[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for atum0:AAK87761.1

[Show Plain Result]


## Summary of Sequence Search
    1::200
   14::75      2e-13  48%  413 aa  DNJH_CUCSA RecName: Full=DnaJ protein homolog;AltName:
   15::76      4e-13  48%  417 aa  DNJH_ATRNU RecName: Full=DnaJ protein homolog ANJ1;
   16::77      1e-12  47%  420 aa  DNAJ3_ARATH RecName: Full=Chaperone protein dnaJ 3;       
   16::77      3e-12  47%  419 aa  DNAJ2_ARATH RecName: Full=Chaperone protein dnaJ 2;       
    4::69      3e-12  53%  392 aa  DNAJ1_PROAC RecName: Full=Chaperone protein dnaJ 1;
    4::70      4e-12  50%  365 aa  DNAJ_THEVO RecName: Full=Chaperone protein dnaJ;
   17::94      7e-12  41%  410 aa  DNJ15_ARATH RecName: Full=Chaperone protein dnaJ 15;       
    5::71      7e-12  48%  376 aa  DNAJ_YERE8 RecName: Full=Chaperone protein dnaJ;
   15::71      1e-11  47%  418 aa  DNJH2_ALLPO RecName: Full=DnaJ protein homolog 2;
    6::72      2e-11  48%  375 aa  DNAJ_HALOH RecName: Full=Chaperone protein dnaJ;
    3::71      2e-11  51%  373 aa  DNAJ_DESPS RecName: Full=Chaperone protein dnaJ;
    6::78      3e-11  47%  388 aa  DNAJ_ANATD RecName: Full=Chaperone protein dnaJ;
    5::75      4e-11  46%  307 aa  DNAJ_DEIPR RecName: Full=Chaperone protein dnaJ;
    4::70      4e-11  52%  378 aa  DNAJ2_MYCLE RecName: Full=Chaperone protein dnaJ 2;
    4::70      5e-11  47%  365 aa  DNAJ_THEAC RecName: Full=Chaperone protein dnaJ;
    4::70      5e-11  52%  384 aa  DNAJ1_NOCFA RecName: Full=Chaperone protein dnaJ 1;
    4::70      6e-11  47%  378 aa  DNAJ2_STRCO RecName: Full=Chaperone protein dnaJ 2;
    4::70      6e-11  47%  378 aa  DNAJ2_STRAW RecName: Full=Chaperone protein dnaJ 2;
    4::70      6e-11  47%  379 aa  DNAJ2_STRAL RecName: Full=Chaperone protein dnaJ 2;
   93::164     8e-11  48%  480 aa  DNJA3_HUMAN RecName: Full=DnaJ homolog subfamily A member 3,
    6::64      8e-11  55%  287 aa  DNAJ_SYNE7 RecName: Full=Chaperone protein dnaJ;
    3::70      8e-11  47%  377 aa  DNAJ_OCHA4 RecName: Full=Chaperone protein dnaJ;
    5::67      8e-11  53%  369 aa  DNAJ_NITEU RecName: Full=Chaperone protein dnaJ;
    4::70      8e-11  48%  380 aa  DNAJ_NATPD RecName: Full=Chaperone protein dnaJ;
    6::72      8e-11  46%  387 aa  DNAJ_CALS8 RecName: Full=Chaperone protein dnaJ;
    4::70      8e-11  50%  382 aa  DNAJ2_MYCTU RecName: Full=Chaperone protein dnaJ 2;
    4::70      8e-11  50%  382 aa  DNAJ2_MYCBO RecName: Full=Chaperone protein dnaJ 2;
   93::164     1e-10  48%  480 aa  DNJA3_MOUSE RecName: Full=DnaJ homolog subfamily A member 3,
    5::71      1e-10  48%  384 aa  DNAJ_THETN RecName: Full=Chaperone protein dnaJ;
    7::97      1e-10  36%  369 aa  DNAJ_THEP1 RecName: Full=Chaperone protein dnaJ;
    4::72      1e-10  44%  376 aa  DNAJ_RICBR RecName: Full=Chaperone protein dnaJ;
    1::68      1e-10  45%  381 aa  DNAJ_BIFLO RecName: Full=Chaperone protein dnaJ;
    3::70      1e-10  45%  380 aa  DNAJ_BARQU RecName: Full=Chaperone protein dnaJ;
    3::70      1e-10  45%  381 aa  DNAJ_BARHE RecName: Full=Chaperone protein dnaJ;
    5::71      1e-10  49%  377 aa  DNAJ_ACTSZ RecName: Full=Chaperone protein dnaJ;
    4::70      1e-10  49%  375 aa  DNAJ_ZYMMO RecName: Full=Chaperone protein dnaJ;
    5::78      1e-10  48%  375 aa  DNAJ_PSEMY RecName: Full=Chaperone protein dnaJ;
    6::67      1e-10  49%  378 aa  DNAJ_LACDB RecName: Full=Chaperone protein dnaJ;
    6::67      1e-10  49%  378 aa  DNAJ_LACDA RecName: Full=Chaperone protein dnaJ;
   20::87      2e-10  42%  436 aa  DNJ16_ARATH RecName: Full=Chaperone protein dnaJ 16;       
    7::74      2e-10  44%  369 aa  DNAJ_THESQ RecName: Full=Chaperone protein dnaJ;
    7::74      2e-10  44%  369 aa  DNAJ_THEMA RecName: Full=Chaperone protein dnaJ;
    5::72      2e-10  44%  373 aa  DNAJ_THEM4 RecName: Full=Chaperone protein dnaJ;
    4::70      2e-10  48%  375 aa  DNAJ_SINMW RecName: Full=Chaperone protein dnaJ;
    4::72      2e-10  44%  376 aa  DNAJ_RICB8 RecName: Full=Chaperone protein dnaJ;
    6::72      2e-10  49%  386 aa  DNAJ_CLOTH RecName: Full=Chaperone protein dnaJ;
   30::99      2e-10  49%  282 aa  YL39_SCHPO RecName: Full=Uncharacterized J domain-containing
   23::90      2e-10  39%  377 aa  SCJ1_YEAST RecName: Full=DnaJ-related protein SCJ1;       
    4::70      2e-10  49%  392 aa  NOLC_RHIFR RecName: Full=Protein nolC;
   23::88      2e-10  44%  414 aa  DNJ39_ARATH RecName: Full=Chaperone protein dnaJ 39;       
    8::74      2e-10  44%  386 aa  DNAJ_SYMTH RecName: Full=Chaperone protein dnaJ;
    4::71      2e-10  45%  388 aa  DNAJ_SALRD RecName: Full=Chaperone protein dnaJ;
    4::70      2e-10  48%  379 aa  DNAJ_RHIME RecName: Full=Chaperone protein dnaJ;
    1::67      2e-10  47%  374 aa  DNAJ_PROMP RecName: Full=Chaperone protein dnaJ;
    5::71      2e-10  48%  386 aa  DNAJ_HYPNA RecName: Full=Chaperone protein dnaJ;
    1::69      2e-10  45%  385 aa  DNAJ_CAUCR RecName: Full=Chaperone protein dnaJ;
   10::73      2e-10  48%  388 aa  DNAJ1_MYCLE RecName: Full=Chaperone protein dnaJ 1;
    1::55      3e-10  45%  397 aa  DNJH1_ALLPO RecName: Full=DnaJ protein homolog 1;       
    4::70      3e-10  48%  379 aa  DNAJ_RHISN RecName: Full=Chaperone protein dnaJ;
    5::78      3e-10  46%  374 aa  DNAJ_PSEFS RecName: Full=Chaperone protein dnaJ;
    5::72      3e-10  44%  384 aa  DNAJ_IDILO RecName: Full=Chaperone protein dnaJ;
    5::71      3e-10  48%  380 aa  DNAJ_AGRVS RecName: Full=Chaperone protein dnaJ;
    5::71      3e-10  46%  382 aa  DNAJ_AGRRK RecName: Full=Chaperone protein dnaJ;
    4::63      3e-10  51%  381 aa  DNAJ1_MYCPA RecName: Full=Chaperone protein dnaJ 1;
    4::70      3e-10  48%  375 aa  DNAJ1_CORDI RecName: Full=Chaperone protein dnaJ 1;
    8::70      4e-10  44%  352 aa  SIS1_YEAST RecName: Full=Protein SIS1;
    8::68      4e-10  48%  397 aa  DNJA4_HUMAN RecName: Full=DnaJ homolog subfamily A member 4;
    4::72      4e-10  42%  375 aa  DNAJ_RICCK RecName: Full=Chaperone protein dnaJ;
    4::70      4e-10  46%  381 aa  DNAJ_CARHZ RecName: Full=Chaperone protein dnaJ;
    4::70      4e-10  48%  378 aa  DNAJ1_COREF RecName: Full=Chaperone protein dnaJ 1;
    8::68      5e-10  47%  397 aa  DNJA4_MOUSE RecName: Full=DnaJ homolog subfamily A member
    5::67      5e-10  49%  379 aa  DNAJ_XANP2 RecName: Full=Chaperone protein dnaJ;
    5::67      5e-10  46%  375 aa  DNAJ_RHIEC RecName: Full=Chaperone protein dnaJ;
    6::70      5e-10  48%  386 aa  DNAJ_HALLT RecName: Full=Chaperone protein dnaJ;
    6::83      5e-10  39%  390 aa  DNAJ_DICT6 RecName: Full=Chaperone protein dnaJ;
    5::71      5e-10  46%  375 aa  DNAJ_AZOVD RecName: Full=Chaperone protein dnaJ;
    4::68      5e-10  47%  376 aa  DNAJ_ANAVT RecName: Full=Chaperone protein dnaJ;
    4::68      5e-10  47%  376 aa  DNAJ_ANASP RecName: Full=Chaperone protein dnaJ;
   10::74      5e-10  46%  392 aa  DNAJ2_MYCPA RecName: Full=Chaperone protein dnaJ 2;
    5::69      5e-10  45%  313 aa  CBPA_COXBU RecName: Full=Curved DNA-binding protein;
    5::69      5e-10  45%  313 aa  CBPA_COXBR RecName: Full=Curved DNA-binding protein;
    5::69      5e-10  45%  313 aa  CBPA_COXBN RecName: Full=Curved DNA-binding protein;
    5::72      7e-10  43%  379 aa  DNAJ_THEAB RecName: Full=Chaperone protein dnaJ;
    5::71      7e-10  44%  379 aa  DNAJ_RHIRD RecName: Full=Chaperone protein dnaJ;
    5::67      7e-10  46%  234 aa  DNAJ_RHILE RecName: Full=Chaperone protein dnaJ;Flags: Fragment;
    5::67      7e-10  46%  375 aa  DNAJ_RHIL3 RecName: Full=Chaperone protein dnaJ;
    5::67      7e-10  46%  375 aa  DNAJ_RHIE6 RecName: Full=Chaperone protein dnaJ;
    5::67      7e-10  49%  377 aa  DNAJ_PSYWF RecName: Full=Chaperone protein dnaJ;
    5::78      7e-10  49%  374 aa  DNAJ_PSEPW RecName: Full=Chaperone protein dnaJ;
    5::78      7e-10  49%  374 aa  DNAJ_PSEPG RecName: Full=Chaperone protein dnaJ;
    1::67      7e-10  45%  378 aa  DNAJ_PROMA RecName: Full=Chaperone protein dnaJ;
    5::67      7e-10  49%  369 aa  DNAJ_NITEC RecName: Full=Chaperone protein dnaJ;
    5::73      7e-10  46%  376 aa  DNAJ_LISMF RecName: Full=Chaperone protein dnaJ;
    5::73      7e-10  46%  376 aa  DNAJ_LISMC RecName: Full=Chaperone protein dnaJ;
    5::73      7e-10  48%  368 aa  DNAJ_EXIS2 RecName: Full=Chaperone protein dnaJ;
    5::71      7e-10  46%  377 aa  DNAJ_EDWI9 RecName: Full=Chaperone protein dnaJ;
    5::71      7e-10  44%  377 aa  DNAJ_AGRT5 RecName: Full=Chaperone protein dnaJ;
    4::65      7e-10  49%  382 aa  DNAJ1_CORGL RecName: Full=Chaperone protein dnaJ 1;
    5::67      7e-10  50%  317 aa  CBPA_PSEPW RecName: Full=Curved DNA-binding protein;
    5::67      7e-10  50%  319 aa  CBPA_PSEPK RecName: Full=Curved DNA-binding protein;
    5::67      7e-10  50%  319 aa  CBPA_PSEP1 RecName: Full=Curved DNA-binding protein;
    4::65      9e-10  46%  374 aa  DNAJ_TRIEI RecName: Full=Chaperone protein dnaJ;
    5::67      9e-10  46%  376 aa  DNAJ_RHILW RecName: Full=Chaperone protein dnaJ;
    5::81      9e-10  43%  381 aa  DNAJ_RALEH RecName: Full=Chaperone protein dnaJ;
    5::78      9e-10  49%  375 aa  DNAJ_PSEPK RecName: Full=Chaperone protein dnaJ;
    5::78      9e-10  49%  374 aa  DNAJ_PSEP1 RecName: Full=Chaperone protein dnaJ;
    1::67      9e-10  45%  378 aa  DNAJ_PROMM RecName: Full=Chaperone protein dnaJ;
    5::73      9e-10  45%  377 aa  DNAJ_LISMO RecName: Full=Chaperone protein dnaJ;
    5::73      9e-10  45%  376 aa  DNAJ_LISMH RecName: Full=Chaperone protein dnaJ;
    5::73      9e-10  45%  376 aa  DNAJ_LISIN RecName: Full=Chaperone protein dnaJ;
    5::70      9e-10  45%  385 aa  DNAJ_HELHP RecName: Full=Chaperone protein dnaJ;
    6::70      9e-10  44%  280 aa  DNAJ2_THET8 RecName: Full=Chaperone protein dnaJ 2;
    5::67      9e-10  50%  531 aa  DJC21_HUMAN RecName: Full=DnaJ homolog subfamily C member
   29::93      9e-10  44%  782 aa  DJC16_PONAB RecName: Full=DnaJ homolog subfamily C member
   63::123     1e-09  48%  552 aa  DNJC1_MOUSE RecName: Full=DnaJ homolog subfamily C member
   67::127     1e-09  48%  554 aa  DNJC1_HUMAN RecName: Full=DnaJ homolog subfamily C member
    5::71      1e-09  44%  381 aa  DNAJ_VIBVY RecName: Full=Chaperone protein dnaJ;
    5::71      1e-09  44%  381 aa  DNAJ_VIBVU RecName: Full=Chaperone protein dnaJ;
    4::70      1e-09  45%  370 aa  DNAJ_RICPR RecName: Full=Chaperone protein dnaJ;
    5::66      1e-09  46%  380 aa  DNAJ_PHOPR RecName: Full=Chaperone protein dnaJ;
    6::72      1e-09  39%  377 aa  DNAJ_MYCPU RecName: Full=Chaperone protein dnaJ;
    5::71      1e-09  48%  395 aa  DNAJ_MARMM RecName: Full=Chaperone protein dnaJ;
    5::67      1e-09  47%  374 aa  DNAJ_MARAV RecName: Full=Chaperone protein dnaJ;
    4::68      1e-09  45%  374 aa  DNAJ_CYAP4 RecName: Full=Chaperone protein dnaJ;
    5::71      1e-09  44%  375 aa  DNAJ_CHRVO RecName: Full=Chaperone protein dnaJ;
    5::67      1e-09  46%  381 aa  DNAJ_CHRSD RecName: Full=Chaperone protein dnaJ;
    5::67      1e-09  47%  381 aa  DNAJ_AZOC5 RecName: Full=Chaperone protein dnaJ;
    4::70      1e-09  47%  334 aa  DNAJ1_DROME RecName: Full=DnaJ protein homolog 1;       
   29::93      1e-09  44%  782 aa  DJC16_HUMAN RecName: Full=DnaJ homolog subfamily C member
    5::67      1e-09  47%  314 aa  CBPA_PSESM RecName: Full=Curved DNA-binding protein;
    7::74      2e-09  41%  370 aa  DNAJ_THENN RecName: Full=Chaperone protein dnaJ;
    4::65      2e-09  47%  376 aa  DNAJ_SYNP6 RecName: Full=Chaperone protein dnaJ;
    4::70      2e-09  46%  376 aa  DNAJ_RHILO RecName: Full=Chaperone protein dnaJ;
    5::78      2e-09  45%  380 aa  DNAJ_PSESM RecName: Full=Chaperone protein dnaJ;
    5::67      2e-09  47%  382 aa  DNAJ_OPITP RecName: Full=Chaperone protein dnaJ;
    6::67      2e-09  44%  387 aa  DNAJ_LACCB RecName: Full=Chaperone protein dnaJ;
    6::67      2e-09  44%  387 aa  DNAJ_LACC3 RecName: Full=Chaperone protein dnaJ;
    5::66      2e-09  46%  356 aa  DNAJ_HYDTH RecName: Full=Chaperone protein dnaJ;
    5::71      2e-09  44%  385 aa  DNAJ_HALHL RecName: Full=Chaperone protein dnaJ;
    3::66      2e-09  47%  377 aa  DNAJ_BRUSU RecName: Full=Chaperone protein dnaJ;
    3::66      2e-09  47%  377 aa  DNAJ_BRUSI RecName: Full=Chaperone protein dnaJ;
    3::66      2e-09  47%  377 aa  DNAJ_BRUO2 RecName: Full=Chaperone protein dnaJ;
    3::66      2e-09  47%  377 aa  DNAJ_BRUME RecName: Full=Chaperone protein dnaJ;
    3::66      2e-09  47%  377 aa  DNAJ_BRUMB RecName: Full=Chaperone protein dnaJ;
    3::66      2e-09  47%  377 aa  DNAJ_BRUC2 RecName: Full=Chaperone protein dnaJ;
    3::66      2e-09  47%  377 aa  DNAJ_BRUAB RecName: Full=Chaperone protein dnaJ;
    3::66      2e-09  47%  377 aa  DNAJ_BRUA2 RecName: Full=Chaperone protein dnaJ;
    3::66      2e-09  47%  377 aa  DNAJ_BRUA1 RecName: Full=Chaperone protein dnaJ;
    5::71      2e-09  44%  376 aa  DNAJ2_AZOSE RecName: Full=Chaperone protein dnaJ 2;
   10::73      2e-09  45%  399 aa  DNAJ1_STRCO RecName: Full=Chaperone protein dnaJ 1;
    5::67      2e-09  48%  545 aa  DJC21_DANRE RecName: Full=DnaJ homolog subfamily C member
   29::93      2e-09  44%  771 aa  DJC16_RAT RecName: Full=DnaJ homolog subfamily C member 16;Flags:
   29::93      2e-09  44%  772 aa  DJC16_MOUSE RecName: Full=DnaJ homolog subfamily C member
  108::175     2e-09  43%  375 aa  DJB14_XENTR RecName: Full=DnaJ homolog subfamily B member 14;
    5::71      2e-09  44%  381 aa  DNAJ_VIBHB RecName: Full=Chaperone protein dnaJ;
    4::70      2e-09  45%  370 aa  DNAJ_RICTY RecName: Full=Chaperone protein dnaJ;
    5::71      2e-09  44%  380 aa  DNAJ_PSEHT RecName: Full=Chaperone protein dnaJ;
    5::78      2e-09  48%  377 aa  DNAJ_PSEAE RecName: Full=Chaperone protein dnaJ;
    5::78      2e-09  48%  377 aa  DNAJ_PSEAB RecName: Full=Chaperone protein dnaJ;
