFDCGENSAIAANNYDWFGGMNVLTF
SYY_YERPP       VALVGGATGMIGDPSFKASERKLNTEDTVNEWVEKIRHQVSPFLDFDCGENSAIAANNYDWFGGMNVLTF
SYY_YERPN       VALVGGATGMIGDPSFKASERKLNTEDTVNEWVEKIRHQVSPFLDFDCGENSAIAANNYDWFGGMNVLTF
SYY_YERPG       VALVGGATGMIGDPSFKASERKLNTEDTVNEWVEKIRHQVSPFLDFDCGENSAIAANNYDWFGGMNVLTF
SYY_YERPE       VALVGGATGMIGDPSFKASERKLNTEDTVNEWVEKIRHQVSPFLDFDCGENSAIAANNYDWFGGMNVLTF
SYY_YERPB       VALVGGATGMIGDPSFKASERKLNTEDTVNEWVEKIRHQVSPFLDFDCGENSAIAANNYDWFGGMNVLTF
SYY_YERPA       VALVGGATGMIGDPSFKASERKLNTEDTVNEWVEKIRHQVSPFLDFDCGENSAIAANNYDWFGGMNVLTF
SYY_YERP3       VALVGGATGMIGDPSFKASERKLNTEDTVNEWVEKIRHQVSPFLDFDCGENSAIAANNYDWFGGMNVLTF
SYY_SALEP       VALVGGATGLIGDPSFKAAERKLNTEETVQEWVAKIRKQVAPFLDFDCGENSAIAANNYDWFGSMNVLTF
SYY_BACTN       LALIGGATGMIGDPSGKSAERNLLNEETLRHNQACIKKQLAKFLDFESVPNRAELVNNYDWMKEFSFLDF
SYY_VIBFM       LALVGGATGLIGDPSFKAAERQLNTNEVVGDWVNKIKAQVSAFVDFTEEKNGAEVVNNLDWIGQINVIEF
SYY_VIBF1       LALVGGATGLIGDPSFKAAERQLNTNEVVGDWVNKIKAQVSAFVDFTEEKNGAEVVNNLDWIGQINVIEF
SYY_SALTY       VALVGGATGLIGDPSFKAAERKLNTEETVQEWVAKIRKQVAPFLDFDCGENSAIAANNYDWFGSMNVLTF
SYY_SALTI       VALVGGATGLIGDPSFKAAERKLNTEETVQEWVAKIRKQVAPFLDFDCGENSAIAANNYDWFGSMNVLTF
SYY_SALSV       VALVGGATGLIGDPSFKAAERKLNTEETVQEWVAKIRKQVAPFLDFDCGENSAIAANNYDWFGSMNVLTF
SYY_SALPK       VALVGGATGLIGDPSFKAAERKLNTEETVQEWVAKIRKQVAPFLDFDCGENSAIAANNYDWFGSMNVLTF
SYY_SALPC       VALVGGATGLIGDPSFKAAERKLNTEETVQEWVAKIRKQVAPFLDFDCGENSAIAANNYDWFGSMNVLTF
SYY_SALPB       VALVGGATGLIGDPSFKAAERKLNTEETVQEWVAKIRKQVAPFLDFDCGENSAIAANNYDWFGSMNVLTF
SYY_SALPA       VALVGGATGLIGDPSFKAAERKLNTEETVQEWVAKIRKQVAPFLDFDCGENSAIAANNYDWFGSMNVLTF
SYY_SALNS       VALVGGATGLIGDPSFKAAERKLNTEETVQEWVAKIRKQVAPFLDFDCGENSAIAANNYDWFGSMNVLTF
SYY_SALHS       VALVGGATGLIGDPSFKAAERKLNTEETVQEWVAKIRKQVAPFLDFDCGENSAIAANNYDWFGSMNVLTF
SYY_SALG2       VALVGGATGLIGDPSFKAAERKLNTEETVQEWVAKIRKQVAPFLDFDCGENSAIAANNYDWFGSMNVLTF
SYY_SALDC       VALVGGATGLIGDPSFKAAERKLNTEETVQEWVAKIRKQVAPFLDFDCGENSAIAANNYDWFGSMNVLTF
SYY_SALCH       VALVGGATGLIGDPSFKAAERKLNTEETVQEWVAKIRKQVAPFLDFDCGENSAIAANNYDWFGSMNVLTF
SYY_SALAR       VALVGGATGLIGDPSFKAAERKLNTEETVQEWVAKIRKQVAPFLDFDCGENSAIAANNYDWFGSMNVLTF
SYY_SALA4       VALVGGATGLIGDPSFKAAERKLNTEETVQEWVAKIRKQVAPFLDFDCGENSAIAANNYDWFGSMNVLTF
SYY_CITK8       VALVGGATGLIGDPSFKAAERKLNTEDTVQEWVDKIRKQVAPFLDFDCGDNSAIAANNYDWFGGMNVLTF
SYY_STAHJ       IVLIGGGTGMIGDPSGKSEERILQTEDQVEANVEGISAQMHKLFEFG-TDKGAILVNNKDWLSQISLISF
SYY_STRP4       YALVGGATGLIGDPSFKDAERSLQTKDTVDGWVKSIQGQLSRFLDFENGENKAVMVNNYDWFGSISFIDF
SYY_STRPS       YALVGGATGLIGDPSFKDAERSLQTKDTVDGWVKSIQGQLSRFLDFENGENKAVMVNNYDWFGSISFIDF
SYY_STRGC       YALVGGATGLIGDPSFKDAERSLQTKETVEGWVKSIQGQLAGLLDFENGQNKAEMVNNYDWFSDISFIDF
SYY_KLEP7       VALVGGATGLIGDPSFKAAERKLNTEDTVQEWVDKIRKQVAPFLDFDCGDNSAIAANNYDWFGSMNVLTF
SYY_STRZT       YALVGGATGLIGDPSFKDAERSLQTKDTVDGWVKSIQGQLSRFLDFENGENKAVMVNNYDWFGSISFIDF
SYY_STRPI       YALVGGATGLIGDPSFKDAERSLQTKDTVDGWVKSIQGQLSRFLDFENGENKAVMVNNYDWFGSISFIDF
SYY_SHIDS       VALVGGATGLIGDPSFKAAERKLNTEETVQEWVDKIRKQVAPFLDFDCGENSAIAANNYDWFGNMNVLTF
SYY_OPITP       IALAGGATGMVGDPSGRSAERNLLTPDQVAHNIASIKQQLGRFLDFDATTNPARMVDNSTWTAPISFLEF
SYY_ENTS8       VALVGGATGLIGDPSFKATERKLNTEDTVQEWVDKIRRQVAPFLDFDCGENSAIAANNYDWFGNMNVLTF
SYY_STRS2       YALVGGATGLIGDPSFKDAERSLQTKDTVDGWVTKIQGQLSRFLDFENGDNKAEMVNNYDWFSDISFIDF
SYY_DESHY       IALVGGGTGLIGDPSGKTSERTLNPTEVVQEWANRIKEQLSCFLDFEGVGNPAIMANNYEWLGTINVIEF
SYY_STRZP       YALVGGATGLIGDPSFKDAERSLQTKDTVDGWVKSIQGQLSRFLDFENGENKAVMVNNYDWFGSISFIDF
SYY_STRZJ       YALVGGATGLIGDPSFKDAERSLQTKDTVDGWVKSIQGQLSRFLDFENGENKAVMVNNYDWFGSISFIDF
SYY_STRR6       YALVGGATGLIGDPSFKDAERSLQTKDTVDGWVKSIQGQLSRFLDFENGENKAVMVNNYDWFGSISFIDF
SYY_STRPN       YALVGGATGLIGDPSFKDAERSLQTKDTVDGWVKSIQGQLSRFLDFENGENKAVMVNNYDWFGSISFIDF
SYY_STRPJ       YALVGGATGLIGDPSFKDAERSLQTKDTVDGWVKSIQGQLSRFLDFENGENKAVMVNNYDWFGSISFIDF
SYY_STRP2       YALVGGATGLIGDPSFKDAERSLQTKDTVDGWVKSIQGQLSRFLDFENGENKAVMVNNYDWFGSISFIDF
SYY1_STRT2      YALVGGATGLIGDPSFKDAERSLQTKETVEGWVEKIQGQLSRFLDFENGDNKAVMVNNYDWFGSVSFIDF
SYY1_STRT1      YALVGGATGLIGDPSFKDAERSLQTKETVEGWVEKIQGQLSRFLDFENGDNKAVMVNNYDWFGSVSFIDF
SYY_STRP7       YALVGGATGLIGDPSFKDAERSLQTKDTVDGWVKSIQGQLSRFLDFENGENKAVMVNNYDWFGSISFIDF
SYY_SHISS       VALVGGATGLIGDPSFKAAERKLNTEETVQEWVDKIRKQVAPFLDFDCGENSAIAANNYDWFGNMNVLTF
SYY_SHIB3       VALVGGATGLIGDPSFKAAERKLNTEETVQEWVDKIRKQVAPFLDFDCGENSAIAANNYDWFGNMNVLTF
SYY_ESCF3       VALVGGATGLIGDPSFKAAERKLNTEETVQEWVDKIRKQVAPFLDFDCGENSAIAANNYDWFGNMNVLTF
SYY_ECOUT       VALVGGATGLIGDPSFKAAERKLNTEETVQEWVDKIRKQVAPFLDFDCGENSAIAANNYDWFGNMNVLTF
SYY_ECOSM       VALVGGATGLIGDPSFKAAERKLNTEETVQEWVDKIRKQVAPFLDFDCGENSAIAANNYDWFGNMNVLTF
SYY_ECOSE       VALVGGATGLIGDPSFKAAERKLNTEETVQEWVDKIRKQVAPFLDFDCGENSAIAANNYDWFGNMNVLTF
SYY_ECOLU       VALVGGATGLIGDPSFKAAERKLNTEETVQEWVDKIRKQVAPFLDFDCGENSAIAANNYDWFGNMNVLTF
SYY_ECOLI       VALVGGATGLIGDPSFKAAERKLNTEETVQEWVDKIRKQVAPFLDFDCGENSAIAANNYDWFGNMNVLTF
SYY_ECOLC       VALVGGATGLIGDPSFKAAERKLNTEETVQEWVDKIRKQVAPFLDFDCGENSAIAANNYDWFGNMNVLTF
SYY_ECOL6       VALVGGATGLIGDPSFKAAERKLNTEETVQEWVDKIRKQVAPFLDFDCGENSAIAANNYDWFGNMNVLTF
SYY_ECOK1       VALVGGATGLIGDPSFKAAERKLNTEETVQEWVDKIRKQVAPFLDFDCGENSAIAANNYDWFGNMNVLTF
SYY_ECOHS       VALVGGATGLIGDPSFKAAERKLNTEETVQEWVDKIRKQVAPFLDFDCGENSAIAANNYDWFGNMNVLTF
SYY_ECODH       VALVGGATGLIGDPSFKAAERKLNTEETVQEWVDKIRKQVAPFLDFDCGENSAIAANNYDWFGNMNVLTF
SYY_ECOBW       VALVGGATGLIGDPSFKAAERKLNTEETVQEWVDKIRKQVAPFLDFDCGENSAIAANNYDWFGNMNVLTF
SYY_ECO8A       VALVGGATGLIGDPSFKAAERKLNTEETVQEWVDKIRKQVAPFLDFDCGENSAIAANNYDWFGNMNVLTF
SYY_ECO81       VALVGGATGLIGDPSFKAAERKLNTEETVQEWVDKIRKQVAPFLDFDCGENSAIAANNYDWFGNMNVLTF
SYY_ECO7I       VALVGGATGLIGDPSFKAAERKLNTEETVQEWVDKIRKQVAPFLDFDCGENSAIAANNYDWFGNMNVLTF
SYY_ECO5E       VALVGGATGLIGDPSFKAAERKLNTEETVQEWVDKIRKQVAPFLDFDCGENSAIAANNYDWFGNMNVLTF