    5::78      2e-09  48%  377 aa  DNAJ_PSEA8 RecName: Full=Chaperone protein dnaJ;
    5::78      2e-09  48%  377 aa  DNAJ_PSEA7 RecName: Full=Chaperone protein dnaJ;
    5::71      2e-09  46%  373 aa  DNAJ_NEIMF RecName: Full=Chaperone protein dnaJ;
    5::71      2e-09  46%  373 aa  DNAJ_NEIMB RecName: Full=Chaperone protein dnaJ;
    5::71      2e-09  46%  373 aa  DNAJ_NEIMA RecName: Full=Chaperone protein dnaJ;
    5::71      2e-09  46%  373 aa  DNAJ_NEIM0 RecName: Full=Chaperone protein dnaJ;
    5::78      2e-09  45%  374 aa  DNAJ_JANMA RecName: Full=Chaperone protein dnaJ;
    5::70      2e-09  44%  375 aa  DNAJ_CLOTE RecName: Full=Chaperone protein dnaJ;
    5::73      2e-09  45%  377 aa  DNAJ_BACP2 RecName: Full=Chaperone protein dnaJ;
    7::102     2e-09  37%  910 aa  DNAJM_MYCPN RecName: Full=DnaJ-like protein MG200 homolog;
    3::79      2e-09  43%  316 aa  DJB13_MOUSE RecName: Full=DnaJ homolog subfamily B member
  111::181     2e-09  43%  376 aa  DJB12_MOUSE RecName: Full=DnaJ homolog subfamily B member 12;      
   24::89      3e-09  47%  382 aa  DNJ20_CAEBR RecName: Full=DnaJ homolog dnj-20;AltName: Full=DnaJ
    5::71      3e-09  43%  385 aa  DNAJ_VIBHA RecName: Full=Chaperone protein dnaJ;
    5::71      3e-09  43%  381 aa  DNAJ_VIBCM RecName: Full=Chaperone protein dnaJ;
    5::71      3e-09  43%  381 aa  DNAJ_VIBCH RecName: Full=Chaperone protein dnaJ;
    5::71      3e-09  43%  381 aa  DNAJ_VIBC3 RecName: Full=Chaperone protein dnaJ;
    5::72      3e-09  42%  377 aa  DNAJ_PSYIN RecName: Full=Chaperone protein dnaJ;
    5::78      3e-09  45%  380 aa  DNAJ_PSEU2 RecName: Full=Chaperone protein dnaJ;
    5::71      3e-09  46%  379 aa  DNAJ_PSEA6 RecName: Full=Chaperone protein dnaJ;
    5::78      3e-09  45%  380 aa  DNAJ_PSE14 RecName: Full=Chaperone protein dnaJ;
    5::71      3e-09  46%  373 aa  DNAJ_NEIG1 RecName: Full=Chaperone protein dnaJ;
    4::68      3e-09  45%  374 aa  DNAJ_MICAN RecName: Full=Chaperone protein dnaJ;
    5::70      3e-09  43%  376 aa  DNAJ_METTH RecName: Full=Chaperone protein dnaJ;
    5::66      3e-09  47%  386 aa  DNAJ_LACF3 RecName: Full=Chaperone protein dnaJ;
    5::70      3e-09  40%  371 aa  DNAJ_HAMD5 RecName: Full=Chaperone protein dnaJ;
    4::70      3e-09  44%  384 aa  DNAJ_HALME RecName: Full=Chaperone protein dnaJ;
    4::65      3e-09  46%  375 aa  DNAJ_CYAP7 RecName: Full=Chaperone protein dnaJ;
    5::78      3e-09  43%  376 aa  DNAJ_BURM1 RecName: Full=Chaperone protein dnaJ;
    5::73      3e-09  45%  375 aa  DNAJ_BACSU RecName: Full=Chaperone protein dnaJ;
    5::71      3e-09  46%  380 aa  DNAJ_ALISL RecName: Full=Chaperone protein dnaJ;
    4::65      3e-09  47%  377 aa  DNAJ1_SYNY3 RecName: Full=Chaperone protein dnaJ 1;
   10::74      3e-09  44%  395 aa  DNAJ1_MYCTU RecName: Full=Chaperone protein dnaJ 1;
   10::74      3e-09  44%  395 aa  DNAJ1_MYCBO RecName: Full=Chaperone protein dnaJ 1;
    5::66      3e-09  49%  309 aa  CBPA_SERP5 RecName: Full=Curved DNA-binding protein;
    5::67      3e-09  47%  321 aa  CBPA_PSEE4 RecName: Full=Curved DNA-binding protein;
    1::110     3e-09  37%  312 aa  DNJB7_MOUSE RecName: Full=DnaJ homolog subfamily B member 7;       
    5::70      3e-09  42%  375 aa  DNAJ_UREPA RecName: Full=Chaperone protein dnaJ;
    5::72      3e-09  47%  384 aa  DNAJ_SYNFM RecName: Full=Chaperone protein dnaJ;
    6::71      3e-09  43%  370 aa  DNAJ_ROSS1 RecName: Full=Chaperone protein dnaJ;
    6::71      3e-09  43%  370 aa  DNAJ_ROSCS RecName: Full=Chaperone protein dnaJ;
    5::71      3e-09  43%  378 aa  DNAJ_PROMH RecName: Full=Chaperone protein dnaJ;
    5::67      3e-09  49%  372 aa  DNAJ_PASMU RecName: Full=Chaperone protein dnaJ;
    5::71      3e-09  41%  377 aa  DNAJ_METCA RecName: Full=Chaperone protein dnaJ;
    5::78      3e-09  43%  374 aa  DNAJ_HERAR RecName: Full=Chaperone protein dnaJ;
    5::71      3e-09  43%  383 aa  DNAJ_BUCBP RecName: Full=Chaperone protein dnaJ;
    5::73      3e-09  45%  375 aa  DNAJ_BACA2 RecName: Full=Chaperone protein dnaJ;
    8::73      3e-09  47%  332 aa  DNAJH_SYNY3 RecName: Full=DnAJ-like protein slr0093;
  110::176     3e-09  44%  370 aa  DJB12_BOVIN RecName: Full=DnaJ homolog subfamily B member 12;
    5::67      3e-09  47%  318 aa  CBPA_PSEPG RecName: Full=Curved DNA-binding protein;
    4::65      4e-09  46%  337 aa  DNJB4_PONAB RecName: Full=DnaJ homolog subfamily B member 4;
    4::65      4e-09  46%  337 aa  DNJB4_HUMAN RecName: Full=DnaJ homolog subfamily B member
    4::65      4e-09  46%  337 aa  DNJB4_BOVIN RecName: Full=DnaJ homolog subfamily B member 4;
    4::65      4e-09  46%  373 aa  DNAJ_THEEB RecName: Full=Chaperone protein dnaJ;
    1::64      4e-09  48%  377 aa  DNAJ_SYNPX RecName: Full=Chaperone protein dnaJ;
    4::68      4e-09  42%  375 aa  DNAJ_NOSP7 RecName: Full=Chaperone protein dnaJ;
    5::71      4e-09  44%  376 aa  DNAJ_MANSM RecName: Full=Chaperone protein dnaJ;
    5::73      4e-09  43%  376 aa  DNAJ_LISW6 RecName: Full=Chaperone protein dnaJ;
    5::78      4e-09  46%  379 aa  DNAJ_LEGPN RecName: Full=Chaperone protein dnaJ;
    5::78      4e-09  46%  379 aa  DNAJ_LEGPL RecName: Full=Chaperone protein dnaJ;
    5::78      4e-09  46%  379 aa  DNAJ_LEGPH RecName: Full=Chaperone protein dnaJ;
    5::78      4e-09  46%  379 aa  DNAJ_LEGPC RecName: Full=Chaperone protein dnaJ;
    5::78      4e-09  46%  379 aa  DNAJ_LEGPA RecName: Full=Chaperone protein dnaJ;
    5::66      4e-09  46%  384 aa  DNAJ_LACAC RecName: Full=Chaperone protein dnaJ;
    5::73      4e-09  43%  380 aa  DNAJ_GEOSW RecName: Full=Chaperone protein dnaJ;
    5::71      4e-09  44%  380 aa  DNAJ_ERWT9 RecName: Full=Chaperone protein dnaJ;
    4::70      4e-09  46%  377 aa  DNAJ_DESHY RecName: Full=Chaperone protein dnaJ;
    4::70      4e-09  46%  377 aa  DNAJ_DESHD RecName: Full=Chaperone protein dnaJ;
    6::72      4e-09  44%  381 aa  DNAJ_CLOPH RecName: Full=Chaperone protein dnaJ;
    5::78      4e-09  43%  376 aa  DNAJ_BURTA RecName: Full=Chaperone protein dnaJ;
    5::78      4e-09  43%  378 aa  DNAJ_BURS3 RecName: Full=Chaperone protein dnaJ;
    5::73      4e-09  43%  380 aa  DNAJ_BACTR RecName: Full=Chaperone protein dnaJ;
    5::67      4e-09  42%  375 aa  DNAJ_ACIF5 RecName: Full=Chaperone protein dnaJ;
    5::67      4e-09  42%  375 aa  DNAJ_ACIF2 RecName: Full=Chaperone protein dnaJ;
   10::67      6e-09  44%  412 aa  DNJA2_RAT RecName: Full=DnaJ homolog subfamily A member
   10::67      6e-09  44%  412 aa  DNJA2_MOUSE RecName: Full=DnaJ homolog subfamily A member 2;     
   10::67      6e-09  44%  412 aa  DNJA2_HUMAN RecName: Full=DnaJ homolog subfamily A member
   10::67      6e-09  44%  412 aa  DNJA2_BOVIN RecName: Full=DnaJ homolog subfamily A member 2;
    1::65      6e-09  46%  350 aa  DNAJ_THET2 RecName: Full=Chaperone protein dnaJ;
    5::78      6e-09  46%  375 aa  DNAJ_PSEE4 RecName: Full=Chaperone protein dnaJ;
    4::73      6e-09  39%  391 aa  DNAJ_MYXXA RecName: Full=Chaperone protein dnaJ;
    6::72      6e-09  42%  388 aa  DNAJ_MYCPE RecName: Full=Chaperone protein dnaJ;
    4::70      6e-09  46%  374 aa  DNAJ_MESSB RecName: Full=Chaperone protein dnaJ;
    1::64      6e-09  46%  369 aa  DNAJ_LEIXX RecName: Full=Chaperone protein dnaJ;
    6::67      6e-09  49%  383 aa  DNAJ_LACSS RecName: Full=Chaperone protein dnaJ;
    6::67      6e-09  49%  383 aa  DNAJ_LACSK RecName: Full=Chaperone protein dnaJ;
    5::69      6e-09  44%  382 aa  DNAJ_LACBA RecName: Full=Chaperone protein dnaJ;
    6::71      6e-09  40%  389 aa  DNAJ_ENTFA RecName: Full=Chaperone protein dnaJ;
    4::66      6e-09  47%  403 aa  DNAJ_CHLTE RecName: Full=Chaperone protein dnaJ;
    5::78      6e-09  43%  378 aa  DNAJ_BURVG RecName: Full=Chaperone protein dnaJ;
    5::78      6e-09  43%  378 aa  DNAJ_BURCM RecName: Full=Chaperone protein dnaJ;
    5::78      6e-09  43%  378 aa  DNAJ_BURCJ RecName: Full=Chaperone protein dnaJ;
    5::78      6e-09  43%  378 aa  DNAJ_BURCH RecName: Full=Chaperone protein dnaJ;
    5::78      6e-09  43%  378 aa  DNAJ_BURCC RecName: Full=Chaperone protein dnaJ;
    5::78      6e-09  43%  378 aa  DNAJ_BURCA RecName: Full=Chaperone protein dnaJ;
    5::78      6e-09  43%  378 aa  DNAJ_BURA4 RecName: Full=Chaperone protein dnaJ;
   10::74      6e-09  46%  377 aa  DNAJ_BRAJA RecName: Full=Chaperone protein dnaJ;
    5::73      6e-09  45%  375 aa  DNAJ_BACLD RecName: Full=Chaperone protein dnaJ;
    7::73      6e-09  41%  601 aa  DNAJM_MYCGE RecName: Full=DnaJ-like protein MG200;
    1::65      6e-09  46%  350 aa  DNAJ1_THET8 RecName: Full=Chaperone protein dnaJ 1;
   28::92      6e-09  42%  777 aa  DJC16_CHICK RecName: Full=DnaJ homolog subfamily C member
  110::182     6e-09  37%  379 aa  DJB14_BOVIN RecName: Full=DnaJ homolog subfamily B member 14;
    4::79      6e-09  40%  316 aa  DJB13_HUMAN RecName: Full=DnaJ homolog subfamily B member
  110::180     6e-09  41%  375 aa  DJB12_HUMAN RecName: Full=DnaJ homolog subfamily B member 12;
    9::184     8e-09  30%  355 aa  YHXB_SCHPO RecName: Full=Uncharacterized J domain-containing
    4::68      8e-09  42%  348 aa  DNJB5_MOUSE RecName: Full=DnaJ homolog subfamily B member
    5::71      8e-09  43%  381 aa  DNAJ_VIBSL RecName: Full=Chaperone protein dnaJ;
    5::67      8e-09  47%  379 aa  DNAJ_VIBF1 RecName: Full=Chaperone protein dnaJ;
    5::71      8e-09  43%  385 aa  DNAJ_SILST RecName: Full=Chaperone protein dnaJ;
    5::67      8e-09  46%  380 aa  DNAJ_NITOC RecName: Full=Chaperone protein dnaJ;
    1::63      8e-09  47%  376 aa  DNAJ_DEIRA RecName: Full=Chaperone protein dnaJ;
    5::71      8e-09  44%  378 aa  DNAJ_COLP3 RecName: Full=Chaperone protein dnaJ;
    4::70      8e-09  44%  401 aa  DNAJ_CHLL2 RecName: Full=Chaperone protein dnaJ;
    1::69      8e-09  45%  391 aa  DNAJ_CHLAB RecName: Full=Chaperone protein dnaJ;
    5::71      8e-09  43%  376 aa  DNAJ_BURPS RecName: Full=Chaperone protein dnaJ;
    5::71      8e-09  43%  376 aa  DNAJ_BURP6 RecName: Full=Chaperone protein dnaJ;
    5::71      8e-09  43%  376 aa  DNAJ_BURP1 RecName: Full=Chaperone protein dnaJ;
    5::71      8e-09  43%  376 aa  DNAJ_BURP0 RecName: Full=Chaperone protein dnaJ;
    5::71      8e-09  43%  376 aa  DNAJ_BURMS RecName: Full=Chaperone protein dnaJ;
    5::71      8e-09  43%  376 aa  DNAJ_BURMA RecName: Full=Chaperone protein dnaJ;
    5::71      8e-09  43%  376 aa  DNAJ_BURM9 RecName: Full=Chaperone protein dnaJ;
    5::71      8e-09  43%  376 aa  DNAJ_BURM7 RecName: Full=Chaperone protein dnaJ;
    5::71      8e-09  41%  377 aa  DNAJ_BLOFL RecName: Full=Chaperone protein dnaJ;
    5::71      8e-09  46%  375 aa  DNAJ_ACTAC RecName: Full=Chaperone protein dnaJ;
  110::176     8e-09  41%  379 aa  DJB14_PONAB RecName: Full=DnaJ homolog subfamily B member 14;
  110::176     8e-09  41%  379 aa  DJB14_MOUSE RecName: Full=DnaJ homolog subfamily B member 14;
  110::176     8e-09  41%  379 aa  DJB14_HUMAN RecName: Full=DnaJ homolog subfamily B member 14;
   11::69      1e-08  42%  381 aa  SPJ1_SCHPO RecName: Full=DnaJ-related protein spj1;
    1::71      1e-08  42%  227 aa  DNJB8_MOUSE RecName: Full=DnaJ homolog subfamily B member 8;     
    1::66      1e-08  43%  326 aa  DNJB6_CHICK RecName: Full=DnaJ homolog subfamily B member 6;
    4::68      1e-08  42%  348 aa  DNJB5_HUMAN RecName: Full=DnaJ homolog subfamily B member
    4::68      1e-08  42%  348 aa  DNJB5_BOVIN RecName: Full=DnaJ homolog subfamily B member 5;
    5::71      1e-08  44%  372 aa  DNAJ_PHOLL RecName: Full=Chaperone protein dnaJ;
    6::72      1e-08  41%  391 aa  DNAJ_MYCGA RecName: Full=Chaperone protein dnaJ;
    6::71      1e-08  43%  387 aa  DNAJ_METTE RecName: Full=Chaperone protein dnaJ;
    5::71      1e-08  48%  383 aa  DNAJ_MAGSA RecName: Full=Chaperone protein dnaJ;
    7::67      1e-08  44%  372 aa  DNAJ_LEPIN RecName: Full=Chaperone protein dnaJ;
    7::67      1e-08  44%  372 aa  DNAJ_LEPIC RecName: Full=Chaperone protein dnaJ;
    7::67      1e-08  44%  371 aa  DNAJ_LEPBL RecName: Full=Chaperone protein dnaJ;
    7::67      1e-08  44%  371 aa  DNAJ_LEPBJ RecName: Full=Chaperone protein dnaJ;
    5::66      1e-08  46%  383 aa  DNAJ_LACRJ RecName: Full=Chaperone protein dnaJ;
    5::66      1e-08  46%  383 aa  DNAJ_LACRD RecName: Full=Chaperone protein dnaJ;
    7::69      1e-08  44%  373 aa  DNAJ_GEOSL RecName: Full=Chaperone protein dnaJ;
    4::68      1e-08  42%  376 aa  DNAJ_CYAA5 RecName: Full=Chaperone protein dnaJ;
    1::68      1e-08  45%  359 aa  DNAJ_CAMHC RecName: Full=Chaperone protein dnaJ;
    5::69      1e-08  42%  380 aa  DNAJ_BACST RecName: Full=Chaperone protein dnaJ;
   11::74      1e-08  47%  390 aa  DNAJ2_CORDI RecName: Full=Chaperone protein dnaJ 2;
  104::166     1e-08  45%  371 aa  DJB14_XENLA RecName: Full=DnaJ homolog subfamily B member 14;
   23::88      1e-08  41%  224 aa  HLJ1_YEAST RecName: Full=Protein HLJ1;
    1::69      1e-08  42%  357 aa  DNJB6_RAT RecName: Full=DnaJ homolog subfamily B member
    1::66      1e-08  43%  326 aa  DNJB6_PONAB RecName: Full=DnaJ homolog subfamily B member 6;
    1::69      1e-08  42%  365 aa  DNJB6_MOUSE RecName: Full=DnaJ homolog subfamily B member
    1::66      1e-08  43%  241 aa  DNJB6_MACFA RecName: Full=DnaJ homolog subfamily B member 6;
    1::66      1e-08  43%  326 aa  DNJB6_HUMAN RecName: Full=DnaJ homolog subfamily B member
    1::66      1e-08  43%  242 aa  DNJB6_BOVIN RecName: Full=DnaJ homolog subfamily B member
    1::66      1e-08  44%  242 aa  DNJB3_MOUSE RecName: Full=DnaJ homolog subfamily B member 3;     
    5::77      1e-08  45%  372 aa  DNAJ_THIDA RecName: Full=Chaperone protein dnaJ;
    5::71      1e-08  44%  376 aa  DNAJ_SHEAM RecName: Full=Chaperone protein dnaJ;
    6::70      1e-08  47%  374 aa  DNAJ_PEDPA RecName: Full=Chaperone protein dnaJ;
    6::67      1e-08  46%  370 aa  DNAJ_ERYRH RecName: Full=Chaperone protein dnaJ;
    4::72      1e-08  43%  375 aa  DNAJ_BRECH RecName: Full=Chaperone protein dnaJ;
   10::73      1e-08  43%  396 aa  DNAJ1_STRAW RecName: Full=Chaperone protein dnaJ 1;
    6::67      2e-08  47%  590 aa  JJJ1_YEAST RecName: Full=J protein JJJ1;
    1::66      2e-08  43%  242 aa  DNJB6_XENTR RecName: Full=DnaJ homolog subfamily B member 6;
    4::65      2e-08  44%  340 aa  DNJB1_HUMAN RecName: Full=DnaJ homolog subfamily B member
    4::65      2e-08  44%  340 aa  DNJB1_BOVIN RecName: Full=DnaJ homolog subfamily B member 1;
    1::69      2e-08  41%  250 aa  DNJ6A_XENLA RecName: Full=DnaJ homolog subfamily B member 6-A;
    9::73      2e-08  44%  379 aa  DNAJ_RHOS7 RecName: Full=Chaperone protein dnaJ;
    9::73      2e-08  44%  379 aa  DNAJ_RHOPT RecName: Full=Chaperone protein dnaJ;
    9::73      2e-08  44%  379 aa  DNAJ_RHOPA RecName: Full=Chaperone protein dnaJ;
    5::78      2e-08  43%  374 aa  DNAJ_PSEF5 RecName: Full=Chaperone protein dnaJ;
    4::66      2e-08  46%  382 aa  DNAJ_PELLD RecName: Full=Chaperone protein dnaJ;
    4::70      2e-08  44%  373 aa  DNAJ_NITSB RecName: Full=Chaperone protein dnaJ;
    5::71      2e-08  44%  387 aa  DNAJ_METS4 RecName: Full=Chaperone protein dnaJ;
    5::66      2e-08  44%  388 aa  DNAJ_LACJO RecName: Full=Chaperone protein dnaJ;
    5::76      2e-08  43%  381 aa  DNAJ_GEOTN RecName: Full=Chaperone protein dnaJ;
    5::73      2e-08  43%  382 aa  DNAJ_GEOKA RecName: Full=Chaperone protein dnaJ;
    6::72      2e-08  43%  379 aa  DNAJ_CLOCE RecName: Full=Chaperone protein dnaJ;
    5::71      2e-08  41%  374 aa  DNAJ_BORPD RecName: Full=Chaperone protein dnaJ;
    5::73      2e-08  40%  372 aa  DNAJ_BACSK RecName: Full=Chaperone protein dnaJ;
    5::70      2e-08  41%  371 aa  DNAJ_BACHK RecName: Full=Chaperone protein dnaJ;
    5::70      2e-08  41%  371 aa  DNAJ_BACCZ RecName: Full=Chaperone protein dnaJ;
    5::70      2e-08  41%  371 aa  DNAJ_BACCQ RecName: Full=Chaperone protein dnaJ;
    5::70      2e-08  41%  371 aa  DNAJ_BACC7 RecName: Full=Chaperone protein dnaJ;
    5::70      2e-08  41%  371 aa  DNAJ_BACC3 RecName: Full=Chaperone protein dnaJ;
    5::70      2e-08  41%  371 aa  DNAJ_BACC1 RecName: Full=Chaperone protein dnaJ;
    5::70      2e-08  41%  371 aa  DNAJ_BACC0 RecName: Full=Chaperone protein dnaJ;
    5::70      2e-08  41%  371 aa  DNAJ_BACAN RecName: Full=Chaperone protein dnaJ;
    5::70      2e-08  41%  371 aa  DNAJ_BACAC RecName: Full=Chaperone protein dnaJ;
    5::70      2e-08  41%  371 aa  DNAJ_BACAA RecName: Full=Chaperone protein dnaJ;
    4::70      2e-08  41%  372 aa  DNAJ_ARCB4 RecName: Full=Chaperone protein dnaJ;
    5::67      2e-08  46%  380 aa  DNAJ_AERHH RecName: Full=Chaperone protein dnaJ;
    5::72      2e-08  41%  368 aa  DNAJ_ACIAD RecName: Full=Chaperone protein dnaJ;
    1::66      2e-08  43%  145 aa  DNJB3_HUMAN RecName: Full=DnaJ homolog subfamily B member 3;
    4::65      2e-08  44%  340 aa  DNJB1_MOUSE RecName: Full=DnaJ homolog subfamily B member
    1::62      2e-08  41%  348 aa  DNAJ_TROW8 RecName: Full=Chaperone protein dnaJ;
    5::71      2e-08  43%  376 aa  DNAJ_SHEPW RecName: Full=Chaperone protein dnaJ;
    5::70      2e-08  38%  375 aa  DNAJ_SERP5 RecName: Full=Chaperone protein dnaJ;
    4::66      2e-08  46%  396 aa  DNAJ_PROVI RecName: Full=Chaperone protein dnaJ;
    5::71      2e-08  46%  385 aa  DNAJ_PARL1 RecName: Full=Chaperone protein dnaJ;
    5::71      2e-08  41%  383 aa  DNAJ_DINSH RecName: Full=Chaperone protein dnaJ;
    1::67      2e-08  44%  392 aa  DNAJ_CHLCV RecName: Full=Chaperone protein dnaJ;
    5::70      2e-08  41%  368 aa  DNAJ_BACWK RecName: Full=Chaperone protein dnaJ;
   10::74      2e-08  44%  385 aa  DNAJ2_NOCFA RecName: Full=Chaperone protein dnaJ 2;
    7::68      2e-08  46%  364 aa  DNAJ1_AQUAE RecName: Full=Chaperone protein dnaJ 1;
   25::90      2e-08  47%  358 aa  DJB11_RAT RecName: Full=DnaJ homolog subfamily B member
   25::90      2e-08  47%  358 aa  DJB11_PONAB RecName: Full=DnaJ homolog subfamily B member
   25::90      2e-08  47%  358 aa  DJB11_MOUSE RecName: Full=DnaJ homolog subfamily B member
   25::90      2e-08  47%  358 aa  DJB11_HUMAN RecName: Full=DnaJ homolog subfamily B member
   25::90      2e-08  47%  358 aa  DJB11_CANFA RecName: Full=DnaJ homolog subfamily B member
   25::90      2e-08  47%  358 aa  DJB11_BOVIN RecName: Full=DnaJ homolog subfamily B member
  349::411     3e-08  49%  476 aa  DNJC7_SCHPO RecName: Full=DnaJ homolog subfamily C member 7
    4::65      3e-08  42%  337 aa  DNJB4_MOUSE RecName: Full=DnaJ homolog subfamily B member 4;
    7::66      3e-08  44%  371 aa  DNAJ_STRA1 RecName: Full=Chaperone protein dnaJ;
    9::69      3e-08  47%  379 aa  DNAJ_RHOP2 RecName: Full=Chaperone protein dnaJ;
    5::71      3e-08  44%  388 aa  DNAJ_METNO RecName: Full=Chaperone protein dnaJ;
    5::62      3e-08  49%  380 aa  DNAJ_LACPL RecName: Full=Chaperone protein dnaJ;
    7::69      3e-08  42%  379 aa  DNAJ_LACLS RecName: Full=Chaperone protein dnaJ;
    7::69      3e-08  42%  379 aa  DNAJ_LACLM RecName: Full=Chaperone protein dnaJ;
    5::67      3e-08  44%  373 aa  DNAJ_HAES2 RecName: Full=Chaperone protein dnaJ;
    5::67      3e-08  44%  373 aa  DNAJ_HAES1 RecName: Full=Chaperone protein dnaJ;
    4::65      3e-08  42%  375 aa  DNAJ_CYAP8 RecName: Full=Chaperone protein dnaJ;
    6::68      3e-08  44%  384 aa  DNAJ_CLOD6 RecName: Full=Chaperone protein dnaJ;
    1::69      3e-08  45%  392 aa  DNAJ_CHLTR RecName: Full=Chaperone protein dnaJ;
    1::69      3e-08  45%  392 aa  DNAJ_CHLTB RecName: Full=Chaperone protein dnaJ;
    1::69      3e-08  45%  392 aa  DNAJ_CHLTA RecName: Full=Chaperone protein dnaJ;
    1::69      3e-08  45%  392 aa  DNAJ_CHLT2 RecName: Full=Chaperone protein dnaJ;
    1::69      3e-08  45%  392 aa  DNAJ_CHLMU RecName: Full=Chaperone protein dnaJ;
    1::69      3e-08  45%  391 aa  DNAJ_CHLFF RecName: Full=Chaperone protein dnaJ;
    5::78      3e-08  42%  377 aa  DNAJ_BURP8 RecName: Full=Chaperone protein dnaJ;
    5::70      3e-08  41%  371 aa  DNAJ_BACCR RecName: Full=Chaperone protein dnaJ;
    5::66      3e-08  44%  366 aa  DNAJ_BACCN RecName: Full=Chaperone protein dnaJ;
    5::70      3e-08  41%  371 aa  DNAJ_BACC4 RecName: Full=Chaperone protein dnaJ;
    5::70      3e-08  41%  371 aa  DNAJ_BACC2 RecName: Full=Chaperone protein dnaJ;
    5::71      3e-08  44%  383 aa  DNAJ_ACICJ RecName: Full=Chaperone protein dnaJ;
   11::74      4e-08  47%  459 aa  XDJ1_YEAST RecName: Full=DnaJ protein homolog XDJ1;
   65::130     4e-08  42%  520 aa  TID_DROME RecName: Full=Protein tumorous imaginal discs,
    8::73      4e-08  45%  459 aa  DNJA1_DICDI RecName: Full=DnaJ homolog subfamily A member 1
    1::69      4e-08  39%  245 aa  DNJ6B_XENLA RecName: Full=DnaJ homolog subfamily B member 6-B;
    4::65      4e-08  42%  378 aa  DNAJ_SYNP2 RecName: Full=Chaperone protein dnaJ;
    7::71      4e-08  42%  377 aa  DNAJ_STRT2 RecName: Full=Chaperone protein dnaJ;
    7::71      4e-08  42%  377 aa  DNAJ_STRT1 RecName: Full=Chaperone protein dnaJ;
    5::62      4e-08  47%  377 aa  DNAJ_STACT RecName: Full=Chaperone protein dnaJ;
    5::62      4e-08  45%  379 aa  DNAJ_STAAW RecName: Full=Chaperone protein dnaJ;
    5::62      4e-08  45%  379 aa  DNAJ_STAAU RecName: Full=Chaperone protein dnaJ;
    5::62      4e-08  45%  379 aa  DNAJ_STAAT RecName: Full=Chaperone protein dnaJ;
    5::62      4e-08  45%  379 aa  DNAJ_STAAS RecName: Full=Chaperone protein dnaJ;
    5::62      4e-08  45%  379 aa  DNAJ_STAAR RecName: Full=Chaperone protein dnaJ;
    5::62      4e-08  45%  379 aa  DNAJ_STAAN RecName: Full=Chaperone protein dnaJ;
    5::62      4e-08  45%  379 aa  DNAJ_STAAM RecName: Full=Chaperone protein dnaJ;
    5::62      4e-08  45%  379 aa  DNAJ_STAAE RecName: Full=Chaperone protein dnaJ;
    5::62      4e-08  45%  379 aa  DNAJ_STAAC RecName: Full=Chaperone protein dnaJ;
    5::62      4e-08  45%  379 aa  DNAJ_STAAB RecName: Full=Chaperone protein dnaJ;
    5::62      4e-08  45%  379 aa  DNAJ_STAA9 RecName: Full=Chaperone protein dnaJ;
    5::62      4e-08  45%  379 aa  DNAJ_STAA8 RecName: Full=Chaperone protein dnaJ;
    5::62      4e-08  45%  379 aa  DNAJ_STAA3 RecName: Full=Chaperone protein dnaJ;
    5::62      4e-08  45%  379 aa  DNAJ_STAA2 RecName: Full=Chaperone protein dnaJ;
    5::62      4e-08  45%  379 aa  DNAJ_STAA1 RecName: Full=Chaperone protein dnaJ;
    5::71      4e-08  43%  376 aa  DNAJ_SHEPA RecName: Full=Chaperone protein dnaJ;
    5::71      4e-08  41%  378 aa  DNAJ_PSYCK RecName: Full=Chaperone protein dnaJ;
    5::71      4e-08  40%  374 aa  DNAJ_PSYA2 RecName: Full=Chaperone protein dnaJ;
    5::67      4e-08  46%  373 aa  DNAJ_PELCD RecName: Full=Chaperone protein dnaJ;
    4::69      4e-08  40%  373 aa  DNAJ_MYCMO RecName: Full=Chaperone protein dnaJ;
    5::71      4e-08  39%  372 aa  DNAJ_LYSSC RecName: Full=Chaperone protein dnaJ;
    7::66      4e-08  44%  379 aa  DNAJ_LACLA RecName: Full=Chaperone protein dnaJ;
    5::72      4e-08  42%  382 aa  DNAJ_EHRCJ RecName: Full=Chaperone protein dnaJ;
    5::78      4e-08  43%  380 aa  DNAJ_BURXL RecName: Full=Chaperone protein dnaJ;
    5::78      4e-08  43%  379 aa  DNAJ_BURPP RecName: Full=Chaperone protein dnaJ;
    1::71      5e-08  41%  232 aa  DNJB8_HUMAN RecName: Full=DnaJ homolog subfamily B member 8;
    5::70      5e-08  44%  374 aa  DNAJ_WOLSU RecName: Full=Chaperone protein dnaJ;
    5::71      5e-08  37%  374 aa  DNAJ_WIGBR RecName: Full=Chaperone protein dnaJ;
    7::69      5e-08  42%  377 aa  DNAJ_STRMU RecName: Full=Chaperone protein dnaJ;
    7::66      5e-08  44%  379 aa  DNAJ_STRA5 RecName: Full=Chaperone protein dnaJ;
    7::66      5e-08  44%  379 aa  DNAJ_STRA3 RecName: Full=Chaperone protein dnaJ;
    5::67      5e-08  42%  374 aa  DNAJ_SACD2 RecName: Full=Chaperone protein dnaJ;
    9::73      5e-08  43%  379 aa  DNAJ_RHOPB RecName: Full=Chaperone protein dnaJ;
    4::71      5e-08  41%  377 aa  DNAJ_ORITI RecName: Full=Chaperone protein dnaJ;
    4::71      5e-08  41%  377 aa  DNAJ_ORITB RecName: Full=Chaperone protein dnaJ;
    5::66      5e-08  42%  388 aa  DNAJ_LACGA RecName: Full=Chaperone protein dnaJ;
    5::71      5e-08  40%  377 aa  DNAJ_HAEDU RecName: Full=Chaperone protein dnaJ;
    5::71      5e-08  44%  379 aa  DNAJ_COLMA RecName: Full=Chaperone protein dnaJ;
    5::73      5e-08  42%  370 aa  DNAJ_BACHD RecName: Full=Chaperone protein dnaJ;
    5::67      6e-08  44%  381 aa  DNAJ_VIBPA RecName: Full=Chaperone protein dnaJ;
    4::65      6e-08  42%  394 aa  DNAJ_SYNJA RecName: Full=Chaperone protein dnaJ;
    7::66      6e-08  44%  378 aa  DNAJ_STRPY RecName: Full=Chaperone protein dnaJ;
    7::66      6e-08  44%  378 aa  DNAJ_STRP8 RecName: Full=Chaperone protein dnaJ;
    7::66      6e-08  44%  378 aa  DNAJ_STRP6 RecName: Full=Chaperone protein dnaJ;
    7::66      6e-08  44%  378 aa  DNAJ_STRP3 RecName: Full=Chaperone protein dnaJ;
    7::66      6e-08  44%  378 aa  DNAJ_STRP1 RecName: Full=Chaperone protein dnaJ;
    5::71      6e-08  43%  376 aa  DNAJ_STRM5 RecName: Full=Chaperone protein dnaJ;
    5::71      6e-08  43%  377 aa  DNAJ_SHESR RecName: Full=Chaperone protein dnaJ;
    5::71      6e-08  43%  377 aa  DNAJ_SHESM RecName: Full=Chaperone protein dnaJ;
    5::71      6e-08  40%  378 aa  DNAJ_SHESH RecName: Full=Chaperone protein dnaJ;
    5::71      6e-08  43%  377 aa  DNAJ_SHESA RecName: Full=Chaperone protein dnaJ;
    5::71      6e-08  43%  378 aa  DNAJ_SHEON RecName: Full=Chaperone protein dnaJ;
    5::71      6e-08  43%  376 aa  DNAJ_SHELP RecName: Full=Chaperone protein dnaJ;
    5::71      6e-08  40%  376 aa  DNAJ_SHEHH RecName: Full=Chaperone protein dnaJ;
    4::65      6e-08  46%  383 aa  DNAJ_GLOVI RecName: Full=Chaperone protein dnaJ;
    5::67      6e-08  44%  376 aa  DNAJ_ECO5E RecName: Full=Chaperone protein dnaJ;
    1::64      6e-08  43%  392 aa  DNAJ_CHLPN RecName: Full=Chaperone protein dnaJ;
    4::65      6e-08  42%  374 aa  DNAJ_ACAM1 RecName: Full=Chaperone protein dnaJ;
   31::94      6e-08  43%  284 aa  DNAJ6_ARATH RecName: Full=Chaperone protein dnaJ 6;       
   17::80      6e-08  37%  195 aa  CSP_TORCA RecName: Full=Cysteine string protein;AltName:
    1::62      8e-08  39%  348 aa  DNAJ_TROWT RecName: Full=Chaperone protein dnaJ;
    4::65      8e-08  42%  394 aa  DNAJ_SYNJB RecName: Full=Chaperone protein dnaJ;
    7::66      8e-08  44%  377 aa  DNAJ_STRU0 RecName: Full=Chaperone protein dnaJ;
    5::71      8e-08  41%  377 aa  DNAJ_SHEB9 RecName: Full=Chaperone protein dnaJ;
    5::71      8e-08  41%  377 aa  DNAJ_SHEB8 RecName: Full=Chaperone protein dnaJ;
    5::71      8e-08  41%  377 aa  DNAJ_SHEB5 RecName: Full=Chaperone protein dnaJ;
    5::71      8e-08  41%  377 aa  DNAJ_SHEB2 RecName: Full=Chaperone protein dnaJ;
    1::68      8e-08  45%  386 aa  DNAJ_PARUW RecName: Full=Chaperone protein dnaJ;
    7::66      8e-08  42%  379 aa  DNAJ_LACLC RecName: Full=Chaperone protein dnaJ;
    5::71      8e-08  38%  382 aa  DNAJ_HAEIN RecName: Full=Chaperone protein dnaJ;
    5::71      8e-08  43%  375 aa  DNAJ_COXBN RecName: Full=Chaperone protein dnaJ;
    5::71      8e-08  43%  374 aa  DNAJ_COXB2 RecName: Full=Chaperone protein dnaJ;
    5::71      8e-08  43%  375 aa  DNAJ_COXB1 RecName: Full=Chaperone protein dnaJ;
   15::82      1e-07  39%  260 aa  DNJC9_HUMAN RecName: Full=DnaJ homolog subfamily C member
    5::72      1e-07  37%  365 aa  DNAJ_VESOH RecName: Full=Chaperone protein dnaJ;
    6::67      1e-07  41%  386 aa  DNAJ_TETHA RecName: Full=Chaperone protein dnaJ;
    5::71      1e-07  41%  379 aa  DNAJ_RHOCS RecName: Full=Chaperone protein dnaJ;
    5::66      1e-07  39%  375 aa  DNAJ_OCEIH RecName: Full=Chaperone protein dnaJ;