SYY_ECO57       VALVGGATGLIGDPSFKAAERKLNTEETVQEWVDKIRKQVAPFLDFDCGENSAIAANNYDWFGNMNVLTF
SYY_ECO55       VALVGGATGLIGDPSFKAAERKLNTEETVQEWVDKIRKQVAPFLDFDCGENSAIAANNYDWFGNMNVLTF
SYY_ECO45       VALVGGATGLIGDPSFKAAERKLNTEETVQEWVDKIRKQVAPFLDFDCGENSAIAANNYDWFGNMNVLTF
SYY_ECO27       VALVGGATGLIGDPSFKAAERKLNTEETVQEWVDKIRKQVAPFLDFDCGENSAIAANNYDWFGNMNVLTF
SYY_ECO24       VALVGGATGLIGDPSFKAAERKLNTEETVQEWVDKIRKQVAPFLDFDCGENSAIAANNYDWFGNMNVLTF
SYY_DESHD       IALVGGGTGLIGDPSGKTSERTLNPTEVVQEWANRIKEQLSCFLDFEGVGNPAIMANNYEWLGTINVIEF
SYY_BORT9       IALVGGGTTKIGDPSGKDAMRKILSKEDIEKNVKAIRAQLLRIIDFSHG----YILDNSAWLDNINYIEF
SYY_STRPG       YALVGGATGLIGDPSFKDAERSLQTKETVLEWSDKIKGQLSTFLDFENGDNKAELVNNYDWFSQISFIDF
SYY_STAES       IVLIGGGTGMIGDPSGKSEERVLQTESQVEANVKGLSNQMHRLFEFG-SDKGAKLVNNKDWLGQISLISF
SYY_STAEQ       IVLIGGGTGMIGDPSGKSEERVLQTESQVEANVKGLSNQMHRLFEFG-SDKGAKLVNNKDWLGQISLISF
SYY_YERE8       VALVGGATGMIGDPSFKASERKLNTEDTVNEWVEKIRRQVSPFLDFDCGDNSAIAANNYDWFGGMNVLTF
SYY_STRTD       YALVGGATGLIGDPSFNDAERSLQTKETVEGWVEKIQGQLSRFLDFENGDNKAVMVNNYDWFGSVSFIDF
SYY_TREPA       CVLIGGGTARIGDPSGKTSMRKMLDYATLDAYAGAIVAQLDHFLSFDHRH--VFYVNNRDWLAHLNYIDF
SYY_ERWCT       VALVGGATGLIGDPSFKATERKLNTSETVGEWVEKIRRQVSPFLDFDCGKNSAIAANNYDWFGNMNVLDF
SYY_KLEP3       VALVGGATGLIGDPSFKAAERKLNTEDTVQEWVDKIRKQVAPFLDFDCGDNSAIAANNYDWFGSMNVLTF
SYY_ENT38       IALVGGATGLIGDPSFKAAERKLNTEDTVQEWVDKIRKQVAPFLDFDCGENSAIAANNYDWFGNMNVLTF
SYY_STAAW       IVLIGGGTGMIGDPSGKSEERVLQTEEQVDKNIEGISKQMHNIFEFG-TDHGAVLVNNRDWLGQISLISF
SYY_STAAT       IVLIGGGTGMIGDPSGKSEERVLQTEEQVDKNIEGISKQMHNIFEFG-TDHGAVLVNNRDWLGQISLISF
SYY_STAAS       IVLIGGGTGMIGDPSGKSEERVLQTEEQVDKNIEGISKQMHNIFEFG-TDHGAVLVNNRDWLGQISLISF
SYY_STAAR       IVLIGGGTGMIGDPSGKSEERVLQTEEQVDKNIEGISKQMHNIFEFG-TDHGAVLVNNRDWLGQISLISF
SYY_STAAN       IVLIGGGTGMIGDPSGKSEERVLQTEEQVDKNIEGISKQMHNIFEFG-TDHGAVLVNNRDWLGQISLISF
SYY_STAAM       IVLIGGGTGMIGDPSGKSEERVLQTEEQVDKNIEGISKQMHNIFEFG-TDHGAVLVNNRDWLGQISLISF
SYY_STAAE       IVLIGGGTGMIGDPSGKSEERVLQTEEQVDKNIEGISKQMHNIFEFG-TDHGAVLVNNRDWLGQISLISF
SYY_STAAC       IVLIGGGTGMIGDPSGKSEERVLQTEEQVDKNIEGISKQIHNIFEFG-TDHGAVLVNNRDWLGQISLISF
SYY_STAAB       IVLIGGGTGMIGDPSGKSEERVLQTEEQVDKNIEGISKQMHNIFEFG-TDHGAVLVNNRDWLGQISLISF
SYY_STAA9       IVLIGGGTGMIGDPSGKSEERVLQTEEQVDKNIEGISKQMHNIFEFG-TDHGAVLVNNRDWLGQISLISF
SYY_STAA8       IVLIGGGTGMIGDPSGKSEERVLQTEEQVDKNIEGISKQMHNIFEFG-TDHGAVLVNNRDWLGQISLISF
SYY_STAA3       IVLIGGGTGMIGDPSGKSEERVLQTEEQVDKNIEGISKQMHNIFEFG-TDHGAVLVNNRDWLGQISLISF
SYY_STAA2       IVLIGGGTGMIGDPSGKSEERVLQTEEQVDKNIEGISKQMHNIFEFG-TDHGAVLVNNRDWLGQISLISF
SYY_STAA1       IVLIGGGTGMIGDPSGKSEERVLQTEEQVDKNIEGISKQMHNIFEFG-TDHGAVLVNNRDWLGQISLISF
SYY_CYTH3       MALVGGATGMIGDPSGRSEERNFLSEETLRLNQEGIRKQLTKFLDFDCGANSAKLVNNYDWFKGIGFLEF
SYY_BACP2       IALVGGATGLIGDPSFKKAERSLNPAEIVEHWSDKIKGQLSQFLDFEAGENPAVIVNNYDWISQMNVITF
SYY_STAS1       LVLIGGGTGMIGDPSGKSEERTLQTEAQVETNVQGINKQMHKIFEFD-TEKGAKLVNNKDWLGQISLIDF
SYY_STRPD       YALVGGATGLIGDPSFKDAERSLQTKETVLEWSDKIKGQLSTFLDFENGDNKAELVNNYDWFSQISFIDF
SYY_STRPC       YALVGGATGLIGDPSFKDAERSLQTKETVLEWSDKIKGQLSTFLDFENGDNKAELVNNYDWFSQISFIDF
SYY_STRPB       YALVGGATGLIGDPSFKDAERSLQTKETVLEWSDKIKGQLSTFLDFENGDNKAELVNNYDWFSQISFIDF
SYY_STREM       YALVGGATGLIGDPSFKDAERILQTKETVLDWSQKIKEQLSCFLDFDNGENKAELVNNYDWFSQISFIDF
SYY_STRE4       YALVGGATGLIGDPSFKDAERILQTKETVLDWSQKIKEQLSCFLDFDNGENKAELVNNYDWFSQISFIDF
SYY_STRP6       YALVGGATGLIGDPSFKDAERSLQTKETVLEWSDKIKGQLSAFLDFENGDNKAELVNNYDWFSQISFIDF
SYY_STRMU       YALVGGATGLIGDPSFKDDERSLQTKETVKNWVQSIRSQLERFIDFKHGDNKAQMVNNYDWMGKITFIDF
SYY_SERP5       VALVGGATGLIGDPSFKAAERKLNTTETVNEWVDKIRKQVSPFLDFDCGSNSAIAANNYDWFGGMNVLTF
SYY_LACLS       YALVGGATGLIGDPSFKDSERSLQTKDTVTKWSGKIRSQLERFLDFENGENKAEMTNNYNWFENLTFIDF
SYY_STRPM       YALVGGATGLIGDPSFKDAERSLQTKETVLEWSDKIKGQLSTFLDFENGDNKAELVNNYDWFSQISFIDF
SYY1_PHOLL      VALVGGATGLIGDPSFKATERKLNTEATVKEWVEKIRRQVSPFLDFDCGENSAKTANNYDWFGNMDVLAF
SYY_STRS7       YALVGGATGLIGDPSFKDAERILQTKETVLDWSQKIKEQLSCFLDFDNGENKAELVNNYDWFSQISFIDF
SYY_STRP3       YALVGGATGLIGDPSFKDAERSLQTKETVLEWSDKIKGQLSTFLDFENGDNKAELVNNYDWFSQISFIDF
SYY_STRP8       YALVGGATGLIGDPSFKDAERSLQTKETVLEWSDKIKGQLSTFLDFENGDNKAELVNNYDWFSQISFIDF
SYY_LACLM       YALVGGATGLIGDPSFKDSERSLQTKDTVTKWSGKIRSQLERFLDFENGENKAEMTNNYNWFENLTFIDF
SYY_PORG3       IALIGGATGMIGDPSMKSAERVLLDEATLRHNQDCIKQQLAKFLDFDSAPNAAKLVNNYDWMKDYSFLGF
SYY_FLAPJ       IALIGGATGMIGDPSGKSDERNLLDEATLNKNVAGIKAVLSSFLDFNTTNNAPILVNNYDWMKDFSFIDF
SYY1_VIBVY      IALIGGATGMIGDPSFKASERSLNSAETVAAWVNALATQIQQLMT-PHLTQPLVMVNNADWMQSIGVIAF
SYY_ERWT9       VALVGGATGLIGDPSFKAAERKLNTSETVNQWVEKIRQQVAPFLSFNCGDNSAIAANNYDWFGSMNVLTF
SYY_PORGI       IALIGGATGMIGDPSMKSAERVLLDEATLRHNQDCIKQQLAKFLDFDSAPNAAKLVNNYDWMKDYSFLGF
SYY_STRPZ       YALVGGATGLIGDPSFKDAERSLQTKETVLEWSDKIKGQLSTFLDFENGDNKAELVNNYDWFSQISFIDF
SYY_STRPF       YALVGGATGLIGDPSFKDAERSLQTKETVLEWSDKIKGQLSTFLDFENGDNKAELVNNYDWFSQISFIDF
SYY_STRP1       YALVGGATGLIGDPSFKDAERSLQTKETVLEWSDKIKGQLSTFLDFENGDNKAELVNNYDWFSQISFIDF
SYY_FLAJ1       IALVGGATGMIGDPSGKSDERNLLNEETLAKNVAGIKSVLSRFLDFNKEQNAPIMVNNYDWMKEFSFIDF
SYY_AMOA5       IAVVGGATGMIGDPSFKSTERKFLSEEELLHNQSCIMKQLKCFLDFSSSANTAELLNNIDWFKDFGFLRF
SYY1_VIBVU      IALIGGATGMIGDPSFKASERSLNSAETVAAWVNALATQIQQLMT-PHLTQPLVMVNNADWMQSIGVIAF
SYY_STRA3       YALVGGATGLIGDPSFKDVERSLQTKETVVSWGNKIRGQLSNFLEFETGDNKAVLVNNYDWFSNISFIDF
SYY1_PSEHT      VALIGGATGLIGDPSFKATERSLNSKETVQGWVADLSSQVESVMNPHLSE-PIQLKNNADWFSGIEVLDF
SYY_PARUW       VAIVGGATGMIGDPSGKNAERQLLDEKKIQLNLKGISKNLEAILDFNHPTAPAIILNNLDWFKNFTFISF
SYY_STRA5       YALVGGATGLIGDPSFKDVERSLQTKKTVVSWGNKIRGQLSNFLEFETGDNKAVLVNNYDWFSNISFIDF
SYY_STRA1       YALVGGATGLIGDPSFKDVERSLQTKETVVSWGNKIRGQLSNFLEFETGDNKAVLVNNYDWFSNISFIDF
SYY_STRU0       YALVGGATGLIGDPSFKDAERSLQTKETVLEWSGKIKGQLSQFLDFENGANKAELVNNYDWFSQISFIDF