    5::67      1e-07  44%  375 aa  DNAJ_HAHCH RecName: Full=Chaperone protein dnaJ;
    5::71      1e-07  38%  381 aa  DNAJ_HAEI8 RecName: Full=Chaperone protein dnaJ;
    5::72      1e-07  42%  380 aa  DNAJ_EHRCR RecName: Full=Chaperone protein dnaJ;
    3::71      1e-07  43%  374 aa  DNAJ_CAMJJ RecName: Full=Chaperone protein dnaJ;
    5::71      1e-07  40%  380 aa  DNAJ_ACTPJ RecName: Full=Chaperone protein dnaJ;
    5::71      1e-07  40%  380 aa  DNAJ_ACTP2 RecName: Full=Chaperone protein dnaJ;
   10::73      1e-07  43%  395 aa  DNAJ2_COREF RecName: Full=Chaperone protein dnaJ 2;
   10::74      1e-07  43%  392 aa  YAY1_SCHPO RecName: Full=Uncharacterized J domain-containing
    5::71      1e-07  43%  374 aa  DNAJ_STRMK RecName: Full=Chaperone protein dnaJ;
    5::62      1e-07  45%  378 aa  DNAJ_STAS1 RecName: Full=Chaperone protein dnaJ;
    5::62      1e-07  45%  373 aa  DNAJ_STAES RecName: Full=Chaperone protein dnaJ;
    5::62      1e-07  45%  373 aa  DNAJ_STAEQ RecName: Full=Chaperone protein dnaJ;
    5::71      1e-07  41%  376 aa  DNAJ_SHEFN RecName: Full=Chaperone protein dnaJ;
    5::71      1e-07  41%  384 aa  DNAJ_ROSDO RecName: Full=Chaperone protein dnaJ;
    5::73      1e-07  43%  380 aa  DNAJ_POLNA RecName: Full=Chaperone protein dnaJ;
    7::79      1e-07  44%  390 aa  DNAJ_MYCPN RecName: Full=Chaperone protein dnaJ;
    7::79      1e-07  38%  389 aa  DNAJ_MYCGE RecName: Full=Chaperone protein dnaJ;
    5::71      1e-07  41%  383 aa  DNAJ_METPB RecName: Full=Chaperone protein dnaJ;
    5::71      1e-07  41%  385 aa  DNAJ_METEP RecName: Full=Chaperone protein dnaJ;
    5::71      1e-07  41%  385 aa  DNAJ_METC4 RecName: Full=Chaperone protein dnaJ;
    5::71      1e-07  38%  382 aa  DNAJ_HAEIG RecName: Full=Chaperone protein dnaJ;
    5::67      1e-07  44%  374 aa  DNAJ_DESVM RecName: Full=Chaperone protein dnaJ;
    4::66      1e-07  44%  395 aa  DNAJ_CHLPD RecName: Full=Chaperone protein dnaJ;
   35::105     1e-07  51%  344 aa  DJC25_XENLA RecName: Full=DnaJ homolog subfamily C member 25;
   84::146     1e-07  40%  358 aa  DJC18_MACFA RecName: Full=DnaJ homolog subfamily C member 18;
   84::146     1e-07  40%  358 aa  DJC18_HUMAN RecName: Full=DnaJ homolog subfamily C member 18;
   84::146     1e-07  40%  358 aa  DJC18_BOVIN RecName: Full=DnaJ homolog subfamily C member 18;
    6::92      2e-07  36%  156 aa  DPH4_ASHGO RecName: Full=Diphthamide biosynthesis protein 4;
    1::69      2e-07  39%  309 aa  DNJB7_HUMAN RecName: Full=DnaJ homolog subfamily B member 7;
    5::71      2e-07  41%  377 aa  DNAJ_SHEDO RecName: Full=Chaperone protein dnaJ;
    5::73      2e-07  42%  380 aa  DNAJ_GLUOX RecName: Full=Chaperone protein dnaJ;
    5::68      2e-07  42%  374 aa  DNAJ_GLUDA RecName: Full=Chaperone protein dnaJ;
    5::71      2e-07  44%  382 aa  DNAJ_EHRRW RecName: Full=Chaperone protein dnaJ;
    5::71      2e-07  44%  382 aa  DNAJ_EHRRG RecName: Full=Chaperone protein dnaJ;
    5::67      2e-07  42%  387 aa  DNAJ_CLOPE RecName: Full=Chaperone protein dnaJ;
    3::71      2e-07  42%  373 aa  DNAJ_CAMJR RecName: Full=Chaperone protein dnaJ;
    3::71      2e-07  42%  373 aa  DNAJ_CAMJE RecName: Full=Chaperone protein dnaJ;
    3::71      2e-07  42%  374 aa  DNAJ_CAMJD RecName: Full=Chaperone protein dnaJ;
    5::71      2e-07  40%  377 aa  DNAJ_BUCAT RecName: Full=Chaperone protein dnaJ;
    5::71      2e-07  40%  377 aa  DNAJ_BUCAI RecName: Full=Chaperone protein dnaJ;
    5::71      2e-07  40%  377 aa  DNAJ_BUCA5 RecName: Full=Chaperone protein dnaJ;
    5::71      2e-07  35%  375 aa  DNAJ_BLOPB RecName: Full=Chaperone protein dnaJ;
    5::71      2e-07  41%  379 aa  DNAJ_ANAMM RecName: Full=Chaperone protein dnaJ;
    5::71      2e-07  41%  379 aa  DNAJ_ANAMF RecName: Full=Chaperone protein dnaJ;
   59::129     2e-07  51%  368 aa  DJC25_XENTR RecName: Full=DnaJ homolog subfamily C member 25;
   10::75      2e-07  37%  642 aa  YCJ3_SCHPO RecName: Full=Uncharacterized J domain-containing
  104::165     2e-07  37%  761 aa  SEC63_PONAB RecName: Full=Translocation protein SEC63 homolog;
  104::165     2e-07  37%  760 aa  SEC63_MOUSE RecName: Full=Translocation protein SEC63 homolog;
  104::165     2e-07  37%  760 aa  SEC63_HUMAN RecName: Full=Translocation protein SEC63 homolog;
   99::163     2e-07  39%  354 aa  DNJ49_ARATH RecName: Full=Chaperone protein dnaJ 49;       
    5::71      2e-07  43%  376 aa  DNAJ_XANCP RecName: Full=Chaperone protein dnaJ;
    5::71      2e-07  43%  376 aa  DNAJ_XANCB RecName: Full=Chaperone protein dnaJ;
    5::71      2e-07  43%  376 aa  DNAJ_XANC8 RecName: Full=Chaperone protein dnaJ;
    5::71      2e-07  41%  381 aa  DNAJ_SILPO RecName: Full=Chaperone protein dnaJ;
    4::70      2e-07  41%  391 aa  DNAJ_HALSA RecName: Full=Chaperone protein dnaJ;
    4::70      2e-07  41%  391 aa  DNAJ_HALS3 RecName: Full=Chaperone protein dnaJ;
    3::71      2e-07  42%  374 aa  DNAJ_CAMJ8 RecName: Full=Chaperone protein dnaJ;
    5::71      2e-07  37%  388 aa  DNAJ_BUCCC RecName: Full=Chaperone protein dnaJ;
    5::71      2e-07  41%  382 aa  DNAJ_ANAPZ RecName: Full=Chaperone protein dnaJ;
    5::72      2e-07  39%  379 aa  DNAJ_ACEAC RecName: Full=Chaperone protein dnaJ;
    8::73      2e-07  37%  376 aa  DNAJ2_AQUAE RecName: Full=Chaperone protein dnaJ 2;
    5::71      3e-07  41%  378 aa  DNAJ_SHEWM RecName: Full=Chaperone protein dnaJ;
    5::67      3e-07  41%  381 aa  DNAJ_RHOSK RecName: Full=Chaperone protein dnaJ;
    5::67      3e-07  41%  382 aa  DNAJ_RHOS5 RecName: Full=Chaperone protein dnaJ;
    5::67      3e-07  41%  382 aa  DNAJ_RHOS4 RecName: Full=Chaperone protein dnaJ;
    5::67      3e-07  41%  382 aa  DNAJ_RHOS1 RecName: Full=Chaperone protein dnaJ;
    6::68      3e-07  44%  383 aa  DNAJ_PORGI RecName: Full=Chaperone protein dnaJ;
    5::67      3e-07  39%  377 aa  DNAJ_CLOB8 RecName: Full=Chaperone protein dnaJ;
    5::71      3e-07  38%  378 aa  DNAJ_BUCAP RecName: Full=Chaperone protein dnaJ;
    6::73      3e-07  41%  371 aa  DNAJ_BDEBA RecName: Full=Chaperone protein dnaJ;
    5::70      3e-07  37%  369 aa  DNAJ_ACHLA RecName: Full=Chaperone protein dnaJ;
   14::82      3e-07  42%  559 aa  DJC11_PONAB RecName: Full=DnaJ homolog subfamily C member 11;
   14::82      3e-07  42%  559 aa  DJC11_MOUSE RecName: Full=DnaJ homolog subfamily C member 11;
   14::82      3e-07  42%  559 aa  DJC11_HUMAN RecName: Full=DnaJ homolog subfamily C member 11;
   28::91      4e-07  39%  223 aa  DNJB9_PONAB RecName: Full=DnaJ homolog subfamily B member 9;
   28::91      4e-07  39%  223 aa  DNJB9_HUMAN RecName: Full=DnaJ homolog subfamily B member
    7::66      4e-07  42%  372 aa  DNAJ_STRR6 RecName: Full=Chaperone protein dnaJ;
    7::66      4e-07  42%  378 aa  DNAJ_STRPN RecName: Full=Chaperone protein dnaJ;
    5::68      4e-07  39%  364 aa  DNAJ_RUTMC RecName: Full=Chaperone protein dnaJ;
    4::71      4e-07  39%  384 aa  DNAJ_RHOCA RecName: Full=Chaperone protein dnaJ;
    6::68      4e-07  44%  383 aa  DNAJ_PORG3 RecName: Full=Chaperone protein dnaJ;
    7::71      4e-07  43%  371 aa  DNAJ_FRATW RecName: Full=Chaperone protein dnaJ;
    7::71      4e-07  43%  374 aa  DNAJ_FRATT RecName: Full=Chaperone protein dnaJ;
    7::71      4e-07  43%  374 aa  DNAJ_FRAT1 RecName: Full=Chaperone protein dnaJ;
    7::71      4e-07  39%  374 aa  DNAJ_FRAP2 RecName: Full=Chaperone protein dnaJ;
    5::66      4e-07  39%  368 aa  DNAJ_EXISA RecName: Full=Chaperone protein dnaJ;
    5::71      4e-07  40%  372 aa  DNAJ_BEII9 RecName: Full=Chaperone protein dnaJ;
    5::67      4e-07  46%  380 aa  DNAJ_AERS4 RecName: Full=Chaperone protein dnaJ;
   49::121     4e-07  49%  360 aa  DJC25_HUMAN RecName: Full=DnaJ homolog subfamily C member 25;
   88::176     5e-07  43%  621 aa  DNJC2_MOUSE RecName: Full=DnaJ homolog subfamily C member
   88::176     5e-07  43%  621 aa  DNJC2_MACFA RecName: Full=DnaJ homolog subfamily C member
   88::176     5e-07  43%  621 aa  DNJC2_HUMAN RecName: Full=DnaJ homolog subfamily C member
   88::176     5e-07  43%  621 aa  DNJC2_BOVIN RecName: Full=DnaJ homolog subfamily C member
    5::78      5e-07  43%  376 aa  DNAJ_PSEST RecName: Full=Chaperone protein dnaJ;
    5::71      5e-07  37%  379 aa  DNAJ_PASHA RecName: Full=Chaperone protein dnaJ;
    5::89      5e-07  38%  372 aa  DNAJ_MYCMS RecName: Full=Chaperone protein dnaJ;
    6::71      5e-07  38%  389 aa  DNAJ_METMA RecName: Full=Chaperone protein dnaJ;
    7::71      5e-07  41%  371 aa  DNAJ_FRATU RecName: Full=Chaperone protein dnaJ;
    7::71      5e-07  41%  371 aa  DNAJ_FRATH RecName: Full=Chaperone protein dnaJ;
    5::68      5e-07  42%  372 aa  DNAJ_FINM2 RecName: Full=Chaperone protein dnaJ;
    5::71      5e-07  41%  374 aa  DNAJ_COXBU RecName: Full=Chaperone protein dnaJ;
    5::71      5e-07  41%  374 aa  DNAJ_COXBR RecName: Full=Chaperone protein dnaJ;
    5::67      5e-07  39%  374 aa  DNAJ_CLOAB RecName: Full=Chaperone protein dnaJ;
    5::71      5e-07  41%  383 aa  DNAJ_ALHEH RecName: Full=Chaperone protein dnaJ;
   48::118     5e-07  46%  357 aa  DJC25_RAT RecName: Full=DnaJ homolog subfamily C member 25;
   48::118     5e-07  46%  357 aa  DJC25_MOUSE RecName: Full=DnaJ homolog subfamily C member 25;
    8::129     5e-07  30%  289 aa  CWC23_SCHPO RecName: Full=Pre-mRNA-splicing factor cwc23;AltName:
  115::181     7e-07  34%  403 aa  YNF5_SCHPO RecName: Full=Uncharacterized J domain-containing
   28::91      7e-07  39%  222 aa  DNJB9_RAT RecName: Full=DnaJ homolog subfamily B member
    5::67      7e-07  44%  384 aa  DNAJ_PARDP RecName: Full=Chaperone protein dnaJ;
    6::71      7e-07  38%  382 aa  DNAJ_METAC RecName: Full=Chaperone protein dnaJ;
    5::71      7e-07  38%  385 aa  DNAJ_JANSC RecName: Full=Chaperone protein dnaJ;
    5::67      7e-07  39%  376 aa  DNAJ_CLONN RecName: Full=Chaperone protein dnaJ;
    5::67      7e-07  42%  368 aa  DNAJ_BACSH RecName: Full=Chaperone protein dnaJ;
   12::73      7e-07  43%  395 aa  DNAJ2_CORGL RecName: Full=Chaperone protein dnaJ 2;
    5::78      7e-07  38%  306 aa  CBPA_ECOSM RecName: Full=Curved DNA-binding protein;
    5::78      7e-07  38%  306 aa  CBPA_ECOLU RecName: Full=Curved DNA-binding protein;
    5::78      7e-07  38%  306 aa  CBPA_ECO7I RecName: Full=Curved DNA-binding protein;
    5::78      7e-07  38%  306 aa  CBPA_ECO5E RecName: Full=Curved DNA-binding protein;
    5::78      7e-07  38%  306 aa  CBPA_ECO57 RecName: Full=Curved DNA-binding protein;
   17::80      9e-07  35%  198 aa  DNJC5_RAT RecName: Full=DnaJ homolog subfamily C member
   17::80      9e-07  35%  198 aa  DNJC5_MOUSE RecName: Full=DnaJ homolog subfamily C member
   17::80      9e-07  35%  198 aa  DNJC5_HUMAN RecName: Full=DnaJ homolog subfamily C member
   17::80      9e-07  35%  198 aa  DNJC5_BOVIN RecName: Full=DnaJ homolog subfamily C member
   21::84      9e-07  37%  199 aa  DNJ5B_BOVIN RecName: Full=DnaJ homolog subfamily C member 5B;
   68::130     9e-07  44%  197 aa  DNJ20_ARATH RecName: Full=Chaperone protein dnaJ 20, chloroplastic;
    5::66      9e-07  39%  257 aa  DNAJ_ONYPE RecName: Full=Chaperone protein dnaJ;
    5::70      9e-07  38%  372 aa  DNAJ_MYCCT RecName: Full=Chaperone protein dnaJ;
    5::80      9e-07  43%  380 aa  DNAJ_METPP RecName: Full=Chaperone protein dnaJ;
    5::67      9e-07  37%  373 aa  DNAJ_CLOBB RecName: Full=Chaperone protein dnaJ;
    5::67      9e-07  37%  373 aa  DNAJ_CLOBA RecName: Full=Chaperone protein dnaJ;
    8::68      9e-07  40%  307 aa  DNAJ2_SYNY3 RecName: Full=Chaperone protein dnaJ 2;
  443::505     9e-07  35%  703 aa  DJC14_MOUSE RecName: Full=DnaJ homolog subfamily C member 14;
  443::505     9e-07  35%  699 aa  DJC14_BOVIN RecName: Full=DnaJ homolog subfamily C member
   14::82      9e-07  42%  559 aa  DJC11_BOVIN RecName: Full=DnaJ homolog subfamily C member 11;
   35::100     9e-07  39%  793 aa  DJC10_PONAB RecName: Full=DnaJ homolog subfamily C member 10;Flags:
   35::100     9e-07  39%  793 aa  DJC10_HUMAN RecName: Full=DnaJ homolog subfamily C member
   17::80      9e-07  37%  197 aa  CSP_XENLA RecName: Full=Cysteine string protein;       
    5::66      9e-07  39%  306 aa  CBPA_SHISS RecName: Full=Curved DNA-binding protein;
    5::66      9e-07  39%  306 aa  CBPA_SHIFL RecName: Full=Curved DNA-binding protein;
    5::66      9e-07  39%  306 aa  CBPA_SHIF8 RecName: Full=Curved DNA-binding protein;
    5::66      9e-07  39%  306 aa  CBPA_SHIBS RecName: Full=Curved DNA-binding protein;
    5::66      9e-07  39%  306 aa  CBPA_SHIB3 RecName: Full=Curved DNA-binding protein;
    5::66      9e-07  39%  306 aa  CBPA_SALTY RecName: Full=Curved DNA-binding protein;
    5::66      9e-07  39%  306 aa  CBPA_SALTI RecName: Full=Curved DNA-binding protein;
    5::66      9e-07  39%  306 aa  CBPA_SALSV RecName: Full=Curved DNA-binding protein;
    5::66      9e-07  39%  306 aa  CBPA_SALPK RecName: Full=Curved DNA-binding protein;
    5::66      9e-07  39%  306 aa  CBPA_SALPC RecName: Full=Curved DNA-binding protein;
    5::66      9e-07  39%  306 aa  CBPA_SALPB RecName: Full=Curved DNA-binding protein;
    5::66      9e-07  39%  306 aa  CBPA_SALPA RecName: Full=Curved DNA-binding protein;
    5::66      9e-07  39%  306 aa  CBPA_SALNS RecName: Full=Curved DNA-binding protein;
    5::66      9e-07  39%  306 aa  CBPA_SALHS RecName: Full=Curved DNA-binding protein;
    5::66      9e-07  39%  306 aa  CBPA_SALG2 RecName: Full=Curved DNA-binding protein;
    5::66      9e-07  39%  306 aa  CBPA_SALEP RecName: Full=Curved DNA-binding protein;
    5::66      9e-07  39%  306 aa  CBPA_SALDC RecName: Full=Curved DNA-binding protein;
    5::66      9e-07  39%  306 aa  CBPA_SALAR RecName: Full=Curved DNA-binding protein;
    5::66      9e-07  39%  306 aa  CBPA_SALA4 RecName: Full=Curved DNA-binding protein;