SYY_CORJK       ITLAGGATGMIGDPRDVGE-RSMLTEEQIGENMVAIKKQLEAFVDFTEVDSPAVMVNNADWISQMNVIEY
SYY_LACLA       YALVGGATGLIGDPSFKDSERSLQTKDTVTKWSGKIRSQLERFLDFENGENKAEMTNNYNWFENLTFIDF
SYY_LISW6       IILVGGATGTIGDPSGKKEERKLQSMEQISRNVESLRVQLGKIFDFE-GDSAASMVNNYDWTKDVSILDF
SYY_LISIN       IILVGGATGTIGDPSGKKEERKLQSMEQISKNVESLRVQLGKIFDFE-GDSAASMVNNYDWTKDVSILDF
SYY_PARD8       IALVGGATGMIGDPSMKSAERNLLDEATLRHNQDCIKKQLAKFLDFDSAPNAAKLVNNYDWMKGYSFLNF
SYY_SODGM       VALVGGATGLIGDPSFKATERKLNTAETVQEWVEKIKRQVSPFLDFDCGDNSAVAANNYDWFGSMNVLTF
SYY_OCEIH       IALVGGGTGMIGDPSGRSSERSLNAPEVVHGFTSKLQQQIAKLVDMEASENTVVARNNHDWLGNMTIIDF
SYY_LISMH       IILVGGATGTIGDPSGKKEERKLQSMEQISKNVESLRVQLGKIFDFE-GDSAASMVNNYDWTKDVSILDF
SYY_BORRA       XXXXXXXXXXXXDPSGKDSMRKILLKEDIDENVKTISSQLLKIIDLS---NGGYILNNAEWLDGINYIEF
SYY_BORDL       XXXXXXXXXXXXDPSGKDSMRKILLKEDIDENVKTISSQLLKIIDLS---NGGYILNNAEWLDGINYIEF
SYY_MACCJ       VVLIGGATGMIGDPSGRTDERTLQTLAQVQHNVDGISKQMEQLFDFG-TENGAIRVDNKDWLGKIDLLTF
SYY_LISMO       IILVGGATGTIGDPSGKKEERKLQSMEQISKNVESLRVQLGKIFDFE-GNSAASMVNNYDWTKDVSILDF
SYY_LISMF       IILVGGATGTIGDPSGKKEERKLQSMEQISKNVESLRVQLGKIFDFE-GNSAASMVNNYDWTKDVSILDF
SYY_LISMC       IILVGGATGTIGDPSGKKEERKLQSMEQISKNVESLRVQLGKIFDFE-GNSAASMVNNYDWTKDVSILDF
SYY_AERHH       VALVGGATGLIGDPSFKATERNLNSSETVQGWVASLSAQIKALLPASEGLAAPLLVNNADWMGQMSALDF
SYY_MYCPE       XXXXXXXXXXXXDPSGRSEIRKILDRKTIDYNCECLKKQMSKFISFE-GKNKAVMVNNADWLLKINWIEF
SYY_LARHH       IALVGGATGMIGDPSFKAAERKLNTPDVIAGWVDKIRRQLSPFLSFE-GDNAAVMANNYDWFGQMNVLEF
SYY_BUCBP       VILMGGGTSLIGDPSFKLLERQLNSIELVHTWKQKITKQLSLFLKFNVGKNNALIVDNYEWFKNINVLTF
SYY_LEIXX       FGLVGGSTGLIGDPKPSAE-RTLNAKETVAEWVGSLREQVTRFLSAE-GDNAVRLVNNLDWTAPLSAIDF
SYY_CORDI       ITLAGGATGFIGDPRDVGE-RSMLSQDTIEHNLESIKKQLRSFVRFD-GDSPAIMVNNADWTMSMSVVDF
SYY_KINRD       LILVGGATGLVGDPRPSAE-RTMNDPSVVAGWVTGLQGQIAPFLDFD-GPAAATMVNNLDWTQSMSTIEF
SYY_STRGG       LALVGGATGQIGDPRPTAE-RTLNDPETIAAWVQRLRGQIEPFLTFE-GPNAATMVNNLDWTAGMSAIEF
SYY_SHIBS       VALVGGATGLIGDPSFKAAERKLNTEETVQEWVDKIRKQVAPFLDFDCGENSAIAANNYDWFGNMNVLTF
SYY_BIFA0       IALVGGATGLIGDPRQSGE-RILNPKDIVEQWCERLRIQIGGILEQE-GSNPVTFVSNYDWTATMNVLDF
SYY2_BACHK      VILIGGATGTIGDPSGRQSERQLQTLEVVQHNVDALTAQMKKLFDFG-GNSEVKMVNNYDWTHEINIIEF
SYY_SHIFL       VALVGGATGLIGDPSFKAAERKLNTEETVQEWVDKIRKQVAPFLDFDCGENSAIAANNYDWFGNMNVLTF
SYY_SHIF8       VALVGGATGLIGDPSFKAAERKLNTEETVQEWVDKIRKQVAPFLDFDCGENSAIAANNYDWFGNMNVLTF
SYY_HAMD5       IILVGGATGLIGDPSFKAGERKLNDIDTVHQWVNKIREQVEPFLDFDCGNHSATIENNHNWFSHINVLTF
SYY2_BACCZ      VILIGGATGTIGDPSGRQSERQLQTLEVVQHNVDALTAQMKKLFDFG-GNSEVKMVNNYDWTHEINIIEF
SYY_LACPL       YVVVGGGTGAIGDPSGKNSERKLQTMDQVKHNQDGLSAQMYKLFGHD--ENFSI-VNNYDWLSKISLLDF
SYY_ACIC1       IALVGGATGLIGDPSGRTTERALNDPDVVAGWAERIHRQLAPFLDFERAGQPAIAVNNLEWTGRLTAIEF
SYY2_BACCR      VILIGGATGTIGDPSGRQSERQLQTLEVVQHNVDALTAQMKKLFDFG-GNSEVKMVNNYDWTHEINIIEF
SYY2_BACC1      VILIGGATGTIGDPSGRQSERQLQTLEVVQHNVDALTAQMKKLFDFG-GNSEVKMVNNYDWTHEINIIEF
SYY_ROSS1       XXXXXXXXXXXXXXSGKTQERPLLSKEQVAANVEAIKGQLAQFLDFNAGDHSALLLNNADWLTRLSLMDF
SYY2_BACAN      VILIGGATGTIGDPSGRQSERQLQTLEVVQHNVDALTAQMKKLFDFG-GNSEVKMVNNYDWTHEINIIEF
SYY1_VIBCH      IALIGGATGMIGDPSFKANERVLNSAQTVQQWVSDLSQQITQLMTSQGENCASLMVNNADWIGKINLIDF
SYY_MYCFO       IVLAGGATGMIGDPRDTGE-RTLNTADTVADWAGRIRGQLERFVEFDDTPTGAIVENNLNWTGRLSAIEF
SYY_BLOPB       XXXXXXXXXXXXDPSFKDSERKLNLIETVQKWIEKIKYQVSLFVDFSHSQSQACIVNNYDWLSSISLLTF
SYY_ROSCS       XXXXXXXXXXXXXXSGKTQERPLLSKEQVAANVEAIKRQLAQFLDFNAGDHSAMLLNNAEWLTRLSLMDF
SYY_BIFAA       IALVGGATGLIGDPRQSGE-RTLNPKDVVAGWADRLKKQIGGILETE-GSNPVRFVSNYDWTASMNVIDF
SYY_CORGL       IVLAGGATGMIGDPRDVGE-RTMNSADTVSDWAERISGQLSRFVDFD-GEHAARLVNNAEWTNEMSVVTF
SYY_CHLMU       IALVGGATGMIGDPSGKSVERSLLDQEQVLDNSKKIEVALANYLPDIR------IVNNADWLGSLSMVDF
SYY_BIFLO       IALVGGATGLIGDPRQSGE-RTLNPKDVVAGWADRLKNQIGGILDTEGA-NAVRFVSNYDWTASMTVIDF
SYY_BIFLI       IALVGGATGLIGDPRQSGE-RTLNPKDVVAGWADRLKNQIGGILDTEGA-NAVRFVSNYDWTASMTVIDF
SYY_BIFLD       IALVGGATGLIGDPRQSGE-RTLNPKDVVAGWADRLKNQIGGILDTEGA-NAVRFVSNYDWTASMTVIDF
SYY_LACJO       VILIGGGTGAIGDPSGRKTERTLQTAEQVKHNEEKLTAQMKKLFGTENFE----IRNNAEWLGKMNLLDF
SYY_CHLTR       VALVGGATGMIGDPSGKSVERSLLDQAQVLDNSKKIAAALASYLPGIR------IVNNADWLGSLSMVDF
SYY_CHLTB       VALVGGATGMIGDPSGKSVERSLLDQAQVLDNSKKIAAALASYLPGIR------IVNNADWLGSLSMVDF
SYY_CHLTA       VALVGGATGMIGDPSGKSVERSLLDQAQVLDNSKKIAAALASYLPGIR------IVNNADWLGSLSMVDF
SYY_CHLT2       VALVGGATGMIGDPSGKSVERSLLDQAQVLDNSKKIAAALASYLPGIR------IVNNADWLGSLSMVDF
SYY_ANADE       XXXXXXXXXXXXXXXXKRSERPVLSVEEIDRNVAAIRAQLERFVSFE-GQNAARVRNNADWLRSIGLMEF
SYY_LACF3       VILIGGGTGAIGDPSGRKTERDLETRSKLEQNVQSLTKQMIRLFGTEN----FTIVNNYDWLSKFTMIDF
SYY_ANAD2       XXXXXXXXXXXXXXXXKRSERPVLSVEEIDRNVAAIRAQLERFVSFE-GQNAARVRNNADWLRAIGLMEF
SYY_MYCSS       IVLAGGATGMIGDPRDTGE-RTLQTADTVADWADRIRGQLERFVEFDESPTGAIVENNLSWTGALSTIEF
SYY_MYCSK       IVLAGGATGMIGDPRDTGE-RTLQTADTVADWADRIRGQLERFVEFDESPTGAIVENNLSWTGALSTIEF
SYY_COREF       IVLAGGATGMIGDPRDVGE-RTMNSADTVAEWAERISDQLSRFVDFE-GEHAARLVNNAEWTNNMSVVTF
SYY_CHLCV       VALVGSATGMIGDPSGKSIERTLLESNEVAHNSKKLSECLSHYLP------GVQIVNNMEWFQGTTVIDF
SYY_ANASK       XXXXXXXXXXXXXXXXKRSERPVLSVEEIDRNVAAIRAQLERFVSFE-GQNAARVRNNADWLRAIGLMEF
SYY_MYCSJ       IVLAGGATGMIGDPRDTGE-RTLQTADTVADWADRIRGQLERFVEFDESPTGAIVENNLSWTGALSTIEF
SYY_LACBR       YILIGGATGSIGDPSGRKTERQLQTMDKVQHNVKALSRQMQRLFGGD---SNVTMVNNYDWLSKISLLDF
SYY_NOCFA       IVLAGGATGLIGDPRDVGE-RTMNSSDTVAEWARRIRSQLERFVDLDDSPTGAVIVNNMDWTGPLSAVDF
SYY_BUCAT       IILIGGATSLIGDPSFKEKERVFNSNYNVNIWTEKITKQISCFLDFNCGKNSAVLLNNNTWFKQINILSF
SYY_BUCAI       IILIGGATSLIGDPSFKEKERVFNSNYNVNIWTEKITKQISCFLDFNCGKNSAVLLNNNTWFKQINILSF
SYY_BUCA5       IILIGGATSLIGDPSFKEKERVFNSNYNVNIWTEKITKQISCFLDFNCGKNSAVLLNNNTWFKQINILSF
SYY_LACAC       VILIGGGTGAIGDPSGRTTERVLQTAEQVKHNEESLTNQMKKLFGTENFE----IRNNAEWLGKINLIDF
SYY_PEDPA       VILXXXXXXXXXXXXXKKSERVLQTMEQVHHNEEALKSQMVKFFGTDNFR----MVNNYDWLSKMSLLDF
SYY_CHLAB       VALVGSATGMIGDPSGKSIERTLLEESQVAYNSQKLSECLAYYLP------GVQIVNNIDWLKETTVIDF
SYY_MYCLE       IVLAGGATGMIGDPRDIGERNEAYTVAEWAERIRGQLERFVEFDDVAKSRNGAIVVNNLEWTSPMSAIEF
SYY_LACH4       VILIGGGTGAIGDPSGRKTERTLQTADQVKHNEECLTNQMKKLFGTENFE----IRNNAEWLGKLNLIDF
SYY_MYCPA       IVLAGGATGMIGDPRDVGE-RTLNEADTVAEWTERIRGQLERFVDFDESDTGAVVVNNLDWTRQLSAIEF
SYY_MYCPN       HVLLGSGTALIGDPTGRMELRQMMSRETIAENTRNIKKQIRRFLGSN-----VVFCQNETWLKKLNYIEV
SYY_STRCO       LALVGGATGQIGDPRPTAE-RTLNSPETVAGWVERLRGQIEPFLSFE-GENAAVMVNNLDWTEGLSAIEF
SYY_LACS1       HXXXXXXXXXXXDPSGKKSERVLQTMEQVHHNEEALKHLF--------GKDNITIVNNRDWLSKIDLLGF
SYY_THEFY       IALVGGATGMIGDPKPNAE-RTLNSPETIRQWVGNLKRQLSSFLEFEPKPTDALLLDNAEWLGKLTAIGL
SYY_MYCTU       IVLAGGATGMIGDPRDVGE-RSLNEADTVAEWTERIRGQLERFVDFDDSPMGAIVENNLEWTGSLSAIEF
SYY_MYCBO       IVLAGGATGMIGDPRDVGE-RSLNEADTVAEWTERIRGQLERFVDFDDSPMGAIVENNLEWTGSLSAIEF
SYY_LACRD       VXXXXXXXXXXXDPSGRKSERQLQTMDQVHHNEEALT---AQMKKLFGTEN-FTIVNNYEWLSKISLLDF
SYY_STRAW       LGLVGGATGLIGDPKPNSE-RTLNSREVVAEWVERLRAQIAPLLDFE-GPNAAIMVNNLDWTQGLSAIEF
SYY_CHLPN       IALVGGATGMVGDPSGKQSERSLLQTSEVFDNSQKITACLQRYLP------GVTLVNNADWLQEISLIDF
SYY_PROAC       LLLVGGATGLIGDPKMTGE-RHMNDREVVAEWVESIKDQVSKYVDTD-GRNAAQIVNNYDWTVKYTALDL
SYYM_DROME      IALVGGATGLIGDPSGRKTERNQLGETVIETNLKALRRVFENHENWDSKKQPLIIVNNADWYADLQLIDF
SYY_LACSS       YIVXXXXXXXXXXXXXRKSERQLQTMEMVQHNVEALSGQMKRLFGEDANVS---MVNNYDWLSKISLLDF
SYY_OENOB       XXXXXXXXXXXXDPSGKASERKLLPKDVFDENVSRITKQMTRLFGKDGFE----IVNNYDWLSKLDLISF
SYY_BUCAP       IVLIGGATSLIGDPSFKTKERLLKSDSFVEKCTLKISQQIXXXXXXXXXXXXAIILNNNLWFKKINILQF
SYY_TROWT       IALVGGSTGLIGDPRPGGE-RQLHSHEQVQEWVRALQQQLSRFLDFKGAA-AAVLVNNLDWTKSLTALDF
SYY_TROW8       IALVGGSTGLIGDPRPGGE-RQLHSHEQVQEWVRALQQQLSRFLDFKGAA-AAVLVNNLDWTKSLTALDF
SYY1_ENTFA      YILXXXXXXXXXDPSGRTTERVLQTMEAVQHNVDSLSNQMKKLFGKDA---EVTMVNNYDWLSELSLLDF
SYY_BLOFL       XXXXXXXXXXXXDPSFKDSERKLQSFNTTQKWIKKIKLQIALFIDCNSNNSQAHIIDNYSWFSSMNILTF
SYY_ACHLI       XXXXXXXXXXXXXXRETSE-RSLLTLEKSLENAQKIENQIKGLI-----KGNVEFVNNYEWLSKIDLISF
SYY_MYCCT       IALIGGATGMIGDPSFKASERVLQTKQQVDHNITQLKEIIPT----------VSFVNNRDWLEDISLIDF
SYY_LEUCK       XXXXXXXXXXXXDPRPTTE-RQLLSSEQLAENEKGITAQVTKLF----GDNDTRIVNNNDWLGQLTLTDF
SYY_MYCMS       IALIGGATGMIGDPSFKANERVLQTKDQVEHNIAQLKQIIPN----------VNFVNNNTWLSNISLIDF
SYYM_DICDI      IALMGGATALIGDPSGKSSDRVMLTEEFIEGNLKHIRENITAVLGED-----TLVVNNIEWNKTMDVISF
SYY_WIGBR       IIVIGGATALLGDFNIKKNKSFLEKYKNVKNWSKTIENQILNIIKYEXXXXXXXXXXXXXXXKELKIINF
SYY_MESFL       XXXXXXXXXXXXDPSFKADERKLQTDEQVKFHATAIQNQLLRIIP------DVTFANNVDWLGNMSLIDF
SYY_LACDB       XXXXXXXXXXXXXXXXRSTERVLQSEETIKHNEEALT---AQMVKLFGTENFRI-VNNRDWLGKMNLLEF
SYY_LEUMM       XXXXXXXXXXXXDPRPTTE-RQLLSPEQLRQNEKGITEQVTKLF----GDEKTAIVNNNDWLGKLTLTDF
SYY_ONYPE       VILVGGATGLIGDPKETEE-RKLLSLENSLQNAKSIECQLKNILLNKQVE----FVNNYQWLSQIDIISF
SYYM_YEAST      VTVIGGATGKVGDPSGRKTERDVMENDIRQSNVASLQRFFKNGLEYDVPSGKYTPRNNFNWWKDIKMLDF
SYY_LACDA       XXXXXXXXXXXXXXXXRSTERVLQSEETIKHNEEALT---AQMVKLFGTENFRI-VNNRDWLGKMNLLEF
SYY_AYWBP       VILVGGATGLIGDPKETEE-RKLLSLENSLQNAKSIESQLKTILLNKQVE----FVNNYQWLSQIDIISF
SYY_MYCGE       HIVLGSATALIGDPTGXXXXXXXXXXXXXVKNXXXXXXXXXXFL------GDVIIHENKVWLEKLNYIEV
SYYM_MOUSE      IALVGGSTALLGDPSGRTKGREALSAECVRANAHALRRLAANHARLFADGRPFTVLDNAAWFQEQHLVDF
SYY_UREU1       FALVGGATGMIGDPSGKSAERNLLDKTILEHNITKIKYQLEKFTN-------SQVINNYDFYKNMTFLDF
SYYM_RAT        IALVGGSTALLGDPSGRTKEREALSAECVRANARALQRLAANHARLFADGRPFTVLDNAAWFQKQHLMDF
SYY_PHYMT       IVLLGGATSFIGDPK-KIEERKLLDPSQILDNFNKISLQFKKILSFISFE----IVNNYDWISKIDVINF
SYYM_HUMAN      IALVGGATARLGDPSGRTKEREALETEXXXXXXXXXXXXXXQLFTDGRSWGSFTVLDNSAWYQKQHLVDF
SYY_PHYAS       FILVGGATGLIGDPKETEE-RKLLSLETSLQNAKSLETQLKKIL----FQKKITFLNNYEWFSQLDIITF
SYY_UREPA       LALVGGATGMIGDPSGKSAERNLLDKTILEKNIAKIKFQLEKFTN-------SQVINNYVFYENMTFLDF
SYY_UREP2       LALVGGATGMIGDPSGKSAERNLLDKTILEKNIAKIKFQLEKFTN-------SQVINNYVFYENMTFLDF
SYY2_STRT2      IILIGGATALVGDPRGTSE-RDLAEQEKIFDNFEKLKNQIQKIFPYE-------IVNNYDWTKNIMAIDF
SYY2_STRT1      IILIGGATALVGDPRGTSE-RDLAEQEKIFDNFEKLKNQIQKIFPYE-------IVNNYDWTKNIMAIDF
SYY_MYCAP       YAVLGGATGMIGDPSFKDSERVLLDNESVNKNKSKIKAQLESF--------GLEVIDNYDFYKDMNVLEF
SYY_MYCGA       YAILGGATGLIGDPSGKTSERKVQDYEKITANANKIKVQLERY-------TQAKIINNIDFYQNMNLLNF
SYY_MYCPU       IAILGGATSMIGDPSFKDSERKLLSNETILENKKHIRKQLENF--------GFKVIDNLDFYKDMNILDY
SYY_MYCS5       LAVLGGATGMIGDPSFRSTERVLLSTEELLKNKNKIKSQLESF--------GLKVFDNYEIYKDISFLDF
SYYM_NEUCR      FTLIGGSTAKIGDPTGRLKSRDHLSSSDATMNMTKLKKLWENVDTQMRARGYEAIVNNNHWWNKQPMLEV
SYYM_SCHPO      FTVIGDATAQLGDPSGRSTSRKQMAETTRTANSNSIHNQYAQDCNYPFSQMPSSIVRNSSWYENLKLLKF
SYY_MYCMO       VALIGGATGGIGDPSGKKSERILIDEDTLKKNTEAIKKQIKHFLP------DAKIVNNSDFYKNQSFIDF
SYY_MYCHJ       LAVIGGATGMIGDPSFSSKERKLLDFKTLNANKEKIKKQLESF--------GLPVFDNFEIYKNMNILDF
SYY_MYCH2       LAVIGGATGMIGDPSFSSKERKLLDFKTLNANKEKIKKQLESF--------GLPVFDNFEIYKNMNILDF
SYY_MYCH7       LAVIGGATGMIGDPSFSSKERKLLDFKTLNANKEKIKKQLESF--------GLPVFDNFEIYKNMNILDF
SYY_BACSK       QLLIGDFTGKIGDPTGKSETRKVLTDEQVKQNAQTYVEQYGKILDIEKTE----ILYNSRWLSELKFDDV
SYY_DESPS       IFLIGDFTGMIGDPTGKSETRKALTVEQVAENAETYKKQVFKILDPEK----TTVAFNSTWLSKLTAHEM
SYYM_PODAN      YTLIGGATAKIGDPTDRLVSRTPLKRTDLTMNLTKLKALWMNVEEQARRRGKRAVVNNSTWWNSLPLIEV
SYY_THIDA       VFLIGDFTGMIGDPTGKNATRPPLTREAVAENAKTYQEQVFKVLD------PALVRFNSEWMEGLGSVGM
SYY_GEOSL       IFLIGDFTGMIGDPTGKSETRKALSREDVLRNAETYKEQVFKILDPEKTR----VAFNSEWLAKLDAGGM
SYY_SYNY3       VVIIGDFTAQIGDPTGKSEVRKQLTADQVKRNAESYLAQLKPILDFDTPGRLEIRY-NSEWLSNLD-LNK
SYY_NITOC       LFLIGDFTGMIGDPSGKNVTRQPLTRDKILENARTYEEQIFRVLDPEK----TLVVFNSSWMSGMTAADL
SYY_BACHD       QMLIGDFTGRIGDPSGKSETRKQLTDEQVKANARTYVEQYGKILDMEK----ATLHYNSKWLSALNFEDV
SYY_PELCD       NFLIGDFTGMIGDPTGKNETRKALTREEVLKNAETYKQQVFKILDPERTK----VVFNSSWMGQMSAADL