    5::66      9e-07  39%  306 aa  CBPA_ESCF3 RecName: Full=Curved DNA-binding protein;
    5::66      9e-07  39%  306 aa  CBPA_ECOUT RecName: Full=Curved DNA-binding protein;
    5::66      9e-07  39%  306 aa  CBPA_ECOSE RecName: Full=Curved DNA-binding protein;
    5::66      9e-07  39%  306 aa  CBPA_ECOLI RecName: Full=Curved DNA-binding protein;
    5::66      9e-07  39%  306 aa  CBPA_ECOLC RecName: Full=Curved DNA-binding protein;
    5::66      9e-07  39%  306 aa  CBPA_ECOL6 RecName: Full=Curved DNA-binding protein;
    5::66      9e-07  39%  306 aa  CBPA_ECOL5 RecName: Full=Curved DNA-binding protein;
    5::66      9e-07  39%  306 aa  CBPA_ECOK1 RecName: Full=Curved DNA-binding protein;
    5::66      9e-07  39%  306 aa  CBPA_ECOHS RecName: Full=Curved DNA-binding protein;
    5::66      9e-07  39%  306 aa  CBPA_ECODH RecName: Full=Curved DNA-binding protein;
    5::66      9e-07  39%  306 aa  CBPA_ECOBW RecName: Full=Curved DNA-binding protein;
    5::66      9e-07  39%  306 aa  CBPA_ECO8A RecName: Full=Curved DNA-binding protein;
    5::66      9e-07  39%  306 aa  CBPA_ECO81 RecName: Full=Curved DNA-binding protein;
    5::66      9e-07  39%  306 aa  CBPA_ECO55 RecName: Full=Curved DNA-binding protein;
    5::66      9e-07  39%  306 aa  CBPA_ECO45 RecName: Full=Curved DNA-binding protein;
    5::66      9e-07  39%  306 aa  CBPA_ECO27 RecName: Full=Curved DNA-binding protein;
    5::66      9e-07  39%  306 aa  CBPA_ECO24 RecName: Full=Curved DNA-binding protein;
    5::66      9e-07  39%  306 aa  CBPA_CITK8 RecName: Full=Curved DNA-binding protein;
    7::72      1e-06  40%  398 aa  YR260_MIMIV RecName: Full=DnaJ-like protein R260;
   11::75      1e-06  40%  494 aa  RSP1_SCHPO RecName: Full=DnaJ-related protein rsp1;
   84::150     1e-06  36%  528 aa  MDJ1_SCHPO RecName: Full=DnaJ homolog 1, mitochondrial;Flags:
    1::69      1e-06  41%  242 aa  DNJB3_MACFU RecName: Full=DnaJ homolog subfamily B member
    4::69      1e-06  37%  357 aa  DNAJ_PICTO RecName: Full=Chaperone protein dnaJ;
    5::67      1e-06  41%  380 aa  DNAJ_METRJ RecName: Full=Chaperone protein dnaJ;
    5::66      1e-06  41%  374 aa  DNAJ_MESFL RecName: Full=Chaperone protein dnaJ;
    4::66      1e-06  42%  400 aa  DNAJ_CHLCH RecName: Full=Chaperone protein dnaJ;
  443::505     1e-06  35%  703 aa  DJC14_RAT RecName: Full=DnaJ homolog subfamily C member 14;AltName:
    5::66      1e-06  39%  306 aa  CBPA_SHIDS RecName: Full=Curved DNA-binding protein;
  123::197     2e-06  37%  663 aa  SEC63_YEAST RecName: Full=Protein translocation protein
  361::428     2e-06  41%  539 aa  DNJC7_DICDI RecName: Full=DnaJ homolog subfamily C member 7
   88::176     2e-06  42%  621 aa  DNJC2_RAT RecName: Full=DnaJ homolog subfamily C member 2;AltName:
   24::89      2e-06  40%  355 aa  DNJ20_CAEEL RecName: Full=DnaJ homolog dnj-20;AltName: Full=DnaJ
   67::130     2e-06  40%  161 aa  DNJ11_ARATH RecName: Full=Chaperone protein dnaJ 11, chloroplastic;
    5::78      2e-06  39%  379 aa  DNAJ_RALEJ RecName: Full=Chaperone protein dnaJ;
    5::66      2e-06  36%  372 aa  DNAJ_MACCJ RecName: Full=Chaperone protein dnaJ;
    5::73      2e-06  43%  385 aa  DNAJ_LEPCP RecName: Full=Chaperone protein dnaJ;
   37::100     2e-06  38%  793 aa  DJC10_RAT RecName: Full=DnaJ homolog subfamily C member 10;Flags:
   37::100     2e-06  38%  793 aa  DJC10_MOUSE RecName: Full=DnaJ homolog subfamily C member
    5::66      2e-06  39%  306 aa  CBPA_SALCH RecName: Full=Curved DNA-binding protein;
   28::91      2e-06  38%  222 aa  DNJB9_MOUSE RecName: Full=DnaJ homolog subfamily B member 9;     
   21::84      2e-06  37%  199 aa  DNJ5B_MOUSE RecName: Full=DnaJ homolog subfamily C member
   21::84      2e-06  37%  199 aa  DNJ5B_HUMAN RecName: Full=DnaJ homolog subfamily C member
    5::72      2e-06  41%  372 aa  DNAJ_WOLPM RecName: Full=Chaperone protein dnaJ;
    5::67      2e-06  42%  376 aa  DNAJ_TERTT RecName: Full=Chaperone protein dnaJ;
    8::72      2e-06  41%  391 aa  DNAJ_RHOBA RecName: Full=Chaperone protein dnaJ;
    5::79      3e-06  40%  376 aa  DNAJ_TOLAT RecName: Full=Chaperone protein dnaJ;
    5::77      3e-06  41%  380 aa  DNAJ_LARHH RecName: Full=Chaperone protein dnaJ;
    6::69      3e-06  40%  369 aa  DNAJ_HELPY RecName: Full=Chaperone protein dnaJ;
    5::63      3e-06  38%  379 aa  DNAJ_CLOK5 RecName: Full=Chaperone protein dnaJ;
   10::72      3e-06  44%  380 aa  DNAJ2_PROAC RecName: Full=Chaperone protein dnaJ 2;
   33::96      3e-06  42%  333 aa  DJC25_DROME RecName: Full=DnaJ homolog subfamily C member 25
    8::121     4e-06  29%  413 aa  XDJ1_SCHPO RecName: Full=DnaJ protein homolog xdj1;
    1::70      4e-06  36%  184 aa  DNJ72_ARATH RecName: Full=Chaperone protein dnaJ 72;       
    5::71      4e-06  40%  379 aa  DNAJ_ENTS8 RecName: Full=Chaperone protein dnaJ;
    6::66      4e-06  40%  373 aa  DNAJ_CAMLR RecName: Full=Chaperone protein dnaJ;
   54::122     4e-06  30%  163 aa  DNAJ8_ARATH RecName: Full=Chaperone protein dnaJ 8, chloroplastic; 
    5::54      4e-06  49%  347 aa  DNAJ1_AZOSE RecName: Full=Chaperone protein dnaJ 1;
   16::67      5e-06  42%  174 aa  ST_SV40 RecName: Full=Small t antigen;         Short=ST-AG;      
   16::67      5e-06  42%  708 aa  LT_SV40 RecName: Full=Large T antigen;         Short=LT-AG;      
    5::78      5e-06  37%  382 aa  DNAJ_RALPJ RecName: Full=Chaperone protein dnaJ;
    6::69      5e-06  40%  369 aa  DNAJ_HELPJ RecName: Full=Chaperone protein dnaJ;
    8::71      5e-06  38%  391 aa  CAJ1_YEAST RecName: Full=Protein CAJ1;
  390::454     6e-06  36%  502 aa  DNJC3_DICDI RecName: Full=DnaJ homolog subfamily C member 3
    5::71      6e-06  40%  376 aa  DNAJ_SHESW RecName: Full=Chaperone protein dnaJ;
    5::71      6e-06  40%  376 aa  DNAJ_SHEPC RecName: Full=Chaperone protein dnaJ;
    4::70      6e-06  36%  384 aa  DNAJ_HALMA RecName: Full=Chaperone protein dnaJ;
    5::67      6e-06  42%  376 aa  DNAJ_DESVV RecName: Full=Chaperone protein dnaJ;
    5::67      6e-06  42%  376 aa  DNAJ_DESVH RecName: Full=Chaperone protein dnaJ;
   44::115     6e-06  43%  219 aa  DJC30_MOUSE RecName: Full=DnaJ homolog subfamily C member
   16::75      8e-06  37%  168 aa  DPH4_DEBHA RecName: Full=Diphthamide biosynthesis protein 4;
   17::85      8e-06  37%  538 aa  DNJ13_ARATH RecName: Full=Chaperone protein dnaJ 13;       
    6::72      8e-06  34%  368 aa  DNAJ_PEWBP RecName: Full=Chaperone protein dnaJ;
    5::71      8e-06  38%  377 aa  DNAJ_KLEP7 RecName: Full=Chaperone protein dnaJ;
    5::71      8e-06  38%  377 aa  DNAJ_KLEP3 RecName: Full=Chaperone protein dnaJ;
    4::61      8e-06  37%  309 aa  DNAJL_MYCPN RecName: Full=DnaJ-like protein MG002 homolog;
   15::82      1e-05  35%  299 aa  Y6693_DROME RecName: Full=J domain-containing protein CG6693;
   15::82      1e-05  34%  259 aa  DNJC9_MOUSE RecName: Full=DnaJ homolog subfamily C member 9;
    5::71      1e-05  38%  373 aa  DNAJ_METFK RecName: Full=Chaperone protein dnaJ;
    5::78      1e-05  36%  377 aa  DNAJ_CUPTR RecName: Full=Chaperone protein dnaJ;
    4::61      1e-05  39%  310 aa  DNAJL_MYCGE RecName: Full=DnaJ-like protein MG002;
   42::100     1e-05  38%  796 aa  DJC10_XENLA RecName: Full=DnaJ homolog subfamily C member 10;Flags:
   19::82      1e-05  33%  249 aa  CSP_DROME RecName: Full=Cysteine string protein;
    5::67      1e-05  39%  374 aa  DNAJ_SODGM RecName: Full=Chaperone protein dnaJ;
    4::70      1e-05  39%  387 aa  DNAJ_HALWD RecName: Full=Chaperone protein dnaJ;
    5::71      1e-05  38%  382 aa  DNAJ_ENT38 RecName: Full=Chaperone protein dnaJ;
    5::67      1e-05  41%  375 aa  DNAJ_DESDG RecName: Full=Chaperone protein dnaJ;
    4::72      1e-05  35%  375 aa  DNAJ_BREBN RecName: Full=Chaperone protein dnaJ;
   51::122     1e-05  43%  226 aa  DJC30_HUMAN RecName: Full=DnaJ homolog subfamily C member
   11::75      2e-05  38%  551 aa  MU184_SCHPO RecName: Full=Meiotically up-regulated gene 184
   15::76      2e-05  45%  176 aa  HSCB_CUPTR RecName: Full=Co-chaperone protein hscB homolog;
    8::79      2e-05  38%  398 aa  DNJ10_ARATH RecName: Full=Chaperone protein dnaJ 10;       
    5::71      2e-05  37%  371 aa  DNAJ_METSS RecName: Full=Chaperone protein dnaJ;
  442::504     2e-05  32%  702 aa  DJC14_HUMAN RecName: Full=DnaJ homolog subfamily C member
   34::117     2e-05  34%  575 aa  DJC11_DICDI RecName: Full=DnaJ homolog subfamily C member 11
   10::56      2e-05  45%  145 aa  ST_BFPYV RecName: Full=Small t antigen;         Short=ST-AG;     
   10::56      2e-05  45%  587 aa  LT_BFPYV RecName: Full=Large T antigen;         Short=LT-AG;     
  381::448     2e-05  42%  494 aa  DNJC7_PONAB RecName: Full=DnaJ homolog subfamily C member 7;
  381::448     2e-05  42%  494 aa  DNJC7_MOUSE RecName: Full=DnaJ homolog subfamily C member
  381::448     2e-05  42%  494 aa  DNJC7_HUMAN RecName: Full=DnaJ homolog subfamily C member
    5::78      2e-05  36%  379 aa  DNAJ_RALME RecName: Full=Chaperone protein dnaJ;
    5::68      2e-05  38%  376 aa  DNAJ_PELUB RecName: Full=Chaperone protein dnaJ;
    7::71      2e-05  38%  373 aa  DNAJ_DESAD RecName: Full=Chaperone protein dnaJ;
    5::73      2e-05  40%  380 aa  DNAJ_DELAS RecName: Full=Chaperone protein dnaJ;
    4::38      2e-05  54%  401 aa  DNAJ_CHLP8 RecName: Full=Chaperone protein dnaJ;
    8::71      3e-05  40%  432 aa  YIS4_YEAST RecName: Full=Uncharacterized J domain-containing
   16::67      3e-05  40%  172 aa  ST_POVBA RecName: Full=Small t antigen;         Short=ST-AG;     
   16::67      3e-05  40%  691 aa  LT_POVBA RecName: Full=Large T antigen;         Short=LT-AG;     
    6::73      3e-05  38%  162 aa  DPH4_KLULA RecName: Full=Diphthamide biosynthesis protein 4;
    5::71      3e-05  37%  377 aa  DNAJ_THISH RecName: Full=Chaperone protein dnaJ;
    5::39      3e-05  54%  375 aa  DNAJ_AZOSB RecName: Full=Chaperone protein dnaJ;
    8::67      4e-05  33%  181 aa  YR266_MIMIV RecName: Full=Putative J domain-containing protein
   17::79      4e-05  40%  170 aa  JDP_BOMMO RecName: Full=J domain-containing protein;
   17::123     4e-05  32%  173 aa  HSCB_PSEU5 RecName: Full=Co-chaperone protein hscB homolog;
   19::123     4e-05  31%  173 aa  HSCB_PSEPF RecName: Full=Co-chaperone protein hscB homolog;
  394::470     4e-05  40%  504 aa  DNJC3_RAT RecName: Full=DnaJ homolog subfamily C member 3;AltName:
    5::80      4e-05  39%  378 aa  DNAJ_ACIAC RecName: Full=Chaperone protein dnaJ;
    8::71      4e-05  40%  528 aa  APJ1_YEAST RecName: Full=J domain-containing protein APJ1;
    5::35      5e-05  55%  379 aa  DNAJ_YERPY RecName: Full=Chaperone protein dnaJ;
    5::35      5e-05  55%  379 aa  DNAJ_YERPS RecName: Full=Chaperone protein dnaJ;
    5::35      5e-05  55%  379 aa  DNAJ_YERPP RecName: Full=Chaperone protein dnaJ;
    5::35      5e-05  55%  379 aa  DNAJ_YERPN RecName: Full=Chaperone protein dnaJ;
    5::35      5e-05  55%  379 aa  DNAJ_YERPG RecName: Full=Chaperone protein dnaJ;
    5::35      5e-05  55%  379 aa  DNAJ_YERPE RecName: Full=Chaperone protein dnaJ;
    5::35      5e-05  55%  379 aa  DNAJ_YERPB RecName: Full=Chaperone protein dnaJ;
    5::35      5e-05  55%  379 aa  DNAJ_YERPA RecName: Full=Chaperone protein dnaJ;
    5::35      5e-05  55%  379 aa  DNAJ_YERP3 RecName: Full=Chaperone protein dnaJ;
    5::67      5e-05  39%  376 aa  DNAJ_SHISS RecName: Full=Chaperone protein dnaJ;
    5::67      5e-05  39%  376 aa  DNAJ_SHIDS RecName: Full=Chaperone protein dnaJ;
    5::67      5e-05  39%  376 aa  DNAJ_SHIBS RecName: Full=Chaperone protein dnaJ;
    5::67      5e-05  39%  376 aa  DNAJ_SHIB3 RecName: Full=Chaperone protein dnaJ;
    5::67      5e-05  39%  379 aa  DNAJ_SALTY RecName: Full=Chaperone protein dnaJ;
    5::67      5e-05  39%  379 aa  DNAJ_SALTI RecName: Full=Chaperone protein dnaJ;
    5::67      5e-05  39%  379 aa  DNAJ_SALSV RecName: Full=Chaperone protein dnaJ;
    5::67      5e-05  39%  375 aa  DNAJ_SALPK RecName: Full=Chaperone protein dnaJ;
    5::67      5e-05  39%  379 aa  DNAJ_SALPC RecName: Full=Chaperone protein dnaJ;
    5::67      5e-05  39%  379 aa  DNAJ_SALPB RecName: Full=Chaperone protein dnaJ;
    5::67      5e-05  39%  375 aa  DNAJ_SALPA RecName: Full=Chaperone protein dnaJ;
    5::67      5e-05  39%  379 aa  DNAJ_SALNS RecName: Full=Chaperone protein dnaJ;
    5::67      5e-05  39%  379 aa  DNAJ_SALHS RecName: Full=Chaperone protein dnaJ;
    5::67      5e-05  39%  379 aa  DNAJ_SALG2 RecName: Full=Chaperone protein dnaJ;
    5::67      5e-05  39%  379 aa  DNAJ_SALEP RecName: Full=Chaperone protein dnaJ;
    5::67      5e-05  39%  379 aa  DNAJ_SALDC RecName: Full=Chaperone protein dnaJ;
    5::67      5e-05  39%  379 aa  DNAJ_SALCH RecName: Full=Chaperone protein dnaJ;
    5::67      5e-05  39%  379 aa  DNAJ_SALA4 RecName: Full=Chaperone protein dnaJ;
    5::67      5e-05  39%  376 aa  DNAJ_ESCF3 RecName: Full=Chaperone protein dnaJ;
    5::67      5e-05  39%  376 aa  DNAJ_ECOUT RecName: Full=Chaperone protein dnaJ;
    5::67      5e-05  39%  376 aa  DNAJ_ECOSM RecName: Full=Chaperone protein dnaJ;
    5::67      5e-05  39%  376 aa  DNAJ_ECOSE RecName: Full=Chaperone protein dnaJ;
    5::67      5e-05  39%  376 aa  DNAJ_ECOLU RecName: Full=Chaperone protein dnaJ;
    5::67      5e-05  39%  376 aa  DNAJ_ECOLC RecName: Full=Chaperone protein dnaJ;
    5::67      5e-05  39%  376 aa  DNAJ_ECOL6 RecName: Full=Chaperone protein dnaJ;
    5::67      5e-05  39%  376 aa  DNAJ_ECOHS RecName: Full=Chaperone protein dnaJ;
    5::67      5e-05  39%  376 aa  DNAJ_ECO8A RecName: Full=Chaperone protein dnaJ;
    5::67      5e-05  39%  376 aa  DNAJ_ECO81 RecName: Full=Chaperone protein dnaJ;
    5::67      5e-05  39%  376 aa  DNAJ_ECO7I RecName: Full=Chaperone protein dnaJ;
    5::67      5e-05  39%  376 aa  DNAJ_ECO57 RecName: Full=Chaperone protein dnaJ;