SYY_DESDG       IFLIGDFTGMIGDPSGRSETRPPLTREQVLQNAETYKKQVFKILDPEKTE----VRFNSEWMDKFGAADF
SYY_PASMU       IFLIGDFTGMVGDPSGKNTTRPPLSRDDVLRNAETYKQQIYKILDPQKTR----IVFNSSWLGELGTEGM
SYY_SALRD       VLIVGDFTGMIGDPSGRSKTRPQLTLEETREHGQSYYEQATRVLDPNKTE----IRYNSEWLDEMRFSDV
SYY_AZOSE       MFLVGDFTAMIGDPSGKNATRPPLSREQILENARTYQEQVFKILDPDKTE----ICFNSSWMESLGTAGM
SYY_CARHZ       IIIIGDFTAQIGDPTGKKETRKQLSWEEVLENAKTYQEQIFKILDPAKTK----MVFNSEWLAKLTFADV
SYY_HAEIN       YFLIGDFTGMVGDPSGKNATRPPLSREDVLRNAETYKEQIYKILDPQKTK----IVFNSEWLSKLGTXGM
SYY_MANSM       IFLIGDFTGMVGDPSGKNKTRPPLSREDVLRNAETYKQQIYKILDPQKTR----IVFNSDWLGKLGTEGM
SYY_MOOTA       IIIIGDFTGRIGDPTGKSETRRQLTEAEILANAETYKEQIFKVLDPEQTR----VTFNSHWLGKLTFAEV
SYY_IDILO       VFLIGDFTGMIGDPTGKNVTRKPLTTEQVIANAETYKEQVFKILDPAKTE----IRFNSEWMSKMGAADM
SYY2_PSEAE      IFLIGDFTGMIGDPSGKSVTRPPLTREQVLENAETYKSQVFKILDPAKTE----VAFNSTWMDQLTPADF
SYY_BURS3       IFLIGDFTSLIGDPSGRNATRPPLTREQIESNAKTYFEQAALVLDRDKTE----IRYNSEWSMPLGADGM
SYY_THEMA       VLIIGDFTARIGDPSGRNETRPMLTKEEVLENAKTYQEQAFKILDPKRTE----LRFNGEWLDRMTFADV
SYY_HAEI8       YFLIGDFTGMVGDPSGKNATRPPLSREDVLRNAETYKEQIYKILDPQKTK----IVFNSEWLSKLGTEGM
SYY_DEHSC       VLIVGDWTAQIGDPSGASVTRPMLSAEQVKANAKTYLEQFFKIVDKDKTE----VRWQSEWYGNFKLEDV
SYY_BURPS       IFLIGDFTSLIGDPSGRNATRPPLTREQIESNAKTYFEQAALVLDREKTE----IRYNSEWSMPLGADGM
SYY_HAHCH       IFLIGDFTGMIGDPTGKSATRPPLTKEDVAQNAQTYKEQVFKILDPKKTE----VRFNSEWMDKLSAADM
SYY_GEOMG       CFLIGDFTGMIGDPTGKSETRKALTREDVLKNAETYKEQVFKILDPKKTR----VVFNSEWLGKMTASDM
SYY_BURMA       IFLIGDFTSLIGDPSGRNATRPPLTREQIESNAKTYFEQAALVLDREKTE----IRYNSEWSMPLGADGM
SYY_BURTA       IFLIGDFTSLIGDPSGRNATRPPLTREQIESNAKTYFEQAALVLDREKTE----IRYNSEWSMPLGADGM
SYY_HAEDU       IFLIGDFTGMVGDPSGKNTTRPPLTREDVLRNAETYKQQLFKILD----PNKTRVVFNSAWLNELGTEGM
SYY_PHOPR       TFLIGDFTGMVGDPTGKNTTRPPLTREDVLANAETYKEQVFKILDPAKTK----IEFNSTWLSELGAEGM
SYY_BURP1       IFLIGDFTSLIGDPSGRNATRPPLTREQIESNAKTYFEQAALVLDRAKTE----IRYNSEWSMPLGADGM
SYY_SYNJB       ILLIGDFTALVGDPTGQSEARPRLTPAEVEENARTYLEQAGKILDF---ETPGRLRRNSEWLAHLTLSEL
SYY_BORPE       IFLIGDFTSTIGDPSGRNSTRPPLTREQIETNAKTYYAQASLVLDPARTE----IRYNSEWCDPLGARGM
SYY_BORBR       IFLIGDFTSTIGDPSGRNSTRPPLTREQIETNAKTYYAQASLVLDPARTE----IRYNSEWCDPLGARGM
SYY_SHEON       IFLIGDFTGMVGDPSGKNSTRPPLTREQVLANAETYKEQVYKILDPAKTR----IEFNSSWLEPLGAAGM
SYY_COXBU       IFLIGDFTAMIGDPTGKNITRQPLTREIVMENTKTYETQAFRILDPDKTQ----VTSNSTWINKLKADDL
SYY_BORPA       IFLIGDFTSTIGDPSGRNSTRPPLTREQIETNAKTYYAQASLVLDPARTE----IRYNSEWCDPLGARGM
SYY_WOLSU       TFLIGDYTAMIGDPTGKSETRKPLTREQVLQNAQSYQDQVFKILDPQK----TVIRFNSEWLEKLGTAGM
SYY_SYNP6       VLIIGDFTARIGDPTGKSEVRRQLTAEDVQRNAETYLDQLRPILDFETPGRLEIRY-NSEWLAGLDLAKI
SYY_SYNE7       VLIIGDFTARIGDPTGKSEVRRQLTAEDVQRNAETYLDQLRPILDFETPGRLEIRY-NSEWLAGLDLAKI
SYY_HELPJ       KFLIGDFTAMIGDPTGKNETRKPLNREQVLENAKTYKEQIYKILDQKHTE----VCFNSAWLDALG-AKG
SYY_ACIAD       TFLIGDYTAMIGDPTGKSATRPPLTREQVEANAKTYQEQVFKILD----PNKTKVRFNSEWFNQRTAADL
SYY_PSYA2       YFLIGDYTAKIGDPSGKNSTRPPLTDEQIKANAETYAEQVFKILDKEKTR----VVFNSEWFNDMSAADM
SYY_GLOVI       ILLIGGFTAQIGDPTGKSEARPRLSAAEVEEYAETYLDQARLILNFDTLE----VRNNTEWLSGLDLAAI
SYY2_CLOAB      VIIIGDFTGMIGDPTGKSKTRKQLSSQQVMKNAETYEKQIFKILDRNKTD----LRFNSQWLEKLNFKEV
SYY_METCA       IFLIGDFTGMIGDPTGKNVTRRPLTRDEVIENAKTYEEQIYKVLCPER----TLVMFNSSWMNAMTSADL
SYY_SULDN       QFLIGDFTAQIGDPSGKSATRKILSTEDILENAKSYKEQVFKILDASKTD----VVFNSEWLNALGASGM
SYY_PSESM       IFLIGDFTGMIGDPSGKSATRPPLTREQVLDYAETYKSQVFKILDPAKTE----VAFNSTWMDKLSPADF
SYY_HELHP       KFLIGDFTATIGDPSGKSETRKPLSAEQVKANALTYKEQVFKVLDPQYTQ----ICFNSKWLNELGALGL
SYY_DEIRA       IMLIGDFTATIGDPSGKSKTRPPLSLEEARANAES---YLAQCRLILRQEPEALEIRNSEWLEQLGYKDI
SYY_COLP3       IFLIGDFTGMIGDPTGKNVTRKALTKEDVLANAETYKEQVFKILDPAKTT----VAFNSTWMDKLGAAGM
SYY_AQUAE       FFIIGDFTAMIGDPTGRSQTRPPLSREQVLENAKTYEHQVFKVLIPEKTT----VVFNSTWLEELG-TKG
SYY_NITMU       LFLIGDFTGMIGDPSGKNTTRPPLSREQVAENAKSYQDQVFRILKPEQTE----VVFNSAWMDRLNAADL
SYY_DESVH       IFLIGDFTGLIGDPSGRSDTRPPLTREQVLANAETYKQQVFKILDPEK----TVVDFNSRWMGEFGAADF
SYY_XANOR       IFLIGDFTGMIGDPSGKNATRKPLSREDVLANARTYEEQVFKILDRERTE----VRFNSEWFGQMSAADM
SYY_XANOM       IFLIGDFTGMIGDPSGKNATRKPLSREDVLANARTYEEQVFKILDRERTE----VRFNSEWFGQMSAADM
SYY_SYNJA       ILLIGDFTALVGDPTGQSEARPRLTPAEVEENARTYLEQAGKILDF---ETPGRLRRNSEWLARLTLSEL
SYY_DEHE1       VLIVGDWTAQIGDPSGASVTRPMLSAEQVKANAKTYLEQFFKIVDKDKTE----VRWQSEWYANFKLEDV
SYY_PSEU2       IFLIGDFTGMIGDPSGKSATRPPLTREQVLDYAETYKSQVFKILDPAKTE----VAFNSTWMDQLSPADF
SYY_HELPY       KFLIGDFTAMIGDPTGKNETRKPLNREQVLENAKTYEEQIYKILDEKHTE----VCFNSTWLDALG-AKG
SYY_PSE14       IFLIGDFTGMIGDPSGKSATRPPLTREQVLDYAETYKSQVFKILDPAKTE----VAFNSTWMDKLSPADF
SYY_PSEPK       IFLIGDFTGMIGDPSGKSATRPPLTREQVLENAETYKQQVFKILDPAKTE----VAFNSTWMDKLTPADF
SYY_FRATT       HFLIGDFTAQIGDPTGKNATRPPLTAEEVAANATYTKQVF-KILDKDK----TIIRRNGDWFNKMSASEM
SYY_XANCP       IFLIGDFTGMIGDPSGKNVTRKPLSREDVLANARTYEEQVFKILDRTRTE----VRFNSEWFGQMSAADM
SYY_XANC8       IFLIGDFTGMIGDPSGKNVTRKPLSREDVLANARTYEEQVFKILDRTRTE----VRFNSEWFGQMSAADM
SYY_BDEBA       SFLIGDFTAMIGDPSGKNSTRPMLTREEIEENGRSYAKQIFKILDPEKTE----IVYNSSWIMKMTPAEF
SYY_RALSO       IFLIGDFTSTIGDPSGRNATRPPLTREQIEANAQTYYRQASMVLDPSKTE----IRYNSEWCDPLGARGI
SYY2_BACSU      QLLIGDFTGKIGDPTGKSAARKQLTDEEVQHNAKTYFEQFGKVLDPEKVE----LHYNSKWLKTLN-LED
SYY2_BACLD      QLLIGDFTGKIGDPTGKSAARKQLTDEEVRRNAETYFQQFGKVLDQNKVE----LHYNSKWLKRLT-LED
SYY_LEGPH       IFLIGDFTAMIGDPTGKNVTRMPLSQETVLENAKTYQHQVFKILDPDK----TTVAFNSQWLNKFNAVDL
SYY_PSEPF       IFLIGDFTGMIGDPSGKSATRPPLTREQVLENAETYKTQVFKILDPAKTE----VAFNSTWMDQMGPADF
SYY2_VIBCH      TFLIGDFTGMVGDPTGKNTTRPPLTREDVLRNAETYKQQVFKILDPAKTK----IQFNSEWLSKLGAEGM
SYY_LEGPL       IFLIGDFTAMIGDPTGKNVTRMPLSQETVLENAKTYQHQVFKILDPDK----TTVAFNSQWLNKFNAVDL
SYY_CHLTE       ILIIGDFTAMIGDPSGKSKTRPQLTAEEARENGKSYFEQASKILDPEKTT----ICYNADWLSQMHFADV