    5::67      5e-05  39%  376 aa  DNAJ_ECO55 RecName: Full=Chaperone protein dnaJ;
    5::67      5e-05  39%  376 aa  DNAJ_ECO45 RecName: Full=Chaperone protein dnaJ;
    5::67      5e-05  39%  376 aa  DNAJ_ECO27 RecName: Full=Chaperone protein dnaJ;
    5::67      5e-05  39%  376 aa  DNAJ_ECO24 RecName: Full=Chaperone protein dnaJ;
   99::145     5e-05  40%  150 aa  DJC15_PONAB RecName: Full=DnaJ homolog subfamily C member 15;
   99::145     5e-05  40%  150 aa  DJC15_HUMAN RecName: Full=DnaJ homolog subfamily C member
   16::67      7e-05  38%  172 aa  ST_POVS1 RecName: Full=Small t antigen;         Short=ST-AG;     
   16::67      7e-05  38%  172 aa  ST_POVBK RecName: Full=Small t antigen;         Short=ST-AG;     
   16::67      7e-05  38%  699 aa  LT_POVS1 RecName: Full=Large T antigen;         Short=LT-AG;     
   16::67      7e-05  38%  695 aa  LT_POVBK RecName: Full=Large T antigen;         Short=LT-AG;     
   14::169     7e-05  32%  174 aa  HSCB_SHESR RecName: Full=Co-chaperone protein hscB homolog;
    1::92      7e-05  31%  149 aa  DPH4_CANAL RecName: Full=Diphthamide biosynthesis protein
  394::470     7e-05  39%  504 aa  DNJC3_MOUSE RecName: Full=DnaJ homolog subfamily C member
  394::470     7e-05  39%  504 aa  DNJC3_HUMAN RecName: Full=DnaJ homolog subfamily C member
  394::470     7e-05  39%  504 aa  DNJC3_BOVIN RecName: Full=DnaJ homolog subfamily C member
    5::72      7e-05  34%  374 aa  DNAJ_MARMS RecName: Full=Chaperone protein dnaJ;
    5::72      7e-05  37%  394 aa  DNAJ_FUSNP RecName: Full=Chaperone protein dnaJ;
    5::72      7e-05  36%  392 aa  DNAJ_FUSNN RecName: Full=Chaperone protein dnaJ;
  217::277     7e-05  44%  283 aa  DJLA_VIBF1 RecName: Full=DnaJ-like protein djlA;
   80::145     9e-05  35%  529 aa  TID_DROVI RecName: Full=Protein tumorous imaginal discs,
    8::68      9e-05  37%  380 aa  MU185_SCHPO RecName: Full=Meiotically up-regulated gene 185
   61::122     9e-05  36%  511 aa  MDJ1_YEAST RecName: Full=DnaJ homolog 1, mitochondrial;Flags:
    5::68      9e-05  39%  374 aa  DNAJ_DICNV RecName: Full=Chaperone protein dnaJ;
    5::72      9e-05  34%  370 aa  DNAJ_ACIBY RecName: Full=Chaperone protein dnaJ;
    5::72      9e-05  34%  370 aa  DNAJ_ACIBT RecName: Full=Chaperone protein dnaJ;
    5::72      9e-05  34%  370 aa  DNAJ_ACIBS RecName: Full=Chaperone protein dnaJ;
    5::72      9e-05  34%  370 aa  DNAJ_ACIBC RecName: Full=Chaperone protein dnaJ;
    5::72      9e-05  34%  370 aa  DNAJ_ACIB5 RecName: Full=Chaperone protein dnaJ;
    5::72      9e-05  34%  370 aa  DNAJ_ACIB3 RecName: Full=Chaperone protein dnaJ;
   50::114     9e-05  34%  408 aa  DNAJ1_ARATH RecName: Full=Chaperone protein dnaJ 1, mitochondrial; 
  219::281     9e-05  38%  287 aa  DJLA_VIBVY RecName: Full=DnaJ-like protein djlA;
  219::281     9e-05  38%  287 aa  DJLA_VIBVU RecName: Full=DnaJ-like protein djlA;
   32::75      1e-04  42%  184 aa  JAC1_YEAST RecName: Full=J-type co-chaperone JAC1,
   14::130     1e-04  38%  174 aa  HSCB_SHESM RecName: Full=Co-chaperone protein hscB homolog;
   14::130     1e-04  38%  174 aa  HSCB_SHESA RecName: Full=Co-chaperone protein hscB homolog;
    7::69      1e-04  41%  379 aa  DNAJ_TREDE RecName: Full=Chaperone protein dnaJ;
    5::67      1e-04  37%  376 aa  DNAJ_SHIFL RecName: Full=Chaperone protein dnaJ;
    5::67      1e-04  37%  376 aa  DNAJ_SHIF8 RecName: Full=Chaperone protein dnaJ;
    4::70      1e-04  31%  371 aa  DNAJ_RICAH RecName: Full=Chaperone protein dnaJ;
    1::45      1e-04  44%  331 aa  DNAJ_RHITR RecName: Full=Chaperone protein dnaJ;Flags: Fragment;
    5::76      1e-04  35%  368 aa  DNAJ_MYCH2 RecName: Full=Chaperone protein dnaJ;
    5::67      1e-04  37%  376 aa  DNAJ_ECOLI RecName: Full=Chaperone protein dnaJ;AltName:
    5::67      1e-04  37%  376 aa  DNAJ_ECODH RecName: Full=Chaperone protein dnaJ;
    5::67      1e-04  37%  376 aa  DNAJ_ECOBW RecName: Full=Chaperone protein dnaJ;
   65::116     1e-04  33%  116 aa  TIM14_BOVIN RecName: Full=Mitochondrial import inner membrane
   34::68      1e-04  47%  379 aa  PSI1_SCHPO RecName: Full=Protein psi1;AltName: Full=Protein psi;
  393::469     1e-04  39%  503 aa  DNJC3_CHICK RecName: Full=DnaJ homolog subfamily C member 3;Flags:
    7::67      1e-04  39%  375 aa  DNAJ_LEPBP RecName: Full=Chaperone protein dnaJ;
    7::67      1e-04  39%  375 aa  DNAJ_LEPBA RecName: Full=Chaperone protein dnaJ;
   16::67      2e-04  36%  172 aa  ST_POVJC RecName: Full=Small t antigen;         Short=ST-AG;     
   16::67      2e-04  36%  688 aa  LT_POVJC RecName: Full=Large T antigen;         Short=LT-AG;     
   14::130     2e-04  39%  174 aa  HSCB_SHEON RecName: Full=Co-chaperone protein hscB homolog;
   28::92      2e-04  31%  217 aa  DNJ60_DROME RecName: Full=DnaJ-like protein 60;
    5::72      2e-04  34%  374 aa  DNAJ_WOLTR RecName: Full=Chaperone protein dnaJ;
  279::337     2e-04  37%  341 aa  DJC22_PONAB RecName: Full=DnaJ homolog subfamily C member 22;
   17::79      3e-04  37%  170 aa  JDP_MANSE RecName: Full=J domain-containing protein;
   21::75      3e-04  43%  175 aa  HSCB_BURM1 RecName: Full=Co-chaperone protein hscB homolog;
    5::67      3e-04  37%  387 aa  DNAJ_THICR RecName: Full=Chaperone protein dnaJ;
    4::70      3e-04  33%  371 aa  DNAJ_RICFE RecName: Full=Chaperone protein dnaJ;
    5::78      3e-04  34%  380 aa  DNAJ_RALSO RecName: Full=Chaperone protein dnaJ;
    4::38      3e-04  51%  395 aa  DNAJ_PROA2 RecName: Full=Chaperone protein dnaJ;
  118::166     3e-04  49%  171 aa  YCB2_PSEDE RecName: Full=Uncharacterized 19.0 kDa protein in cobS
  538::612     3e-04  33%  645 aa  JEM1_YEAST RecName: Full=DnaJ-like chaperone JEM1;AltName:
   17::79      3e-04  37%  195 aa  JDP_DROME RecName: Full=J domain-containing protein;AltName:
   19::75      3e-04  40%  176 aa  HSCB_RALSO RecName: Full=Co-chaperone protein hscB homolog;
    8::65      3e-04  32%  396 aa  DNJA1_PONAB RecName: Full=DnaJ homolog subfamily A member 1;
    8::65      3e-04  32%  397 aa  DNJA1_HUMAN RecName: Full=DnaJ homolog subfamily A member
    8::65      3e-04  32%  397 aa  DNJA1_BOVIN RecName: Full=DnaJ homolog subfamily A member 1;
    6::68      3e-04  39%  375 aa  DNAJ_EUBE2 RecName: Full=Chaperone protein dnaJ;
    5::79      3e-04  35%  385 aa  DNAJ_BORPE RecName: Full=Chaperone protein dnaJ;
    8::65      3e-04  32%  397 aa  DNAJ1_CERAE RecName: Full=DnaJ homolog subfamily A member
   53::99      3e-04  41%  388 aa  DJC28_HUMAN RecName: Full=DnaJ homolog subfamily C member 28;
   97::143     3e-04  34%  149 aa  DJC15_MOUSE RecName: Full=DnaJ homolog subfamily C member 15;
   65::116     4e-04  31%  116 aa  TIM14_PONAB RecName: Full=Mitochondrial import inner membrane
   65::116     4e-04  31%  116 aa  TIM14_MOUSE RecName: Full=Mitochondrial import inner membrane
   65::116     4e-04  31%  116 aa  TIM14_HUMAN RecName: Full=Mitochondrial import inner membrane
   14::67      4e-04  44%  174 aa  HSCB_SHESW RecName: Full=Co-chaperone protein hscB homolog;
   14::67      4e-04  44%  174 aa  HSCB_SHEPC RecName: Full=Co-chaperone protein hscB homolog;
    8::65      4e-04  32%  397 aa  DNJA1_RAT RecName: Full=DnaJ homolog subfamily A member
    8::65      4e-04  32%  397 aa  DNJA1_MOUSE RecName: Full=DnaJ homolog subfamily A member
    5::71      4e-04  37%  378 aa  DNAJ_PECCP RecName: Full=Chaperone protein dnaJ;
    5::39      4e-04  46%  377 aa  DNAJ_BORPA RecName: Full=Chaperone protein dnaJ;
    5::39      4e-04  46%  373 aa  DNAJ_BORBR RecName: Full=Chaperone protein dnaJ;
    5::80      4e-04  37%  376 aa  DNAJ_ACISJ RecName: Full=Chaperone protein dnaJ;
   10::73      4e-04  35%  303 aa  DJC17_MOUSE RecName: Full=DnaJ homolog subfamily C member 17;
   10::73      4e-04  35%  304 aa  DJC17_HUMAN RecName: Full=DnaJ homolog subfamily C member 17;
   10::73      4e-04  35%  304 aa  DJC17_BOVIN RecName: Full=DnaJ homolog subfamily C member 17;
   63::108     6e-04  39%  112 aa  TIM14_CAEEL RecName: Full=Mitochondrial import inner membrane
   16::75      6e-04  35%  653 aa  JJJ2_KLULA RecName: Full=J protein JJJ2;
    5::71      6e-04  37%  368 aa  DNAJ_XYLFT RecName: Full=Chaperone protein dnaJ;
    5::71      6e-04  37%  368 aa  DNAJ_XYLFM RecName: Full=Chaperone protein dnaJ;
    5::71      6e-04  37%  368 aa  DNAJ_XYLFA RecName: Full=Chaperone protein dnaJ;
    5::71      6e-04  37%  368 aa  DNAJ_XYLF2 RecName: Full=Chaperone protein dnaJ;
    7::71      6e-04  32%  374 aa  DNAJ_RICM5 RecName: Full=Chaperone protein dnaJ;
    6::70      6e-04  32%  373 aa  DNAJ_RICCN RecName: Full=Chaperone protein dnaJ;
    6::70      6e-04  32%  373 aa  DNAJ_RICAE RecName: Full=Chaperone protein dnaJ;
   97::164     7e-04  44%  442 aa  YOI1_SCHPO RecName: Full=Uncharacterized J domain-containing
   64::115     7e-04  33%  115 aa  TIM14_DANRE RecName: Full=Mitochondrial import inner membrane
   62::107     7e-04  37%  111 aa  TIM14_CAEBR RecName: Full=Mitochondrial import inner membrane
   36::97      7e-04  36%  241 aa  DNJC4_HUMAN RecName: Full=DnaJ homolog subfamily C member
    5::71      7e-04  37%  376 aa  DNAJ_XANOR RecName: Full=Chaperone protein dnaJ;
    5::71      7e-04  37%  376 aa  DNAJ_XANOP RecName: Full=Chaperone protein dnaJ;
    5::71      7e-04  37%  376 aa  DNAJ_XANOM RecName: Full=Chaperone protein dnaJ;
    5::71      7e-04  37%  375 aa  DNAJ_XANC5 RecName: Full=Chaperone protein dnaJ;
    5::71      7e-04  37%  375 aa  DNAJ_XANAC RecName: Full=Chaperone protein dnaJ;
    5::35      7e-04  48%  375 aa  DNAJ_SALAR RecName: Full=Chaperone protein dnaJ;
    6::70      7e-04  32%  373 aa  DNAJ_RICRS RecName: Full=Chaperone protein dnaJ;
    6::70      7e-04  32%  373 aa  DNAJ_RICRO RecName: Full=Chaperone protein dnaJ;
    5::80      7e-04  36%  376 aa  DNAJ_DIAST RecName: Full=Chaperone protein dnaJ;
  893::1029    0.001  27% 1935 aa  MYSS_CYPCA RecName: Full=Myosin heavy chain, fast skeletal muscle;
   14::67      0.001  42%  174 aa  HSCB_SHEB9 RecName: Full=Co-chaperone protein hscB homolog;
   14::67      0.001  42%  174 aa  HSCB_SHEB8 RecName: Full=Co-chaperone protein hscB homolog;
   14::67      0.001  42%  174 aa  HSCB_SHEB5 RecName: Full=Co-chaperone protein hscB homolog;
   14::67      0.001  42%  174 aa  HSCB_SHEB2 RecName: Full=Co-chaperone protein hscB homolog;
   21::75      0.001  39%  175 aa  HSCB_BURTA RecName: Full=Co-chaperone protein hscB homolog;
    5::71      0.001  35%  379 aa  DNAJ_ERWCT RecName: Full=Chaperone protein dnaJ;
  216::278     0.001  38%  284 aa  DJLA_VIBCH RecName: Full=DnaJ-like protein djlA;
  220::279     0.001  39%  286 aa  DJLA_HAEDU RecName: Full=DnaJ-like protein djlA;
  279::333     0.001  36%  341 aa  DJC22_HUMAN RecName: Full=DnaJ homolog subfamily C member 22;
    1::200

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MIDPYVLLGVERDADEAAIKTAYRKVAKAAHPDSGGDGEQFARLQTAYELLKDPVRRRVFDDTGYDPQLA
DNJH_CUCSA      ----YEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGED----
DNJH_ATRNU      ----YEILGVPKDASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAHAYEVLSDPEKREIYDQYGED----
DNAJ3_ARATH     ----YEILGVPKSASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGED----
DNAJ2_ARATH     ----YEILGVPKTAAPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGED----
DNAJ1_PROAC     --DYYEILGVSHDASADEIKKAYRRKAMKLHPDVAGPGEEFKKVQEAYEILQDPQKRAVF-DRGGDP---
DNAJ_THEVO      --DYYKILGVDRNASEEDIKKAFRELAKKWHPDLHPDNEKFKEISEAYEVLSDPEKRRIYDQTG------
DNJ15_ARATH     --DPYEVLCVSKDANDQEIKSAYRKLALKYHPDKNANSELFKEVAFSYSILSDPEKRRHYDNAGFEALDA
DNAJ_YERE8      --DYYEVLGVKKDADEREIKKAYKRLAVKYHPDRNQDGENFKEVKEAYEILTDPQKRAAYDQYGH-----
DNJH2_ALLPO     ----YEVLGVSKNATPEDLKKAYRKAAIKNHPDKGGDPEKFKEIGQAYEVLNDPEKREIYD---------
DNAJ_HALOH      --DYYEILGVSRDADQKEIKKAYRRLARKYHPDINKDDEKFKEISEAYEILSDPDKRARYDQYGH-----
DNAJ_DESPS      -IDYYETLSVERDADQGTIKKAYRKLAMKYHPDNQGDKEAFKECTEAYEVLRDESKRRIYDTYGHE----
DNAJ_ANATD      --DYYEILGVPRNATEEEIKRAYRRLAKQYHPDANPGNEKFKEINEAYEVLSDPEKRKLYDQFGFDPK--
DNAJ_DEIPR      --DYYEVLGVSRSASDSDIKSAYRKLAKQYHPDNAGDAEKFKEIGEAYAVLSDPQKRQAYDQFGHTGQV-
DNAJ2_MYCLE     --DYYGLLGVSRNASDADIKRAYRKLARELHPDINPDQAKFKEISMAYEVLSDPEKRRIV-DLGGDP---
DNAJ_THEAC      --DYYKILGVDRNATDEEIKKAFRELAKKWHPDLHPENEKFKEISEAYEVLSDPQKRRMYDQTG------
DNAJ1_NOCFA     --DYYGLLGVARNATDQEIKRAYRKLARELHPDVNPDQARFKEVSTAYEVLSDPEKRRIV-DMGGDP---
DNAJ2_STRCO     --DYYAVLGVRRDASQDEIKKAFRRLARELHPDVNPDQERFKEINAAYEVLSDPQKKQVY-DLGGDP---
DNAJ2_STRAW     --DYYAVLGVRRDASQDEIKKAFRRLARELHPDVNPDQERFKEINAAYEVLSDPQKKQVY-DLGGDP---
DNAJ2_STRAL     --DYYAVLGVRRDASQDEIKKAFRRLARELHPDVNPDQERFKEINAAYEVLSDPQKKQVY-DLGGDP---
DNJA3_HUMAN     --DYYQILGVPRNASQKEIKKAYYQLAKKYHPDTNKDDEKFSQLAEAYEVLSDEVKRKQYDSAGFDP---
DNAJ_SYNE7      --DYYALLGIPQSADQAAIKAAFRKLARQCHPDNPGDEERFKQISEAYEILSDPDRR-------------
DNAJ_OCHA4      -IDYYEALGVERTADDKVLKTAFRKLAMEYHPDRNPNNRKFKEIGEAYETLKDPQKRAAYDRFGH-----
DNAJ_NITEU      --DYYEVLGVGRDADENELKKAYRKLAMKYHPDNAGDEERFKNIKEAYEILSDPNKRAAYD---------
DNAJ_NATPD      --DFYSVLGVSRDADEDEIKQAYRKKASEYHPDVSDDEEKFKQVKKAKEVLLDDEKRRMYDQMGHE----
DNAJ_CALS8      --DYYEILGVPRNATQEEIKRAYRRLAKQYHPDANPGNEKFKEINEAYEVLSDPEKRRKYDQFGH-----
DNAJ2_MYCTU     --DYYGLLGVSKNASDADIKRAYRKLARELHPDVNPDQAKFKEISVAYEVLSDPDKRRIV-DLGGDP---
DNAJ2_MYCBO     --DYYGLLGVSKNASDADIKRAYRKLARELHPDVNPDQAKFKEISVAYEVLSDPDKRRIV-DLGGDP---
DNJA3_MOUSE     --DYYQILGVPRNASQKDIKKAYYQLAKKYHPDTNKDDEKFSQLAEAYEVLSDEVKRKQYDSAGFDP---
DNAJ_THETN      --DLYEILGVDRNASQEEIKKAYRRLAKKYHPDNPGDKEKFKEINEAYEILSDPQKRAQYDQFGH-----
DNAJ_THEP1      --DYYEILGVPRDATQEEIKRAYKRLVKEWHPDRHPENQRFKEIQEAYEVLSDPQKRAMYDRFGYVGEQP
DNAJ_RICBR      --DYYQILGVSKTANSADLKKAYHKLAKQYHPDNAASGDKFKEINAAYEVLKDEQKRAAYDRFGHD----
DNAJ_BIFLO      MADYYETLGVERGASDDEIKKAYRKLSRKYHPDIAGPEDKFKEVNNAYDVLSNPDKRRMY-DSGVDP---
DNAJ_BARQU      -VDYYEILGVTRECDDKKLKSAFRKLAMQYHPDNAGDKERFKEIGEAYEVLKDPQKRAAYDRFGH-----
DNAJ_BARHE      -VDYYEILGVTRECDDKKLKSAFRKLAMQYHPDNAGDKEKFKEIGEAYEVLKDPQKRAAYDRFGH-----