SYY_PELLD       ILIIGDFTAMIGDPSGKSKTRPQLSAEEARENGASYFEQASKILD----PHKTTICYNADWLGNMTFADV
SYY_LEGPA       IFLIGDFTAMIGDPTGKNVTRMPLSQETVLENAKTYQHQVFKILDPDK----TTVAFNSQWLNKFNAVDL
SYY2_VIBVY      TFLIGDFTGMVGDPTGKNSTRPPLTREDVLRNAETYKQQVFKILDPAKTK----IQFNSEWLSELGAEGM
SYY_THIFE       LFVIGDFTAMIGDPTGKSVTRKALSREEVVANAATYRPQVFKILDPERTE----VMFNSEWLGALRPEEL
SYY_RALEJ       IFLIGDFTSTIGDPSGRNSTRPPLTREQIEANAQTYYRQASLVLDPARTE----IRYNSEWCDPLGARGM
SYY2_VIBVU      TFLIGDFTGMVGDPTGKNSTRPPLTREDVLRNAETYKQQVFKILDPAKTK----IQFNSEWLSELGAEGM
SYY2_VIBPA      TFLIGDFTAMVGDPTGKNTTRPPLSREDVLRNAETYKEQVFKILDPAKTK----IQFNSEWLSELGAEGM
SYY_BORA1       IFLIGDFTSTIGDPSGRNSTRPPLTREQIEHNAKTYYAQASLVLDPARTE----IRYNSEWCDPLGARGM
SYY_PSEF5       IFLIGDFTGMIGDPSGKSATRPPLTREQVLENAETYKSQVFKILDPAKTE----VAFNSTWMDKMGPADF
SYY_NITEU       LFLIGDFTGMIGDPSGKSATRPPLTREQITQNADTYASQVFKILKPEQTE----VVFNSSWMDKFSAADV
SYY2_PSEHT      VFLIGDFTGMIGDPTGKNVTRKPLTREDVLANAETYKEQVFKILDPAK----TTVAFNSTWMENLGAAGM
SYY_LEPIN       SFLLGDFTAMIGDPTGKSETRKRLSREEVLENSKTYQNQVFKVLDPVKTK----IVYNSNWCSKMNFEDV
SYY_LEPIC       SFLLGDFTAMIGDPTGKSETRKRLSREEVLENSKTYQNQVFKVLDPVKTK----IVYNSNWCSKMNFEDV
SYY_CHLCH       ILIIGNFTAMIGDPSGKSKTRPQLSAEEAAENGRSYFEQAIKILD---AANTTL-CSNADWLGAMTFADV
SYY_ANAVT       VLIIGDFTARIGDPTGKSEMRRQLTEEDVKQNAQTYLDQVRPILDFDTPGRLEVRY-NSEWLSRLD-LGK
SYY_THICR       LFLIGDFTAMIGDPTGKSATRPPLSEEDVLKNAETYKEQVFKILDPAKTK----VVFNSEWMSKLSAADM
SYY_ANASP       VLIIGDFTARIGDPTGKSEMRRQLTEEDVKQNAQTYLDQVRPILDFDTPGRLEVRY-NSEWLSRLD-LGK
SYY_XYLFT       VFLIGDFTGMIGDPTGKNVTRKPLSREDVLANASTYEDQVFKVLDRTLTE----VRFNSEWFEKMSAVDM
SYY_THEEB       VLIIGDFTAQIGDPTGKSEVRKQLTPEEVAANVQTYLEQVRPILDFETPGRLEIRY-NSEWLAKLDLRKV
SYY_XANC5       IFLIGDFTGMIGDPSGKNATRKPLSREDVLANARTYEEQVFKILDRERTE----VRFNSEWFGQMSAADM
SYY_XANAC       IFLIGDFTGMIGDPSGKNATRKPLSREDVLANARTYEEQVFKILDRERTE----VRFNSEWFGQMSAADM
SYY_XYLFA       IFLIGDFTGMIGDPTGKNVTRKPLSHEDVLANARTYEDQVFKVLDRTLTE----VRFNSEWFGKMSAVDM
SYY_SYNS9       VLIIGDFTARIGDPTGKSATR----VQLSKNDVAVNASTYLRQLGQDQPKETALLRYNSEWLEGMDLPAV
SYY_PROMM       VLIIGDFTARIGDPTGKSSTRVQLTSEQIEANATT----YLAQLGQGQSAEKALLRRNTEWLADLDLPEV
SYY_CAMJE       QFLIGDFTGQIGDPSGKSATRKKLDKEQVLINAKTYKTQVFKVLDKEKTQ----IKFNSTWLNELGAAGI
SYY_SYNPX       VLIIGDFTARIGDPTGKCATR----VQLSKEDVAANASTYLRQLGQDQPKETALLDYNSEWLEGMDLPAV
SYY_PROM9       VLIIGDFTAQIGDPTGKNKTRVQLSEKQVKDNLTQLKPANESILDFDSKDKIEIRY-NSEWLKGLNLNSI
SYY_CAMJR       QFLIGDFTGQIGDPSGKSATRKKLDKEQVLINAKTYETQVFKVLDKEKTQ----IKFNSTWLNELGAAGI
SYY_SYNSC       VLIIGDFTARIGDPTGKSATRVQLSKEQVAANAST----YLRQLGQDQPKETALLDYNSEWLEGMDLPAV
SYY_SYMTH       VLIIGDYTAMVGDPTGRNEARPQLTHAETTANAQRYLEQAARVLDVSKLE----IRRNSEWLAPMSFSDV
SYY_PROMT       ILIIGDFTARIGDPTGKSKTRIQLSKDEVQSNALNYKDPKDSLLDFSIPSRIEIR-RNSEWLENLN-LSK
SYY_PROMP       VLIIGDFTAQIGDPTGKNKTRVQLSEEEVKENSKTYKSSDKSILDFD-SEDRIEIRYNSEWLKNLNLNSI
SYY_PROMA       ILIIGDFTARIGDPTGKSKTRVQLSPEEVEKNSENYLNQLTSLLDFE-TEGRLEVRRNSEWLEGFDMVQI
SYY_THET8       VLIIGDFTGMIGDPSGRSKTRPPLTLEETRENAKTYVAQAGKIL----RQEPHLLRYNSEWLEGLTFKEV
SYY_THET2       VLIIGDFTGMIGDPSGRSKTRPPLTLEETRENAKTYVAQAGKIL----RQEPHLLRYNSEWLEGLTFKEV
SYY2_PHOLL      VVIIGDFTAGIGDPTGRNKLRPPLTPEQINKNSQTYINQLAKVINIENIE----IRKNSEWFNNMPFSNV
SYY2_PYRAE      IVLVATWHAWINDKGSIEELRAHERVRAVLDRIGKFKYVYGD----DVAKDP-------------KYWEL
SYY_METMA       TVLLADVHAYLNRKGTLEEVRKIADYNR--------RCFIALGLDEEQTD----FVYGSDFQLGAEYMLN
SYY_METBF       TVLLADVHAYLNRKGTLEEVRKIADYNK--------RCFIALGLDKEKTN----FVYGSDYQLGAEYMLN
SYY_ARCFU       IVLLADIHAYLNEKGTFEEIAEVADYN---------KKVFALGLDESRAK----FVLGSEYQLSRDYVLD
SYY_METAC       TVLLADVHAYLNKKGTLEEVRKIADYNR--------RCFIALGLDEEQTD----FVYGSDFQLGAEYMLN
SYY_METJA       IILLADLHAYLNQKGELDEIRKI-----------------------------------------------
SYY_METS3       ----------------------------------------------------------------------
SYY_METVS       IILLADLHAYLNQKGTMEEIRAL-----------------------------------------------


                         +         .         .         .         .         *         .:210
query           LRDVGRHFSVNRMLSFDSVKTRLDREQSLSFLEFNYMILQAYDFVELNQRTGCRLQMGGSDQWGNIINGI
SYY_AGRT5       LRDVGRHFSVNRMLSFDSVKTRLDREQSLSFLEFNYMILQAYDFVELNQRTGCRLQMGGSDQWGNIINGI
SYY_BRUSU       LRDVGRHFSVNRMLSFDSVKLRLDREQSLSFLEFNYMILQAYDFVELNKRYGLRLQMGGSDQWGNIVNGI
SYY_BRUME       LRDVGRHFSVNRMLSFDSVKLRLDREQSLSFLEFNYMILQAYDFVELNKRYGLRLQMGGSDQWGNIVNGI
SYY_BRUAB       LRDVGRHFSVNRMLSFDSVKLRLDREQSLSFLEFNYMILQAYDFVELNKRYGLRLQMGGSDQWGNIVNGI
SYY_BRUA2       LRDVGRHFSVNRMLSFDSVKLRLDREQSLSFLEFNYMILQAYDFVELNKRYGLRLQMGGSDQWGNIVNGI
SYY_RHIME       LRDVGRHFSVNRMLSFDSVKMRLEREQSLSFLEFNYMILQAYDFVELYERTGCRLQMGGSDQWGNIVNGI
SYY_RHILO       LRDVGRHFSVNRMLTFDSVKLRLDREQSLSFLEFNYMILQGYDFVELARRQNCRLQMGGSDQWGNIINGV
SYY_BARHE       LRDIGKHFSVNRMLSFDSVRLRLEREHSLSFLEFNYMILQAYDFVELYKRYGLRMQMGGSDQWGNIINGI
SYY_BARQU       LRDVGKHFSINRMLSFDSVRLRLEREHSLSFLEFNYMILQAYDFVELYKRYGLRMQMGGSDQWGNIINGI
SYY_NITWN       LRDVGRHFSINRMLTMDSVKMRLEREQELSFIEFNYMILQSYDYVELARRHGCNLQMGGSDQWGNIVNGV
SYY_RHOPA       LREIGRHFSINRMLTMDSVKLRLDREQELSFIEFNYMILQSYDFVELARRYKCNLQMGGSDQWGNIVTGV
SYY_BRAJA       LRDVGRHFSVNRMLTMDSVRLRLEREQEMSFIEFNYMVCQAYDFVELAKRTGCKLQMGGSDQWGNIIMGV
SYY_METSB       LRDVGRHFSVNRMMAMDSVKLRLERDQELSFLEFNYMCLQAYDFVELNRRYGCVLQMGGSDQWGNIVTGL
SYY_XANP2       LREVGPHFTINRMLTFDSVKLRLEREQPLTFLEFNYMILQAYDFVELNARHGCILQMGGSDQWGNIVNGM
SYY_MAGSA       LRDYGHHFTINRMLTFDSVKLRLEREQPLTFLEFNYMLLQGYDFVELFRRNRCILQMGGSDQWGNIINGV
SYY_BEII9       LRDVGRHFSVNRMLSMDSVKLRLERDQELSFLEFNYMCCQAYDFVELHKRYGCQLQMGGSDQWGNIVTGI
SYY_SILST       LRDIGRHFSVNRMLSFESVKSRLDREQSLSFLEFNYMILQAYDFLELNRRYGCVLQMGGSDQWGNIVNGI
SYY_DINSH       LRDVGRHFSVNRMLSFESVKSRLDREQSLSFLEFNYMILQAYDFMELNRRYGCRLQMGGSDQWGNIVNGI
SYY_RHOS5       LRDIGRHFSVNRMLSFESVKSRLDREQSLSFLEFNYMILQAYDFLELFRRYGCRLQMGGSDQWGNIVNGI