DNAJ_ACTSZ      --DYYEILGVERGADEKAIKKAYKRLAMKYHPDTKGDEEKFKEINEAYEILSDKEKRAAYDQYGH-----
DNAJ_ZYMMO      -LDYYSLLEVERTADDKTIKTSYRRLAMRYHPDNPGDSERFKAISEAYDCLKDPQKRAAYDRYG------
DNAJ_PSEMY      --DYYEVLGVERGASEAELKKAYRRLAMKYHPDRNPDDEKFKEANEAYEVLSDAGKRSAYDQYGHDPQM-
DNAJ_LACDB      --DYYDVLGVSRDASDAEISKAYRKLAKKYHPDEAGAEEKYKEVNEAYEVLHDPQKRQQYD---------
DNAJ_LACDA      --DYYDVLGVSRDASDAEISKAYRKLAKKYHPDEAGAEEKYKEVNEAYEVLHDPQKRQQYD---------
DNJ16_ARATH     --DPYEVLGVLRNSTDQEIKSAYRKLALKYHPDKTANADMFKEVTFSYNILSDPEKRRQFDSAGFE----
DNAJ_THESQ      --DYYEILGVPRDATQEEIKRAYKRLVKEWHPDRHPENQRFKEIQEAYEVLSDPQKRAMYDRFGY-----
DNAJ_THEMA      --DYYEILGVPRDATQEEIKRAYKRLVKEWHPDRHPENQRFKEIQEAYEVLSDPQKRAMYDRFGY-----
DNAJ_THEM4      --DYYEILGVSRNATQEEIRQAYKKLIKKWHPDRNYENEKFKEIQEAYEVLSDPEKRAMYDKFGY-----
DNAJ_SINMW      --DLYETLGVQKSADEKELKSAFRKLAMKYHPDNPGDNESFKEINEAYETLKDPQKRAAYDRYGH-----
DNAJ_RICB8      --DYYQILGVSKTANSADLKKAYHKLAKQYHPDNAAAGDKFKEINAAYEVLKDEQKRAAYDRFGHD----
DNAJ_CLOTH      --DYYEILGVDRGASDAEIKKAYRKLAKQYHPDNPGDEAKFKEINEAYEVLSDPQKRARYDQFGH-----
YL39_SCHPO      -IDPYSVLGVEKDASDELIRRAYRKKALQHHPDRIHDEEEFDKVAIAYGVLSDKKRRKHYDKTG------
SCJ1_YEAST      --DYYAILEIDKDATEKEIKSAYRQLSKKYHPDKNAGSEEFIEVGEAYDVLSDPEKKKIYDQFGAD----
NOLC_RHIFR      --DLYETLGVARNADEKELKSAFRKLAMQYHPDNPGDQESFKEINQAYETLKDPQKRAAYDRYGH-----
DNJ39_ARATH     --NPYEVLGIPSNSTDQEIKSAYRRMALRYHPDKNPDAEMFKEVTFAYEVLSDPENRRLYDTTG------
DNAJ_SYMTH      --DYYEILGVPRNATEAEIKKAFRNLARKYHPDANKDAEKFKEINEAYQVLSDPEKRARYDQFGH-----
DNAJ_SALRD      --DYYDILGVDEDASDKEIKKAYRKKAMEYHPDRNPDDQKFKEASEAYEVLSDPEKRQRYDQFGHD----
DNAJ_RHIME      --DLYETLGVQKNADEKELKSAFRKLAMKYHPDNPGDQESFKEINEAYETLKDPQKRAAYDRYGH-----
DNAJ_PROMP      MADFYQILGVSRDADANTLKSAYRKLARQYHPDDPGAEDKFKEIGKAYEALADPETRARYDQFG------
DNAJ_HYPNA      --DYYEVLGVERGVDEKALKSAYRKLAMKYHPDNAGDEDKFKEVGEAYAILSDPQKRAAYDRYGH-----
DNAJ_CAUCR      MRDYYEILGVTRTIDEAGLKSAFRKLAMEHHPDRNGGCERFKEINEAYSVLSDPQKRAAYDRFGH-----
DNAJ1_MYCLE     --DFYKELGVSSDASPEEIKRAYRKLARYLHPDANPDGERFKVVSEAHNVLSDPVKRKEYDET-------
DNJH1_ALLPO     -----------KNASPDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYDVLSDPEKREIYDQYGED----
DNAJ_RHISN      --DLYETLGVKKNADEKELKSAFRKLAMKYHPDNPGDQESFKEINEAYETLKDPQKRAAYDRYGH-----
DNAJ_PSEFS      --DYYEVLGVERGSSEADLKKAYRRLAMKHHPDRNPDSEMFKEANEAYECLSDPNKRAAYDQYGHDPSM-
DNAJ_IDILO      --DFYQVLGVSKDANERDIKKAYKRMAMKYHPDTEGDKDKFKEIKQAYEVLSDPQKRQMYDQYGHE----
DNAJ_AGRVS      --DFYETLGVSKTADEKELKSAFRKLAMKFHPDKNGDAEKFKEINEAYETLKDPQKRAAYDRFGH-----
DNAJ_AGRRK      --DYYETLGVSRTADEKELKSAFRKLAMQFHPDKNPDDRKFKEINEAYETLKDPNKRAAYDRYGH-----
DNAJ1_MYCPA     --DYYGLLGVSRGASDAEIKRAYRKLARELHPDVNPDQAKFKEISVAYEVLSDPEKRRI-----------
DNAJ1_CORDI     --DYYAILGVERDATDNEIKKAYRKLARKYHPDVNDTAEKFSKISIAQEVLLDAEKRRIV-DMGGDP---
SIS1_YEAST      ----YDLLGVSPSANEQELKKGYRKAALKYHPDKPGDTEKFKEISEAFEILNDPQKREIYDQYGLE----
DNJA4_HUMAN     ----YDILGVKPSASPEEIKKAYRKLALKYHPDKNPDGEKFKLISQAYEVLSDPKKRDVYDQGG------
DNAJ_RICCK      --DYYQILGVSKTASSAELKKAYHKLAKQYHPDNAAAGDKFKEINAAYDVLKDEQKRAAYDRFGHD----
DNAJ_CARHZ      --DYYEILGVARNATPEEIKKAYRKLARKYHPDVNKDAEKFKEINEAYEVLSDPEKRARYDQFGH-----
DNAJ1_COREF     --DYYGILGVDRNATDSEIKKAYRKLARKYHPDSEEAAEKFREASVAHEVLTDPDKRRIV-DMGGDP---
DNJA4_MOUSE     ----YDILGVKPSASPEEIKKAYRKLALKYHPDKNPDGEKFKLISQAYEVLSDPKKRDIYDQGG------
DNAJ_XANP2      --DYYETLGCDRGADDTVLKASYRKLAMKWHPDSQGNGEMFKEVNEAYEVLKDPQKRAAYD---------
DNAJ_RHIEC      --DFYETLGVAKSADEKELKSAFRKLAMKYHPDKNPDDKEFKEINEAYEMLKDPQKRAAYD---------
DNAJ_HALLT      ----YDVLGVSRDASEEEIKKAYRKQAAEHHPDVSDDDERFKAIQKAKEVLTDEQKRQQYDQLGHD----
DNAJ_DICT6      --DYYEILGVPRNATQDEIKQAYRRLVRQYHPDLNKDHEKFKEINEAYEVLSDPQKRAQYDQFGHVGDFS
DNAJ_AZOVD      --DYYEVLGVERGAGEAELKKAYRRLAMKYHPDRNPDDEKFKEVNEAYEVLSDAGKRMAYDQYGH-----
DNAJ_ANAVT      --DYYEILGVARDADKEEIKQAYRRLARKYHPDEPGAEERFKEINRAYEVLSEPETRARYDRFG------
DNAJ_ANASP      --DYYEILGVARDADKEEIKQAYRRLARKYHPDEPGAEERFKEINRAYEVLSEPETRARYDRFG------
DNAJ2_MYCPA     --DFYKELGVSSDASPEEIKRAYRKLARDLHPDANPDGERFKAVSEAHNVLSDPAKRKEYDET-------
CBPA_COXBU      --DYYKILGVSRDATADEIKKSYRKLARKYHPDVSSEEEKFKQVKEAYEVLKDVEKRKAYDAIG------
CBPA_COXBR      --DYYKILGVSRDATADEIKKSYRKLARKYHPDVSSEEEKFKQVKEAYEVLKDVEKRKAYDAIG------
CBPA_COXBN      --DYYKILGVSRDATADEIKKSYRKLARKYHPDVSSEEEKFKQVKEAYEVLKDVEKRKAYDAIG------
DNAJ_THEAB      --DYYEILGVSRNASQEEIRQAYKQLIKKWHPDRNHQNEKFKEIQEAYEVLSDPEKRAMYDRFGY-----
DNAJ_RHIRD      --DFYETLGVSKTADEKELKSAFRKLAMKYHPDKNPDDRKFKEINEAYETLKDPQKRAAYDRFGH-----
DNAJ_RHILE      --DFYETLGVAKSADEKELKSAFRKLAMKFHPDKNPDDKKFKEINEAYEMLKDPQKRAAYD---------
DNAJ_RHIL3      --DFYETLGVAKSADEKELKSAFRKLAMKYHPDKNPDDKKFKEINEAYEMLKDPQKRAAYD---------
DNAJ_RHIE6      --DFYETLGVAKSADEKELKSAFRKLAMKYHPDKNPDDKKFKEINEAYEMLKDPQKRAAYD---------
DNAJ_PSYWF      --DFYEVLGVDRSADEREIKKAYRKLAMKYHPDRNSDDEKFKEASMAYEVLSDKEKRSAYD---------
DNAJ_PSEPW      --DYYEVLGVERGASEADLKKAYRRLAMKYHPDNPGDKEKFKEANEAYEVLSDASKRAAFDQYGHDPSM-
DNAJ_PSEPG      --DYYEVLGVERGASEADLKKAYRRLAMKYHPDNPGDKEKFKEANEAYEVLSDASKRAAFDQYGHDPSM-
DNAJ_PROMA      MADFYDTLGVNRNADADSLKRAYRRLARQYHPDEAGAEERFKEIGRAYEVLGDPEKRARYDQFG------
DNAJ_NITEC      --DYYEVLGVGRDADESELKKVYRKLAMKYHPDNAGDAERFKEIKEAYEVLSDSNKRAAYD---------
DNAJ_LISMF      --DYYEVLGVSKSASADEIKKAYRKLSKQYHPDEAGADEKFKEISEAYEALSDPQKRAQYDQYGHDP---
DNAJ_LISMC      --DYYEVLGVSKSASADEIKKAYRKLSKQYHPDEAGADEKFKEISEAYEALSDPQKRAQYDQYGHDP---
DNAJ_EXIS2      --DYYEVLGVARDASAAEIKRAYRKLARTYHPDVNKEAQKFKELSEAYEVLSDDNQRARYDQFGHDP---
DNAJ_EDWI9      --DYYEILGVSREADEREIKKAYKRLAMKYHPDNQGDKEKFKEIKEAYEILTDAQKRAAYDQYGH-----
DNAJ_AGRT5      --DFYETLGVSKTADEKELKSAFRKLAMKFHPDKNPDDRKFKEINEAYETLKDPQKRAAYDRFGH-----
DNAJ1_CORGL     --DYYGILGVDRNATESEIKKAYRKLARKYHPDNPGEAEKFREASVAHEVLTDPDKRRIVD---------
CBPA_PSEPW      --DYYKILGVEPTADEKAIKAAYRKLARKYHPDVSKEEEKFKEANEAYEVLGDAQKRAEFDE--------
CBPA_PSEPK      --DYYKILGVEPTADEKAIKAAYRKLARKYHPDVSKEEEKFKEANEAYEVLGDAQKRAEFDE--------
CBPA_PSEP1      --DYYKILGVEPTADEKAIKAAYRKLARKYHPDVSKEEEKFKEANEAYEVLGDAQKRAEFDE--------
DNAJ_TRIEI      --DYYEILGVSRSADKEELKRAYRRLARKYHPDEPGSEERFKEINRAYEILSDPEMKARFD---------
DNAJ_RHILW      --DFYETLGVAKTADEKELKSAFRKLAMKFHPDKNPDDKKFKEINEAYEMLKDPQKRAAYD---------
DNAJ_RALEH      --DYYEVLGVGKNASDDEIKKAYRKLAMKYHPDRNPEGEKFKEVKEAYEMLSDPEKKAAYDQYGHDPNM-
DNAJ_PSEPK      --DYYEVLGVERGATEADLKKAYRRLAMKYHPDNPGDKEKFKEANEAYEVLSDASKRAAFDQYGHDPSM-
DNAJ_PSEP1      --DYYEVLGVERGATEADLKKAYRRLAMKYHPDNPGDKEKFKEANEAYEVLSDASKRAAFDQYGHDPSM-
DNAJ_PROMM      MADYYDLLGVSKDADGDTLKRAYRRLARQYHPDDPGAEDRFKEIGRAYEVLSDPQTRGRYDQFG------
DNAJ_LISMO      --DYYEVLGISKSASADEIKKAYRKLSKQYHPDEAGADEKFKEISEAYEALSDPQKRAQYDQYGHDP---
DNAJ_LISMH      --DYYEVLGISKSASADEIKKAYRKLSKQYHPDEAGADEKFKEISEAYEALSDPQKRAQYDQYGHDP---
DNAJ_LISIN      --DYYEVLGISKSASADEIKKAYRKLSKQYHPDEAGADEKFKEISEAYEALSDPQKRAQYDQYGHDP---
DNAJ_HELHP      --DYYEILEITRTSDKETIKKAYRKMALKYHPDRNPDDEQFKRVNEAYEVLSDDSKRQIYDKYG------
DNAJ2_THET8     --DYYAILGVPRNATQEEIKRAYKRLARQYHPDSPEAEEKFKEINEAYAVLSDPEKRRIYDTYG------
DJC21_HUMAN     ----YEALGVRRDASEEELKKAYRKLALKWHPDKNLDAEQFKLIQAAYDVLSDPQERAWYDN--------
DJC16_PONAB     --DPYKVLGVSRTASQADIKKAYKKLAREWHPDKNGAEDKFIQISKAYEILSNEEKRSNYDQYG------
DNJC1_MOUSE     ----YEFLGVQQDASSADIRKAYRKLSLTLHPDKNKDENQFRQLVAIYEVLKDDERRQRYDD--------
DNJC1_HUMAN     ----YQFLGVQQDASSADIRKAYRKLSLTLHPDKNKDENQFRQLVAIYEVLKDDERRQRYDD--------
DNAJ_VIBVY      --DFYEVLGVSRDASERDIKKAYKRLAMKFHPDNQGDADKFKEVKEAYEILTDPQKKAAYDQYGH-----
DNAJ_VIBVU      --DFYEVLGVSRDASERDIKKAYKRLAMKFHPDNQGDADKFKEVKEAYEILTDPQKKAAYDQYGH-----
DNAJ_RICPR      --DYYQVLGVSKTASQADIKKAYLKLAKQYHPDNANDAEKFKEINAAYDVLKDEQKRAAYDRFGHD----
DNAJ_PHOPR      --DFYEVLGVGRDAGERDIKKAYKRLAMKFHPDRNQEAEKFKEVKTAYEILTDPQKKAAYD---------
DNAJ_MYCPU      --DYYKILGIDKSANEKEIKKAYRKLAMEHHPDRSSSKESEAKMREAYEVLSNPEKKAIYDKYGHE----
DNAJ_MARMM      --DFYEVLGVDKTADEKTLKSAYRKQAMKYHPDNPGDAEQFKVVGEAYSVLSDPNKRAAYDRMGH-----
DNAJ_MARAV      --DYYEVLGISRDADEKEIKRAYRKLAMKYHPDRNPDDKKFKEASEAYEILADSSKRAAYD---------
DNAJ_CYAP4      --DYYDILGVSRDAGQEDLKQAYRRLARKYHPDEAGAEERFKEINRAYEVLSDPETRARYDRFG------
DNAJ_CHRVO      --DYYDVLGVNRDASDDDIKKAYRKLAMKYHPDRNPDSDKFKEVKEAYEILSDSQKRGAYDQFGH-----
DNAJ_CHRSD      --DYYEVLGIERGADQKEIKKAYRRLAQKYHPDRNPDAEKFREVSEAYEVLTDEEKRSAYD---------
DNAJ_AZOC5      --DYYEVLGCDRGADETVLKASFRKLAMKWHPDKNGDPERFKEISEAYEVLKDPQKRGAYD---------
DNAJ1_DROME     --DFYKILGLERKASDDEIKKAYRKLALKYHPDSPQAEERFKEIAEAYEVLSDKKKRDIFDNYGED----
DJC16_HUMAN     --DPYRVLGVSRTASQADIKKAYKKLAREWHPDKNGAEDKFIQISKAYEILSNEEKRSNYDQYG------
CBPA_PSESM      --DYYKILDVEPAADDKAIKTAYRKLARKYHPDEAGAEDKFKEASEAYEVLSSPEKRAEYDE--------
DNAJ_THENN      --DYYEILGVPRNATQEEIRKAYKRLVKEWHPDRHPENQRFKEIQEAYEVLSDPQKRAMYDRFGY-----
DNAJ_SYNP6      --DYYQLLGVARDADKDEIKRAYRRLARKYHPDEPGAEDKFKEINRAYEVLSEPETRARYD---------
DNAJ_RHILO      --DFYETLGVQKGADEKELKSAFRKLAMQFHPDNPGDEHKFKEINEAYETLKDPQKRAAYDRFGH-----
DNAJ_PSESM      --DYYEVLGVERGSSEADLKKAYRRLAMKHHPDRNPDDEMFKEANEAYEVLSDASKRAAYDQYGHDPSM-
DNAJ_OPITP      --DYYELLGVQKGASEEELKKAYRKKAVQYHPDKNPGNEMFKKISHAYEVLKDPEKRAAYD---------
DNAJ_LACCB      --DYYETLGVSRDADDDTIRKAFRKLSKKYHPDAPGAEQKFKDINEAYQVLSDPQKRAAYD---------
DNAJ_LACC3      --DYYETLGVSRDADDDTIRKAFRKLSKKYHPDAPGAEQKFKDINEAYQVLSDPQKRAAYD---------
DNAJ_HYDTH      --DYYQILGVSKDATAEEIKKAYRRLAKEYHPDISADSEKFKEINEAYHILSDEERRKEYD---------
DNAJ_HALHL      --DYYEVLGVNKNASDAEIKKAYRRMAQKFHPDNPGDAERFKEVKEAYEVLSDAQKRAAYDQFGH-----
DNAJ_BRUSU      -IDYYEALGVTRTADDKTLKAAFRKLAMQYHPDRNPDDRKFKEIGEAYETLKDPQKRAAYD---------
DNAJ_BRUSI      -IDYYEALGVTRTADDKTLKAAFRKLAMQYHPDRNPDDRKFKEIGEAYETLKDPQKRAAYD---------
DNAJ_BRUO2      -IDYYEALGVTRTADDKTLKAAFRKLAMQYHPDRNPDDRKFKEIGEAYETLKDPQKRAAYD---------
DNAJ_BRUME      -IDYYEALGVTRTADDKTLKAAFRKLAMQYHPDRNPDDRKFKEIGEAYETLKDPQKRAAYD---------
DNAJ_BRUMB      -IDYYEALGVTRTADDKTLKAAFRKLAMQYHPDRNPDDRKFKEIGEAYETLKDPQKRAAYD---------
DNAJ_BRUC2      -IDYYEALGVTRTADDKTLKAAFRKLAMQYHPDRNPDDRKFKEIGEAYETLKDPQKRAAYD---------
DNAJ_BRUAB      -IDYYEALGVTRTADDKTLKAAFRKLAMQYHPDRNPDDRKFKEIGEAYETLKDPQKRAAYD---------
DNAJ_BRUA2      -IDYYEALGVTRTADDKTLKAAFRKLAMQYHPDRNPDDRKFKEIGEAYETLKDPQKRAAYD---------
DNAJ_BRUA1      -IDYYEALGVTRTADDKTLKAAFRKLAMQYHPDRNPDDRKFKEIGEAYETLKDPQKRAAYD---------
DNAJ2_AZOSE     --DYYEVLGVNRDASDNEIKKAYRKLAMKHHPDRNPDNDHFKEAKNAYEILSDAQKRAAYDRYGH-----
DNAJ1_STRCO     --DYYKVLGVPKDATEAEIKKAYRKLARENHPDANKGNERFKEISEANDILGDPKKRKEYDE--------
DJC21_DANRE     ----YEVLGVKRDASDDDLKKAYRKLALKWHPDKNLDAEQFKLIQAAYDVLSDPQERAWYDN--------
DJC16_RAT       --DPYRVLGVSRTASQADIKKAYKKLAREWHPDKNGAEDKFIQISKAYEILSNEEKRTNYDHYG------
DJC16_MOUSE     --DPYRVLGVSRTASQADIKKAYKKLAREWHPDKNGAEDRFIQISKAYEILSNEEKRTNYDHYG------
DJB14_XENTR     ----YEVLGVSTDAGEEDLKKAYRKLALKFHPDKNGATEAFKKIGNAYAVLSNPEKRKQYDLTGSEDQM-
DNAJ_VIBHB      --DFYEVLGVGRDASERDIKKAYKRLAMKFHPDNQGDADKFKEVKEAYEILTDPQKKAAYDQYGH-----
DNAJ_RICTY      --DYYQVLGVSKTASQADIKKAYLKLAKQYHPDNAHDAEKFKEINAAYDVLKDEQKRAAYDRFGHD----
DNAJ_PSEHT      --DYYEVLGVSKDASERDIKKAYKRLAMKYHPDTSGDKEKFKEVKEAYEILTDAQKRQTYDQYGH-----
DNAJ_PSEAE      --DFYEVLGVERGASEADLKKAYRRLAMKYHPDNPGDKEKFKEANEAYEVLSDASKRAAYDQYGHDPNM-
DNAJ_PSEAB      --DFYEVLGVERGASEADLKKAYRRLAMKYHPDNPGDKEKFKEANEAYEVLSDASKRAAYDQYGHDPNM-
DNAJ_PSEA8      --DFYEVLGVERGASEADLKKAYRRLAMKYHPDNPGDKEKFKEANEAYEVLSDASKRAAYDQYGHDPNM-
DNAJ_PSEA7      --DFYEVLGVERGASEADLKKAYRRLAMKYHPDNPGDKEKFKEANEAYEVLSDASKRAAYDQYGHDPNM-
DNAJ_NEIMF      --DFYATLGVARTATDDEIKKAYRKLAMKYHPDRNPDNEKFKEVQKAYETLSDKEKRAMYDQYGH-----
DNAJ_NEIMB      --DFYATLGVARTATDDEIKKAYRKLAMKYHPDRNPDNEKFKEVQKAYETLSDKEKRAMYDQYGH-----
DNAJ_NEIMA      --DFYATLGVARTATDDEIKKAYRKLAMKYHPDRNPDNEKFKEVQKAYETLSDKEKRAMYDQYGH-----
DNAJ_NEIM0      --DFYATLGVARTATDDEIKKAYRKLAMKYHPDRNPDNEKFKEVQKAYETLSDKEKRAMYDQYGH-----
DNAJ_JANMA      --DFYEILGVGKSASDEEIKKAYRKLAMKHHPDSKGAEDKFKEAKEAYEMLSDPQKRDAYDHAGVDPNM-
DNAJ_CLOTE      --DFYEVLGVEKGANDAEIKKAFRKLALKYHPDKNAGNERFKEINEAYQVLSDPQKRAQYDQFG------
DNAJ_BACP2      --DYYEVLGVSKSASKDEIKKAYRKLSKKYHPDEAGSDEKFKEVKEAYETLSDDQKRSQYDQFGHDP---
DNAJM_MYCPN     --DYYEVLGLSRDADDNDIKKAFRKLAKKYHPDKAPDAAQFAEINEANDVLSNPKKRANYDKYGHD----
DJB13_MOUSE     -LDYYAVLQVTRNSEDAQIKKAYRKLALKNHPSEPGAPEIFKQIAEAYDVLSDPVKRGIYDKFG------
DJB12_MOUSE     --DYYEILGVSRSASDEDLKKAYRKLALKFHPDKNGATEAFKAIGTAYAVLSNPEKRKQYDQFGDDKSQA
DNJ20_CAEBR     --DFYKILGVSKNANANQIKKAYRKQAKELHPDRNPDNEKFQDLSAAYEVLSDKEKRAMYDRHG------
DNAJ_VIBHA      --DFYEVLGVSRDASERDIKKAYKRLAMKYHPDNQGDADKFKEVKESYEILTDPQKKAAYDQYGH-----
DNAJ_VIBCM      --DFYEVLGVGRDASERDIKKAYKRLAMKYHPDDAGAAEKFKEVKEAYEILTDAQKKAAYDQYGH-----
DNAJ_VIBCH      --DFYEVLGVGRDASERDIKKAYKRLAMKYHPDDAGAAEKFKEVKEAYEILTDAQKKAAYDQYGH-----
DNAJ_VIBC3      --DFYEVLGVGRDASERDIKKAYKRLAMKYHPDDAGAAEKFKEVKEAYEILTDAQKKAAYDQYGH-----
DNAJ_PSYIN      --DCYEVLGISRDATEKEVKKAYKRLAMKYHPDSGNDEVKFKEVKEAYEILNDSQKKAAYDQYGHD----
DNAJ_PSEU2      --DYYEVLGVERGSSEADLKKAYRRLAMKHHPDRNPDDELFKEANEAYEVLSDASKRAAYDQYGHDPSM-
DNAJ_PSEA6      --DYYEVLGVEKSASERDIKKAYKRLAMKYHPDTQGDEEKFKEVQEAYEILTDSQKRAAYDQYGH-----
DNAJ_PSE14      --DYYEVLGVERGSSEADLKKAYRRLAMKHHPDRNPDDELFKEANEAYEVLSDASKRAAYDQYGHDPSM-
DNAJ_NEIG1      --DFYATLGVARAATDDEIKKAYRKLAMKYHPDRNPDNEKFKEVQKAYETLSDKEKRAMYDQYGH-----
DNAJ_MICAN      --DYYEILGVSRDAGKEDIKRAYRRLARKYHPDEPGAEEHFKEINRAYEILSEPETRNRYDRFG------
DNAJ_METTH      --DYYEILGVDRGADKKEIKKAYRRLARKYHPDVSDDAEKFKEISEAYAVLSDDEKRARYDRFGH-----
DNAJ_LACF3      --DLYDVLGVKKDASEAEIKRAYRKLAAKYHPDEPGAEKKFKKINEAYETLSDDQKRAQYD---------
DNAJ_HAMD5      --DYYEILGIAKNANEQDIKDAYKRLAKKYHPDRNKDKDKFKEMKEAYEVLSDQQKRAAYDQHGH-----
DNAJ_HALME      --DFYDVLGVSRDASKDQIKNAYRKKAAKYHPDVSDEEEKFKKVQKAKEVLTDDEKRQMYDQLGHE----
DNAJ_CYAP7      --DYYEILGVSRDANKDEIKRAYRRLARKYHPDVNGAEERFKEINRAYEILSEPETRARYD---------
DNAJ_BURM1      --DYYEVLGVAKNASDDEIKKAYRKLAMKYHPDRNPDNEHFKEVKEAYEMLSDSQKRAAYDQYGHDPNM-
DNAJ_BACSU      --DYYEVLGVSKSASKDEIKKAYRKLSKKYHPDEAGSDEKFKEVKEAYETLSDDQKRAHYDQFGHDP---
DNAJ_ALISL      --DFYEVLGVSRDASERDIKKAYKRLAMKFHPDNQGDPEKFKEVKVAYEILTDAQKRAAYDQYGH-----
DNAJ1_SYNY3     --DYYQTLGVTRDADKDEIKRAYRRLARKYHPDEPGAEEKFKEINRAYEVLSEPEIRQRYD---------
DNAJ1_MYCTU     --DFYQELGVSSDASPEEIKRAYRKLARDLHPDANAAGERFKAVSEAHNVLSDPAKRKEYDET-------