SYY_SILPO       LRDIGRHFSVNRMLSFESVKSRLDREQSLSFLEFNYMILQAYDFMELNRRYGCILQMGGSDQWGNIVNGI
SYY_RHOS4       LRDIGRHFSVNRMLSFESVKSRLDREQSLSFLEFNYMILQAYDFLELFRRTGCRLQMGGSDQWGNIVNGI
SYY_PARDP       LRDIGRHFSVNRMLSFESVKSRLDREQSLSFLEFNYMILQAYDFLELYRRYGCRLQMGGSDQWGNIVNGI
SYY_RHOSK       LRDIGRHFSVNRMLSFESVKSRLDREQSLSFLEFNYMILQAYDFLELFRRYGCRLQMGGSDQWGNIVNGI
SYY_RHOS1       LRDIGRHFSVNRMLSFESVKSRLDREQSLSFLEFNYMILQAYDFLELFRRTGCRLQMGGSDQWGNIVNGI
SYY_RHORT       LRDFGRHFSVNRMLTFDSVRLRLDREQPLSFLEFNYMILQAYDFLELGRRTGVRLQMGGSDQWGNIVNGV
SYY_ROSDO       LRDIGRHFSINRMLSFESVKSRLDREQSLSFLEFNYMILQAYDFMELYRRYGCILQLGGSDQWGNIVNGI
SYY_NOVAD       LREVGQHFSVNRMLSFDSVKQRLDREQSLSFLEFNYMILQAYDFRELSQRHACRLQMGGSDQWGNIVNGI
SYY_CAUSK       LRDYGVHFTVNRMLAFDSVKLRLEREQPMTFLEFNYMLMQAVDFLELNRAHGCVLQMGGSDQWGNILNGV
SYY_ZYMMO       LRDVGQHFSVNRMLSFDSVKLRLDREQSLSFLEFNYMILQAYDFLELSRRFGVCLQLGGSDQWGNIVNGI
SYY_GLUOX       LQDVGVHFSVSRMLGFDSVRQRLEREQGLTFLEFNYSILQSYDFRELNRRHGAVLQMGGSDQWGNIVSGI
SYY_WOLPP       LRDIGTHFSVNRMLGFDSVKIRLDREQNLSFLEFNYMLLQAYDFVELNKKYGCRFQIGGSDQWGNIVNGI
SYY_WOLTR       LRDIGAHFSVNRMLSFDSAKTRLDREQNLSFLEFNYMLLQAYDFAELNKKYGCRLQIGGSDQWGNIVNGI
SYY_RICBR       LRDFGSHFSVNRMLTMDSVKLRLEREQHLSFLEFNYMLLQAYDFYYLSKHYNCSLQLGGSDQWGNIVMGA
SYY_CAUCR       LREYGVHFTVNRMLAFDSVKLRLEREQPMTFLEFNYMLMQAVDFLELNRAHGCVLQMGGSDQWGNILNGV
SYY_CAUCN       LREYGVHFTVNRMLAFDSVKLRLEREQPMTFLEFNYMLMQAVDFLELNRAHGCVLQMGGSDQWGNILNGV
SYY_WOLWR       LRDIGAYFSVNRMLSFDSVKTRLDREQTLSFLEFNYMLLQAYDFIELNKKYDCRLQIGGSDQWGNIVNGI
SYY_WOLPM       LRDIGAYFSVNRMLSFDSVKTRLDREQTLSFLEFNYMLLQAYDFIELNKKYDCRLQIGGSDQWGNIVNGI
SYY_RICAH       LRDFGVHFSINRMLTMDSVKLRLEREQHLSFLEFNYMLLQAYDFYYLSKHYNCSLQLGGSDQWGNIVMGA
SYY_RICFE       LRDFGSYFSVNRMLTMDSVRLRLEREQHLSFLEFNYMLLQAYDFYYLSKHYNCSLQLGGSDQWGNIVMGA
SYY_RICTY       LRDFGRHFSVNRMLTMDSVKLRLERSHHLSFLELNYMLLQAYDFYYLSKHYNCILQLGGSDQWGNIVIGA
SYY_RICRS       LRDFGSYFSVNRMLTMDSVKLRLEREQHLSFLEFNYMLLQAYDFYYLSKHYNCSLQLGGSDQWGNIVMGA
SYY_RICRO       LRDFGSYFSVNRMLTMDSVKLRLEREQHLSFLEFNYMLLQAYDFYYLSKHYNCSLQLGGSDQWGNIVMGA
SYY_RICCN       LRDFGSYFSVNRMLTMDSVKLRLEREQHLSFLEFNYMLLQAYDFYYLSKHYNCSLQLGGSDQWGNIVMGA
SYY_RICPU       LRDFGSYFSVNRMLTMDSVKLRLEREQHLSFLEFNYMLLQAYDFYYLSKHYNCSLQLGGSDQWGNIVMGA
SYY_RICM5       LRDFGSYFSVNRMLTMDSVKLRLEREQHLSFLEFNYMLLQAYDFYYLSKHYNCSLQLGGSDQWGNIVMGA
SYY_EHRCJ       LRNIGRHFSVNNMLTFDSVRLRLEREQNLSFLEFNYMLLQSYDFVELNRRYNCLLQIGGSDQWGNIVSGV
SYY_RICAE       LRDFGSYFSVNRMLTMDSVKLRLEREQHLSFLEFNYMLLQAYDFYYLSKHYNCSLQLGGSDQWGNIVMGA
SYY_RICCK       LRDFGSYFSVNRMLTMDSVRLRLEREQHLSFLEFNYMLLQAYDFYYLSKYYNCSLQLGGSDQWGNIVIGV
SYY_EHRRW       LRNIGRHFSVNNMLTFDSVKLRLEREQNLSFLEFNYMLLQAYDFIELNQRYNCLLQIGGSDQWGNIVNGV
SYY_RICPR       LRDFGSYFSVNRMLTMDSVKLRLDRSHHLSFLELNYMLLQSYDFYYLSKNYNCILQLGGSDQWGNIVIGA
SYY_PELUB       LRDVGKHFTINKMLSFDSVKIRLEREQSLSYMEFNYMILQAYDFLELNKKEKCMLQIGGSDQWGNIVNGV
SYY_EHRRG       LRNIGRHFSVNNMLTFDSVKLRLEREQNLSFLEFNYMLLQAYDFIELNQRYNCLLQIGGSDQWGNIVNGV
SYY_ANAPZ       LREIGSKFSVNVMLGLESVKSRLSRDQQLSFLEFSYVLLQSYDFVELHKRYGCILQIGGSDQWGNIVSGI
SYY_DESOH       LRDIGRHFSVNRMIKAESYRMRLESEEGLSFIEFNYMLLQAYDFLKLCGDRDCVLQMGGSDQWGNIVAGI
SYY_CLOTE       IREIGVHFSVNKMLTAECFKQRL--EKGLSFLEFNYMLMQAYDFLCLNRKYGCVMELGGDDQWSNMLAGT
SYY_PSEA7       LDQVGRHFSINRLLTFDAIRQRLDREHSLSFLEFGYTLLQAYDFVELSRRRGCTLQLGGADQWANIINGV
SYY_CLOK5       LREIGVHFSVNKMLTAECFKQRM--EKGLTFLEFNYMLMQGYDFLELNRRYGCTFQMGGDDQWANIIAGV
SYY_CLOK1       LREIGVHFSVNKMLTAECFKQRM--EKGLTFLEFNYMLMQGYDFLELNRRYGCTFQMGGDDQWANIIAGV
SYY1_CLOAB      LREVGVHFSVNKMLTAECFKQRM--EKGLSFLEFNYMLMQGFDFYKLNEKYDCKMELGGDDQWSNMIAGV
SYY_CLOTH       LRDIGVHFSVNRMLTAECFKSRLER--GLSFIEFNYMLMQSYDFLKLYKEYGCIMQLGGDDQWSNILGGI
SYY_EHRCR       LRDIGKHFSVNNMLTFDSVRLRLEREQNLSFLEFNYMLLQSYDFVELNRRYNCLLQIGGSDQWGNIVSGV
SYY_CLOBA       LREVGVHFSVNRMLSAECFKQRL--EKGLSFLEFNYMLMQGYDFYVLNQKYGCKMELGGDDQWSNMIAGV
SYY_CLOBB       LREVGVHFSVNRMLSAECFKQRL--EKGLSFLEFNYMLMQGYDFYVLNQKYGCKMELGGDDQWSNMIAGV
SYY_CLOPH       LREIGVHFSVNKMLTAECYKQRM--EKGLTFFEFNYMLMQSYDFWVLYKKYGCKLQLGGNDQWSNILGGV
SYY_FUSNN       LRDVGEHFSVNRMLAAECYKSRM--ENGLSFLEFNYMIMQAYDFYILNHKYNCTMQLGGDDQWSNMIAGV
SYY_THETN       LRDIGVHFTVNRMLEAEAFKTRMER--GLTFLEFNYMLMQAYDFLELYRRYGCVMQMGGNDQWSNIIAGV
SYY_PSEAB       LDRVGRHFSINRLLTFDAIRQRLDREHSLSFLEFGYTLLQAYDFVELSRRRGCTLQLGGADQWANIINGV
SYY_DESAA       LRDFGRHFSVNRMIKAESYRMRLESEEGLSFIEFNYMLLQAYDFLHLFNEYGCQLQMGGSDQWGNIVAGI
SYY_PSEA8       LDRVGRHFSINRLLTFDAIRQRLDREHSLSFLEFGYTLLQAYDFVELSRRRGCTLQLGGADQWANIINGV
SYY1_PSEAE      LDRVGRHFSINRLLTFDAIRQRLDREHSLSFLEFGYTLLQAYDFVELSRRRGCTLQLGGADQWANIINGV
SYY_SYNAS       LRDIGRHFSVNKMLAAESYKMRL--EKGLNFIEFNYMLLQAYDFLYLFQNHNCVMQMGGNDQWGNMLAGV
SYY_ANAMM       LREIGSKFSVNAMLGLDSVRSRLDRDQNLSFLEFSYVLLQSYDFVELHRRHKCVLQIGGADQWGNIVNGI
SYY_CLOPE       LREVGVHFSVNRMLSAECFKQRLER--GLSFLEFNYMLMQGYDFYVLNKKYNCKMELGGDDQWSNMIAGV
SYY_CLOPS       LREVGVHFSVNRMLSAECFKQRLER--GLSFLEFNYMLMQGYDFYVLNKKYNCKMELGGDDQWSNMIAGV
SYY_CLOP1       LREVGVHFSVNRMLSAECFKQRLER--GLSFLEFNYMLMQGYDFYVLNKKYNCKMELGGDDQWSNMIAGV
SYY_TREDE       LRDIGSHFSVNKMLSFEAYKKRM--ETGLSFLEFNYQLLQSYDFLMLNQNYNIELQIGGDDQWGNMVAGS
SYY_DECAR       MRDIGKHFSVNAMIKKESVQQRLTREQGISYTEFSYSLLQGYDFAELNKRYGCVLQIGGSDQWGNIVAGT
SYY_CLOB6       LREIGVHFSVNKMLTAECFKSRL--EKGLSFLEFNYMLMQGYDFLELNRKYNCVMELGGDDQWSNILAGV
SYY_CLOBM       LREIGVHFSVNKMLTAECFKSRL--EKGLSFLEFNYMLMQGYDFLELNRKYNCVMELGGDDQWSNILAGV
SYY_ORITI       LRDYGRAFSVNKMLTMNSVKSRLERHTPLSFLEFNYMLLQAYDFYYLNKYYNCNLQIGGSDQWGNITMGV
SYY_CLOBK       LREIGVHFSVNKMLTAECFKSRL--EKGLSFLEFNYMLMQGYDFLELNRKYNCVMELGGDDQWSNILAGV
SYY_ORITB       LRDYGRAFSVNKMLTMNSVKSRLERHTPLSFLEFNYMLLQAYDFYYLNKYYNCNLQIGGSDQWGNITMGV
SYY_CLOBH       LREIGVHFSVNKMLTAECFKSRL--EKGLSFLEFNYMLMQGYDFLELNRKYNCVMELGGDDQWSNILAGV
SYY_CLOB1       LREIGVHFSVNKMLTAECFKSRL--EKGLSFLEFNYMLMQGYDFLELNRKYNCVMELGGDDQWSNILAGV
SYY_CLOBL       LREIGVHFSVNKMLTAECFKSRL--EKGLSFLEFNYMLMQGYDFLELNRKYNCVMELGGDDQWSNILAGV
SYY_CLOBJ       LREIGVHFSVNKMLTAECFKSRL--EKGLSFLEFNYMLMQGYDFLELNRKYNCVMELGGDDQWSNILAGV
SYY_CLOB8       LREVGVHFSVNRMLTAECFKQRL--EKGLSFLEFNYMLMQGYDFYELNQKYNCKMQLGGDDQWSNMIAGV
SYY2_ENTFA      LRDVGKNFTINYMMSKESVKRRI--ETGISYTEFAYQLLQAYDFLKLYETEGCLLQLGGSDQWGNITSGI
SYY_CHRVO       LRDIGKHFSVNAMIKKESVQQRINRDQGISYTEFSYSLLQGYDFAELNQRLGCKLQIGGSDQWGNITAGT
SYY_BACV8       AREVGKHITVNYMMAKDSVQKRLNGEDGLSFTEFTYQLLQGYDFLHLYETKGCKLQMGGSDQWGNITTGA
SYY_BORAP       LRDIGIHFSVNRMLSFETYKKRLDF--GLSFIEFNYQLLQSYDYYMLNKIRNCRLQIGGDDQWGNIISGI
SYY_NEIMB       LRDIGKHFSVNAMLNKESVKQRIDRDGAISFTEFAYSLLQGYDFAELNKRHGAVLEIGGSDQWGNITAGI
SYY_BACFR       AREVGKHITVNYMMAKESVKKRLNGEDGLSFTEFTYQLLQGYDFLHLYETKGCKLQMGGSDQWGNITTGT
SYY_BACFN       AREVGKHITVNYMMAKESVKKRLNGEDGLSFTEFTYQLLQGYDFLHLYETKGCKLQMGGSDQWGNITTGT
SYY_NEIMA       LRDIGKHFSVNAMLNKESVKQRIDRDGAISFTEFAYSLLQGYDFAELNKRHGAVLEIGGSDQWGNITAGI
SYY_NEIMF       LRDIGKHFSVNAMLNKESVKQRIDRDGAISFTEFAYSLLQGYDFAELNKRHGAVLEIGGSDQWGNITAGI
SYY1_BACSU      LRDVGKNFGINYMLAKDTVSSRI--ESGISYTEFSYMILQSYDFLNLYRDKNCKLQIGGSDQWGNITAGL
SYY1_BACC1      LRDIGKNFGLNYMLAKDTVASRL--ETGISFTEFSYMILQSYDFLNLYQHHNCRLQIGGSDQWGNITAGL
SYY1_VIBPA      FRDVGKHFSINTMINRESVKQRLQRDQGISFTEFSYALLQSYDFAELNRQYGCRLQIGGNDQWGNIVSGI
SYY1_BACHK      LRDIGKNFGLNYMLAKDTVASRL--ETGISFTEFSYMILQSYDFLNLYQHHNCRLQIGGSDQWGNITAGL
SYY1_BACCZ      LRDIGKNFGLNYMLAKDTVASRL--ETGISFTEFSYMILQSYDFLNLYQHHNCRLQIGGSDQWGNITAGL
SYY1_BACAN      LRDIGKNFGLNYMLAKDTVASRL--ETGISFTEFSYMILQSYDFLNLYQHHNCRLQIGGSDQWGNITAGL
SYY_RHOBA       LRDVGKNFPVGAMMGKESVRSRLESEAGLSYTEFSYMLLQAYDFVNLAQTHDCRIQAGGSDQWGNITAGI
SYY_NEIM0       LRDIGKHFSVNAMLNKESVKQRIDRDGAISFTEFAYSLLQGYDFAELNKRYGAVLEIGGSDQWGNITAGI
SYY_BORBZ       LRDVGMHFSVNRMLSFETYKRRMDF--GLSFIEFNYQLLQSYDYYMLNKIKNCRLQIGGDDQWGNIISGV
SYY_BORBU       LRDVGMHFSVNRMLSFETYKRRMDF--GLSFIEFNYQLLQSYDYYMLNKIKNCRLQIGGDDQWGNIISGV
SYY_BACA2       LRDVGKNFGINYMLAKDTVSSRI--ETGISYTEFSYMILQSYDFLNLYREKNCKLQIGGSDQWGNITAGL
SYY_STACT       LRDYGKHVGVNYMLGKDSVQSRL--ENGISYTEFTYMILQAIDFGHLNREYNCKVQIGGSDQWGNITSGI
SYY_NEIG2       LRDIGKHFSVNAMLNKESVKQRIDRDGAISFTEFAYSLLQGYDFAELNKRHGAVLEIGGSDQWGNITAGI
SYY_NEIG1       LRDIGKHFSVNAMLNKESVKQRIDRDGAISFTEFAYSLLQGYDFAELNKRHGAVLEIGGSDQWGNITAGI
SYY1_BACCR      LRDIGKNFGLNYMLAKDTVASRL--ETGISFTEFSYMILQSYDFLNLYQHHKCRLQIGGSDQWGNITAGL
SYY_BORGA       LRDIGIHFSVNRMLSFETYKRRLDF--GLSFIEFNYQLLQSYDYYMLNKIKNCKLQIGGDDQWGNIVSGV
SYY_BACST       LRDVGKHFSVNYMMAKESVQSRI--ETGISFTEFSYMMLQAYDFLRLYETEGCRLQIGGSDQWGNITAGL
SYY_BORHD       LRDIGVYFSVNRMLGFETYKRRL--KDGLSFIEFNYQLLQSYDFYMLNKLKNCKLQIGGDDQWGNIVSGV
SYY1_BACLD      LRDVGKNFGINYMLAKDTVSSRI--ETGISYTEFSYMILQSLDFLNLYRNQECKLQIGGSDQWGNITSGL
SYY_GEOKA       LRDVGKHFSVNYMMAKESVQSRI--ETGISFTEFSYMMLQAYDFLRLYETEGCRLQIGGSDQWGNITAGL
SYY_BACCA       LRDVGKHFSVNYMMAKESVQSRI--ETGISFTEFSYMMLQAYDFLRLYETEGCRLQIGGSDQWGNITAGL
SYY_PECCP       LRDIGKHFSVNQMINKEAVKQRLNRDDGISFTEFSYNLLQGYDFASLNKQHDVELQIGGSDQWGNITSGI
SYY_ALISL       MRDIGKHFSVNSMIQKESVKQRIDREGSISFTEFSYMLLQSYDFAALNKAKECTLQIGGSDQWGNITGGI
SYY_YERPY       LRDIGKHFSVNQMINKEAVKQRLNRDDSISFTEFSYNLLQAYDFACLNKNHGVALQIGGSDQWGNITSGI
SYY_YERPS       LRDIGKHFSVNQMINKEAVKQRLNRDDSISFTEFSYNLLQAYDFACLNKNHGVALQIGGSDQWGNITSGI
SYY_YERPP       LRDIGKHFSVNQMINKEAVKQRLNRDDSISFTEFSYNLLQAYDFACLNKNHGVALQIGGSDQWGNITSGI
SYY_YERPN       LRDIGKHFSVNQMINKEAVKQRLNRDDSISFTEFSYNLLQAYDFACLNKNHGVALQIGGSDQWGNITSGI
SYY_YERPG       LRDIGKHFSVNQMINKEAVKQRLNRDDSISFTEFSYNLLQAYDFACLNKNHGVALQIGGSDQWGNITSGI
SYY_YERPE       LRDIGKHFSVNQMINKEAVKQRLNRDDSISFTEFSYNLLQAYDFACLNKNHGVALQIGGSDQWGNITSGI
SYY_YERPB       LRDIGKHFSVNQMINKEAVKQRLNRDDSISFTEFSYNLLQAYDFACLNKNHGVALQIGGSDQWGNITSGI
SYY_YERPA       LRDIGKHFSVNQMINKEAVKQRLNRDDSISFTEFSYNLLQAYDFACLNKNHGVALQIGGSDQWGNITSGI
SYY_YERP3       LRDIGKHFSVNQMINKEAVKQRLNRDDSISFTEFSYNLLQAYDFACLNKNHGVALQIGGSDQWGNITSGI
SYY_SALEP       LRDIGKHFSVNQMINKEAVKQRLNRDQGISFTEFSYNLLQGYDFACLNKLHGVALQIGGSDQWGNITSGI
SYY_BACTN       VREVGKHITVNYMMAKDSVKRRLNGEDGLSFTEFTYQLLQGYDFLHLYETKGCKLQMGGSDQWGNITTGA
SYY_VIBFM       MRDVGKHFSVNAMIQKESVKQRIDREGSISFTEFSYMLLQSYDFAALNKAKECTLQIGGSDQWGNITGGI
SYY_VIBF1       MRDVGKHFSVNAMIQKESVKQRIDREGSISFTEFSYMLLQSYDFAALNKAKECTLQIGGSDQWGNITGGI
SYY_SALTY       LRDIGKHFSVNQMINKEAVKQRLNRDQGISFTEFSYNLLQGYDFACLNKLHGVALQIGGSDQWGNITSGI
SYY_SALTI       LRDIGKHFSVNQMINKEAVKQRLNRDQGISFTEFSYNLLQGYDFACLNKLHGVALQIGGSDQWGNITSGI
SYY_SALSV       LRDIGKHFSVNQMINKEAVKQRLNRDQGISFTEFSYNLLQGYDFACLNKLHGVALQIGGSDQWGNITSGI
SYY_SALPK       LRDIGKHFSVNQMINKEAVKQRLNRDQGISFTEFSYNLLQGYDFACLNKLHGVALQIGGSDQWGNITSGI
SYY_SALPC       LRDIGKHFSVNQMINKEAVKQRLNRDQGISFTEFSYNLLQGYDFACLNKLHGVALQIGGSDQWGNITSGI
SYY_SALPB       LRDIGKHFSVNQMINKEAVKQRLNRDQGISFTEFSYNLLQGYDFACLNKLHGVALQIGGSDQWGNITSGI
SYY_SALPA       LRDIGKHFSVNQMINKEAVKQRLNRDQGISFTEFSYNLLQGYDFACLNKLHGVALQIGGSDQWGNITSGI
SYY_SALNS       LRDIGKHFSVNQMINKEAVKQRLNRDQGISFTEFSYNLLQGYDFACLNKLHGVALQIGGSDQWGNITSGI
SYY_SALHS       LRDIGKHFSVNQMINKEAVKQRLNRDQGISFTEFSYNLLQGYDFACLNKLHGVALQIGGSDQWGNITSGI
SYY_SALG2       LRDIGKHFSVNQMINKEAVKQRLNRDQGISFTEFSYNLLQGYDFACLNKLHGVALQIGGSDQWGNITSGI
SYY_SALDC       LRDIGKHFSVNQMINKEAVKQRLNRDQGISFTEFSYNLLQGYDFACLNKLHGVALQIGGSDQWGNITSGI
SYY_SALCH       LRDIGKHFSVNQMINKEAVKQRLNRDQGISFTEFSYNLLQGYDFACLNKLHGVALQIGGSDQWGNITSGI
SYY_SALAR       LRDIGKHFSVNQMINKEAVKQRLNRDQGISFTEFSYNLLQGYDFACLNKLHGVALQIGGSDQWGNITSGI
SYY_SALA4       LRDIGKHFSVNQMINKEAVKQRLNRDQGISFTEFSYNLLQGYDFACLNKLHGVALQIGGSDQWGNITSGI
SYY_CITK8       LRDIGKHFSVNQMINKEAVKQRLNRDQGISFTEFSYNLLQGYDFACLNKLHGVTLQIGGSDQWGNITSGI
SYY_STAHJ       LRDYGKHVGVNYMLGKDSIQSRL--ENGISYTEFTYTILQAIDFGHLNRELNCKLQVGGSDQWGNITSGI
SYY_STRP4       LRDIGKYFTVNYMMSKESVKKRI--ETGISYTEFAYQIMQGYDFFVLNQDHNVTLQIGGSDQWGNMTAGT
SYY_STRPS       LRDIGKYFTVNY