DNAJ1_MYCBO     --DFYQELGVSSDASPEEIKRAYRKLARDLHPDANAAGERFKAVSEAHNVLSDPAKRKEYDET-------
CBPA_SERP5      --DYYAILGVKPADDLKAIKTAYRRLARKYHPDVSTESEQFKLVAEAYEVLKDDERRAEYD---------
CBPA_PSEE4      --DYYKILGVEASADEKAIKAAYRKLARKYHPDVSKEEDKFKEANEAYEVLGDKDKRAEYDE--------
DNJB7_MOUSE     MVDYYEVLGVQRYASPEDIKRAYRKVALKWHPDKNPENKEFKEVAEAYEVLSNVEKRDIYDKYGKESHLD
DNAJ_UREPA      --DYYEILGVSKSATPEEIKAAFRKLAKEHHPDKSADDTLFKEINEAYEVLSDSKKRAQYDQFGHD----
DNAJ_SYNFM      --DYYEILGVTRQASEEEIKKAYRKLALKYHPDNPGDEELFKEAAEAYEVLHDAQKKRIYDTYGHE----
DNAJ_ROSS1      --DYYEVLGVQRNASQDEIKKAFRRLARQYHPDKAPDAEKFKEINEAYEVLSDPEKRSMYDRFGH-----
DNAJ_ROSCS      --DYYEVLGVQRNASQDEIKKAFRRLARQYHPDKAPDAEKFKEINEAYEVLSDPEKRSMYDRFGH-----
DNAJ_PROMH      --DFYEVLGLSKTADEKEIKRAYKRLAMKYHPDNQGDKDKFKEIKEAYEVLSDPQKRAAYDQYGH-----
DNAJ_PASMU      --DYYDVLGVERGADEKEIKRAYKKLAMKYHPDRTQGNEKFKEIQEAYEVLSDKQKRANYD---------
DNAJ_METCA      --DYYETLGVPRNASDSDIKKAFRRLAMKYHPDRNKDNERFKSVKEAYDVLSDPKKRSAYDQFGH-----
DNAJ_HERAR      --DFYEILGLGKNASDEEIKKAYRKLAMKHHPDSKGAEDKFKEAKEAYEMLSDPQKRDAYDHAGVDPNM-
DNAJ_BUCBP      --DYYKTLGVTQSSDEREIKRAYKKLAMKYHPDNKNSEEKFKTIKEAYEILIDPKKRTAYDQYGH-----
DNAJ_BACA2      --DYYEVLGVSKSASKDEIKKAYRKLSKKYHPDESGADEKFKEVKEAYEALSDDQKRAQYDQFGHDP---
DNAJH_SYNY3     --DYYQILGVTKTASEAEIKKQFRKLALKYHPDKNGDEEKFKEISEAYEVLSDPEKRQKYDQFG------
DJB12_BOVIN     --DYYEILGVSRGASDEDLKKAYRKLALKFHPDKNGATEAFKAIGTAYAVLSNPEKRKQYDQFGDD----
CBPA_PSEPG      --DYYKILGVEPTADDKAIKAAYRKLARKYHPDVSKEEDKFKEANEAYEVLGDAQKRAEFDE--------
DNJB4_PONAB     --DYYCILGIEKGASDEDIKKAYRKQALKFHPDSPQAEEKFKEVAEAYEVLSDPKKREIYD---------
DNJB4_HUMAN     --DYYCILGIEKGASDEDIKKAYRKQALKFHPDSPQAEEKFKEVAEAYEVLSDPKKREIYD---------
DNJB4_BOVIN     --DYYCILGIEKGASDEDIKKAYRKQALRFHPDSPQAEERFKEVAEAYEVLSDPKKREIYD---------
DNAJ_THEEB      --DFYEILGVSRSADAEELKRAYRRLARKYHPDEPGAEEKFKEINRAYEVLSDPQARANYD---------
DNAJ_SYNPX      MADYYDLLGVGRDADADTLKRAYRSKARKYHPDEPGAEDRFKEIGRAYEVLSDPQTRARYD---------
DNAJ_NOSP7      --DYYEILGVSRDTDKEELKQAYRRLARKYHPDEPGAEDRFKEINRAYEVLSEPETRARYDRFG------
DNAJ_MANSM      --DYYETLGVQKGADEKEIKRAYKRLAMKYHPDTNGDEEKFKEVNEAYEILMDKEKRAAYDQYGH-----
DNAJ_LISW6      --DYYEVLGISKSASADEIKKAYRKLSKQYHPDEAGADEKFKEISEAYEVLSDSQKRAQYDQYGHDP---
DNAJ_LEGPN      --DYYELLEVSRNASDAEIKKAYRRLAMKYHPDNPGDEEKFKEIQKAYNILSDKQKRAAYDQFGHDPSM-
DNAJ_LEGPL      --DYYELLEVSRNASDAEIKKAYRRLAMKYHPDNPGDEEKFKEIQKAYNILSDKQKRAAYDQFGHDPSM-
DNAJ_LEGPH      --DYYELLEVSRNASDAEIKKAYRRLAMKYHPDNPGDEEKFKEIQKAYNILSDKQKRAAYDQFGHDPSM-
DNAJ_LEGPC      --DYYELLEVSRNASDAEIKKAYRRLAMKYHPDNPGDEEKFKEIQKAYNILSDKQKRAAYDQFGHDPSM-
DNAJ_LEGPA      --DYYELLEVSRNASDAEIKKAYRRLAMKYHPDNPGDEEKFKEIQKAYNILSDKQKRAAYDQFGHDPSM-
DNAJ_LACAC      --DYYKVLGVDRDASDQEISKAYRKLAKKYHPDEPGAEEKYKQVNEAYEVLHDKQKRAQYD---------
DNAJ_GEOSW      --DYYEILGVSKNATKEEIKKAYRKLSKKYHPDINKEAEKFKEIKEAYEVLSDDQKRAHYDQFGHDP---
DNAJ_ERWT9      --DYYEILGVAKSADEREIKKAYKRLAMKFHPDNQGDKEKFKEIKEAYEILTDGQKRAAYDQYGH-----
DNAJ_DESHY      --DYYEVLGVSKSADEQEIKKAYRKLARQYHPDNPGDEEKFKEATEAYDVLSDTEKRARYDQMGH-----
DNAJ_DESHD      --DYYEVLGVSKSADEQEIKKAYRKLARQYHPDNPGDEEKFKEATEAYDVLSDTEKRARYDQMGH-----
DNAJ_CLOPH      --DYYEVLGISKSASDDEIKKAYRKLAKQYHPDANGDEAKFKEASEAYAVLSDPEKKRQFDQFGH-----
DNAJ_BURTA      --DYYEVLGVAKNASDDEIKKAYRKLAMKYHPDRNPDSEHFKEAKEAYEMLSDSQKRAAYDQYGHDPNM-
DNAJ_BURS3      --DYYEVLGVAKNAGDDEIKKAYRKLAMKYHPDRNPDNEHFKEVKEAYEMLSDGQKRAAYDQYGHDPNM-
DNAJ_BACTR      --DYYEILGVSKNATKEEIKKAYRKLSKKYHPDINKEAEKFKEIKEAYEVLSDDQKRAHYDQFGHDP---
DNAJ_ACIF5      --DYYEVLEISRTADDGEIKKSYRRLAMRYHPDRNPDDERFKEISAAYEVLSDPQKRQAYD---------
DNAJ_ACIF2      --DYYEVLEISRTADDGEIKKSYRRLAMRYHPDRNPDDERFKEISAAYEVLSDPQKRQAYD---------
DNJA2_RAT       ----YDILGVPPGASENELKKAYRKLAKEYHPDKNPNGDKFKEISFAYEVLSNPEKRELYD---------
DNJA2_MOUSE     ----YDILGVPPGASENELKKAYRKLAKEYHPDKNPNGDKFKEISFAYEVLSNPEKRELYD---------
DNJA2_HUMAN     ----YDILGVPPGASENELKKAYRKLAKEYHPDKNPNGDKFKEISFAYEVLSNPEKRELYD---------
DNJA2_BOVIN     ----YDILGVPPGASENELKKAYRKLAKEYHPDKNPNGDKFKEISFAYEVLSNPEKRELYD---------
DNAJ_THET2      MKDYYAILGVSREASQEEIKKAYRRLALKYHPDNPGDEERFKEINEAYAVLSDPKKRAAYD---------
DNAJ_PSEE4      --DFYEVLGVERGASEGDLKKAYRRLAMKYHPDNPGDKEKFKEANEAYEVLSDTSKRAAYDQYGHDPSM-
DNAJ_MYXXA      --DYYQTLGVDRSASAEDVKKAYRKLARKYHPDNKAAEEKFKQVSAAFEVLSDTRKRKLYDEFGPDAE--
DNAJ_MYCPE      --DYYEVLGVSKDATDDQIKSAFRKKAMQYHPDRNKEEEKFKEVNQAYEVLSDPDKRANYDRFGHE----
DNAJ_MESSB      --DFYETLCVSRNADEKELKSAFRKLAMQYHPDNPGDMEKFKEINEAYETLRDPQKRAAYDRFGH-----
DNAJ_LEIXX      MADHYEVLGVERNATPDEIKKAYRRLARELHPDSTEAQERFKLVTHAYDVLSDPQQRQQYD---------
DNAJ_LACSS      --DYYDVLGVGRDASDDEIKKAYRKLSKKYHPDKAPDAEKFKEVTEAYEALSDPQKRAAYD---------
DNAJ_LACSK      --DYYDVLGVGRDASDDEIKKAYRKLSKKYHPDKAPDAEKFKEVTEAYEALSDPQKRAAYD---------
DNAJ_LACBA      --DLYGVLGVAKDASQDEIKKAYRKLSKKYHPDAPDAAEKFKEVQDAYDVLGDEQKRANYDQSG------
DNAJ_ENTFA      --DYYEVLGLAKGASDDEIKKAYRKLSKKYHPDINKEAEKFKEVSEAYEVLSDPQKKAAYDQYGH-----
DNAJ_CHLTE      --DYYEILGVARSADKDEIKKAYRKLALKYHPDKNPDNEKFKEVNEAYEVLSNDDKRRRYD---------
DNAJ_BURVG      --DYYEVLGVAKNASDDEIKKAYRKLAMKYHPDRNPDNEHFKEAKEAYEMLSDGQKRAAYDQYGHDPNM-
DNAJ_BURCM      --DYYEVLGVAKNASDDEIKKAYRKLAMKYHPDRNPDSEHFKEAKEAYEMLSDGQKRAAYDQYGHDPNM-
DNAJ_BURCJ      --DYYEVLGVAKNASDDEIKKAYRKLAMKYHPDRNPDSEHFKEAKEAYEMLSDGQKRAAYDQYGHDPNM-
DNAJ_BURCH      --DYYEVLGVAKNASDDEIKKAYRKLAMKYHPDRNPDSEHFKEAKEAYEMLSDGQKRAAYDQYGHDPNM-
DNAJ_BURCC      --DYYEVLGVAKNASDDEIKKAYRKLAMKYHPDRNPDSEHFKEAKEAYEMLSDGQKRAAYDQYGHDPNM-
DNAJ_BURCA      --DYYEVLGVAKNASDDEIKKAYRKLAMKYHPDRNPDSEHFKEAKEAYEMLSDGQKRAAYDQYGHDPNM-
DNAJ_BURA4      --DYYEVLGVAKNASDDEIKKAYRKLAMKYHPDRNPDSEHFKEAKEAYEMLSDGQKRAAYDQYGHDPNM-
DNAJ_BRAJA      ----YETLEVERDADESKLKSSFRKLAMKFHPDNPGDDTKFKEINEAYEVLKDKDKRAAYDRFGH-----
DNAJ_BACLD      --DYYEVLGVGKSASKDEIKKAYRKLSKKYHPDEAGAAEKFKEVKEAYETLSDDQKRAHYDQFGHDP---
DNAJM_MYCGE     --DYYEVLGITPDADQSEIKKAFRKLAKKYHPDRNNAPDAFAEINEANDVLSNPKKRANYDKYGFD----
DNAJ1_THET8     MKDYYAILGVSREASQEEIKKAYRRLALKYHPDNPGDEERFKEINEAYAVLSDPKKRAAYD---------
DJC16_CHICK     --DPYRVLGVGRSSSQADIKKAYKRLARQWHPDKNGAEDKFIQISKAYEILSNEEKRANFDRYG------
DJB14_BOVIN     ----YEVLGVTKDAGDEDLKKAYRKLALKFHPDKNGATDAFKKIGNAYAVLSNPEKRKQYDLTGNEEQAC
DJB13_HUMAN     --DYYSVLGITRNSEDAQIKQAYRRLALKHHPNEPSSAEIFRQIAEAYDVLSDPMKRGIYDKFG------
DJB12_HUMAN     --DYYEILGVSRGASDEDLKKAYRRLALKFHPDKNGATEAFKAIGTAYAVLSNPEKRKQYDQFGDDKSQA
YHXB_SCHPO      --DYYDILNISVDADGDTIKKSYRRLAILYHPDKNRENEKFQKLAEAYQVLSDPKLREKYDKLGKVGAVP
DNJB5_MOUSE     --DYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKEEEKFKEIAEAYDVLSDPKKRSLYDQYG------
DNAJ_VIBSL      --DFYEVLGVSRDASERDIKKAYKRLAMKFHPDNQGDADKFKEVKVAYEILTDAQKKAAYDQYGH-----
DNAJ_VIBF1      --DFYEVLGVSRDASERDIKKAYKRLAMKFHPDNQGDAEKFKEVKVAYEILTDAQKRSAYD---------
DNAJ_SILST      --DYYEVLGVSKGASADEIKKGFRKKAKELHPDRNADNAQFKEANEAYDVLKDPERKAAYDRYGH-----
DNAJ_NITOC      --DYYEALGVARNASDAEIKKAYRRLAMRYHPDRNPDDEHFKEIQEAYDVLSDARKRTAYD---------
DNAJ_DEIRA      -MDYYELLGVSRTASADEIKSAYRKLALKLHPDRNGAAEKFAQVSEAYSVLSDTEKRAHYD---------
DNAJ_COLP3      --DYYETLGVSQDASEKEVKKAYKKLAMKYHPDTQGDEETFKEVKEAYEILNDDQKRAAYDQYGH-----
DNAJ_CHLL2      --DYYEVLGVSRSASKDEIKKAYRKLALQYHPDKNPDNEHFKEVNEAYEVLSNDDKRRRYDQFGH-----
DNAJ_CHLAB      -MDYYDVLGVSKTASPEEIKKSYRKLAVKYHPDKNGDAERFKEVSEAYEVLSDPQKRESYDRYGKD----
DNAJ_BURPS      --DYYEVLGVAKNASDDEIKKAYRKLAMKYHPDRNPDSEHFKEAKEAYEMLSDGQKRAAYDQYGH-----
DNAJ_BURP6      --DYYEVLGVAKNASDDEIKKAYRKLAMKYHPDRNPDSEHFKEAKEAYEMLSDGQKRAAYDQYGH-----
DNAJ_BURP1      --DYYEVLGVAKNASDDEIKKAYRKLAMKYHPDRNPDSEHFKEAKEAYEMLSDGQKRAAYDQYGH-----
DNAJ_BURP0      --DYYEVLGVAKNASDDEIKKAYRKLAMKYHPDRNPDSEHFKEAKEAYEMLSDGQKRAAYDQYGH-----
DNAJ_BURMS      --DYYEVLGVAKNASDDEIKKAYRKLAMKYHPDRNPDSEHFKEAKEAYEMLSDGQKRAAYDQYGH-----
DNAJ_BURMA      --DYYEVLGVAKNASDDEIKKAYRKLAMKYHPDRNPDSEHFKEAKEAYEMLSDGQKRAAYDQYGH-----
DNAJ_BURM9      --DYYEVLGVAKNASDDEIKKAYRKLAMKYHPDRNPDSEHFKEAKEAYEMLSDGQKRAAYDQYGH-----
DNAJ_BURM7      --DYYEVLGVAKNASDDEIKKAYRKLAMKYHPDRNPDSEHFKEAKEAYEMLSDGQKRAAYDQYGH-----
DNAJ_BLOFL      --DYYEILGVSKNADEREIKKSYKRLAMKFHPDNPGDESKFKEIKEAYEVLSNPEKRSAYDQYGH-----
DNAJ_ACTAC      --DYYELLGISRSADEKEIKRAYKKLAMQYHPDTKGDXXXXXXIQEAYEVLNDKEKRAAYDQYGH-----
DJB14_PONAB     ----YEVLGVTKDAGDEDLKKAYRKLALKFHPDKNGATDAFKKIGNAYAVLSNPEKRKQYDLTGNEEQ--
DJB14_MOUSE     ----YEVLGVTKDAGDEDLKKAYRKLALKFHPDKNGATDAFKKIGNAYAVLSNPEKRKQYDLTGSEEQ--
DJB14_HUMAN     ----YEVLGVTKDAGDEDLKKAYRKLALKFHPDKNGATDAFKKIGNAYAVLSNPEKRKQYDLTGNEEQ--
SPJ1_SCHPO      ------ILGVSKDASESEIRKAYRQLTKQWHPDKNPGNEEFIEINKAHEVLSDPEQRKIYD---------
DNJB8_MOUSE     MANYYEVLGVQSSASPEDIKKAYRKLALRWHPDKNPDNKEFKQVSEAYEVLSDSKKRSVYDRAGCD----
DNJB6_CHICK     MVDYYEVLGVQKHASAEDIKKAYRKLALKWHPDKNPENQQFKQVAEAYEVLSDAKKRDIYD---------
DNJB5_HUMAN     --DYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKEEEKFKEIAEAYDVLSDPKKRGLYDQYG------
DNJB5_BOVIN     --DYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKEEEKFKEIAEAYDVLSDPKKRGLYDQYG------
DNAJ_PHOLL      --DYYEVLGVSKTASEKEIKKAYKRLAMKYHPDNQGDKEQFKEVKEAYEILTDDQKRAAYDQYGH-----
DNAJ_MYCGA      --DYYEILEVSRSATQQDIKKAFRKLAMKYHPDRNKDSEKFKEVNEAYEVLSDEEKRKLYDTYGHE----
DNAJ_METTE      --DYYEILGLSRDATPEDIKKSYRKLALKYHPDRNGAEEKFKEISEAYAVLSDPEKRAQYDRFGH-----
DNAJ_MAGSA      --DYYELLGVEKGASPDDIKKAYRKQAMQFHPDGNADAEQFKEINEAYDVLKDEQKRAAYDRFGH-----
DNAJ_LEPIN      ----YDILGVSKSANDEEIKSAYRKLAIKYHPDKNKGNEKFKEATEAYEILRDPKKRQAYD---------
DNAJ_LEPIC      ----YDILGVSKSANDEEIKSAYRKLAIKYHPDKNKGNEKFKEATEAYEILRDPKKRQAYD---------
DNAJ_LEPBL      ----YDILGVSKSANDEEIKSAYRKLAIKYHPDKNKGNEKFKEATEAYEILRDPKKRQAYD---------
DNAJ_LEPBJ      ----YDILGVSKSANDEEIKSAYRKLAIKYHPDKNKGNEKFKEATEAYEILRDPKKRQAYD---------
DNAJ_LACRJ      --DYYDILGVSKDASEKDIKRAYRRLAAKYHPDEPGAEEKFKKINEAYETLSDSQKRAQYD---------
DNAJ_LACRD      --DYYDILGVSKDASEKDIKRAYRRLAAKYHPDEPGAEEKFKKINEAYETLSDSQKRAQYD---------
DNAJ_GEOSL      --DYYEVLGVHKNASDTEIKKAFRKLAIQYHPDKNPDDEKFKEITEAYEVLSDPQKRAQYD---------
DNAJ_CYAA5      --DYYDILGVDRNASKEDLKRAYRRLARKYHPDEPGAEERFKEINRAYEVLSEPDTRSRYDQFG------
DNAJ_CAMHC      MSDYYEILGVPKDADSDEIKKAFRKLALKYHPDNAGDEEKFKEINEAYQVLGNDERRQTYDRYG------
DNAJ_BACST      --DYYEILGVSKNATKEEIKKAYRKLSKKYHPDVNKEAEKFKEIKEAYEVLSDDQKRAHYDQFG------
DNAJ2_CORDI     --DYYADLGVSSSATEAEIKKAYRKLARENHPDSPGDAERFKKVAEAYDVVGDETKRKEYDE--------
DJB14_XENLA     ----YEVLGVSPDAGEEDLKKAYRKLALKFHPDKNGATEAFKKIGNAYAVLSNPEKRKQYDLTG------
HLJ1_YEAST      ----YEILKVDRKATDSEIKKAYRKLAIKLHPDKNSHGEAFKVINRAFEVLSNEEKRSIYDRIGRDP---
DNJB6_RAT       MVDYYEVLGVQRHASPEDIKKAYRKQALKWHPDKNPENKEFKQVAEAYEVLSDAKKRDIYDKYG------
DNJB6_PONAB     MVDYYEVLGVQRHASPEDIKKAYRKLALKWHPDKNPENKEFKQVAEAYEVLSDAKKRDIYD---------
DNJB6_MOUSE     MVDYYEVLGVQRHASPEDIKKAYRKQALKWHPDKNPENKEFKQVAEAYEVLSDAKKRDIYDKYG------
DNJB6_MACFA     MVDYYEVLGVQRHASPEDIKKAYRKLALKWHPDKNPENKEFKQVAEAYEVLSDAKKRDIYD---------
DNJB6_HUMAN     MVDYYEVLGVQRHASPEDIKKAYRKLALKWHPDKNPENKEFKQVAEAYEVLSDAKKRDIYD---------
DNJB6_BOVIN     MVDYYEVLGVQRHASAEDIKKAYRKLALKWHPDKNPENKEFKQVAEAYEVLSDAKKRDIYD---------
DNJB3_MOUSE     MVDYYEVLGVPRQASAEAIRKAYRKLALKWHPDKNPEHKEFKQVAQAYEVLSDVRKREVYD---------
DNAJ_THIDA      --DYYEVLGVAKNASDEEIKKAYRKLAMKHHPDNPGDEDKFKEAKQAYEILSDSDKRAAYDQFGHDPQ--
DNAJ_SHEAM      --DYYEVLGVGRDASEREIKKAYKRLAMKYHPDNPGDKESFKEVKEAYEILTDTDKKAAYDQFGH-----
DNAJ_PEDPA      --DYYDILGVSKDASDDEIKKAYRKLSKKYHPDKAPDAEQFKDVNEAYEVLGDSQKRAQYDQFG------
DNAJ_ERYRH      --DFYEILGVSKSATDAEIKKAYRQLAKKYHPDEDGAEAKFKEVQEAYEVLSDSQKRANYD---------
DNAJ_BRECH      --DYYEVLGVGKGADADEIKKAYRKLARQYHPDAADAEEKFKEVKEAYDVLSEPQKRAQYDRFGHDP---
DNAJ1_STRAW     --DYYKVLGVPKDATEAEIKKAYRKLAREFHPDANKGNERFKEISEANDILGDTKKRKEYDE--------
JJJ1_YEAST      ----YELLGVETHASDLELKKAYRKKALQYHPDKNPDNQKFAVIRAAYEVLSDPQERAWYD---------
DNJB6_XENTR     MVEYYDVLGVQRNASPEDIKKAYRKLALKWHPDKNPDNKRFKEVAEAYEVLSDSKKRDIYD---------
DNJB1_HUMAN     --DYYQTLGLARGASDEEIKRAYRRQALRYHPDKNGAEEKFKEIAEAYDVLSDPRKREIFD---------
DNJB1_BOVIN     --DYYQTLGLARGASDEEIKRAYRRQALRYHPDKNGAEEKFKEIAEAYDVLSDPRKREIFD---------
DNJ6A_XENLA     MVEYYEVLGVQRNASADDIKKAYRRLALKWHPDKNPDNKRFKEVAEAYEVLSDSKKRDIYDKYG------
DNAJ_RHOS7      ----YETLEVERNADDSTLKSAFRKLAMKWHPDNPGDPQKFKEINEAYEVLKDGDKRAAYDRYGH-----
DNAJ_RHOPT      ----YETLEVERNADDSTLKSAFRKLAMKWHPDNPGDPQKFKEINEAYEVLKDGDKRAAYDRYGH-----
DNAJ_RHOPA      ----YETLEVERNADDSTLKSAFRKLAMKWHPDNPGDPQKFKEINEAYEVLKDGDKRAAYDRYGH-----
DNAJ_PSEF5      --DYYEVLGVERGSSDAELKKAYRRLAMKHHPDNPGDEDMFKEANEAYEVLSDSSKRAAYDQYGHDPSM-
DNAJ_PELLD      --DYYEVLGVSRSADKDEIKKAYRKLALKYHPDKNPDNDHFKEVNEAYEVLSNDDKRRRYD---------
DNAJ_NITSB      -IDYYELLEVDRNASFEEIKKAYRKLALKYHPDRNPDNEKFKLINEAYQVLSDEEKRALYDQYG------
DNAJ_METS4      --DYYEVLGVAKTAGEAELKSAFRKLAMAYHPDNPGDKEKFKEVNEAYQTLSDDQKRAAYDRFGH-----
DNAJ_LACJO      --DYYDVLGVDKNASESEISKAYRKLAKKYHPDEPGAEEKYKEVNEAYEVLHDKQKRAQYD---------
DNAJ_GEOTN      --DYYEVLGVSKNATKDEIKKAYRKLSKQYHPDAPDAAEKFKEIKEAYEVLSDDEKRARYDRFGHDPNEA
DNAJ_GEOKA      --DYYEILGVSKNATKDEIKKAYRKLSKQYHPDAPDAAEKFKEIKEAYEVLSDDEKRARYDRFGHDP---
DNAJ_CLOCE      --DYYEVLGVDKNASDAELKKAYRNLAKKYHPDNPGDEAKFKEVNEAYEILSDSQKRSRYDQFGH-----
DNAJ_BORPD      --DYYEVLGVAKNATDDELKKAYRKLAMKHHPDRNPDNEKFKEIKEAYEVLGDEQKRAAYDRYGH-----
DNAJ_BACSK      --DYYEVLGVDRNASVEEVKKAYRKLARKYHPDVNKEEDKFKEVKEAYDTLSDPQKKARYDQFGHDP---
DNAJ_BACHK      --DYYEVLGLSKGASKDEIKKAYRRLAKKYHPDVSKEEEKFKEVQEAYEVLSDDQKRAQYDQFGH-----
DNAJ_BACCZ      --DYYEVLGLSKGASKDEIKKAYRRLAKKYHPDVSKEEEKFKEVQEAYEVLSDDQKRAQYDQFGH-----
DNAJ_BACCQ      --DYYEVLGLSKGASKDEIKKAYRRLAKKYHPDVSKEEEKFKEVQEAYEVLSDDQKRAQYDQFGH-----
DNAJ_BACC7      --DYYEVLGLSKGASKDEIKKAYRRLAKKYHPDVSKEEEKFKEVQEAYEVLSDDQKRAQYDQFGH-----
DNAJ_BACC3      --DYYEVLGLSKGASKDEIKKAYRRLAKKYHPDVSKEEEKFKEVQEAYEVLSDDQKRAQYDQFGH-----
DNAJ_BACC1      --DYYEVLGLSKGASKDEIKKAYRRLAKKYHPDVSKEEEKFKEVQEAYEVLSDDQKRAQYDQFGH-----
DNAJ_BACC0      --DYYEVLGLSKGASKDEIKKAYRRLAKKYHPDVSKEEEKFKEVQEAYEVLSDDQKRAQYDQFGH-----
DNAJ_BACAN      --DYYEVLGLSKGASKDEIKKAYRRLAKKYHPDVSKEEEKFKEVQEAYEVLSDDQKRAQYDQFGH-----
DNAJ_BACAC      --DYYEVLGLSKGASKDEIKKAYRRLAKKYHPDVSKEEEKFKEVQEAYEVLSDDQKRAQYDQFGH-----
DNAJ_BACAA      --DYYEVLGLSKGASKDEIKKAYRRLAKKYHPDVSKEEEKFKEVQEAYEVLSDDQKRAQYDQFGH-----
DNAJ_ARCB4      -IDYYELLEISRNSDKSTIKKAYRQMAMKYHPDKNGDNEKFKAINEAYQVLSDDEKKSIYDRYG------
DNAJ_AERHH      --DFYEVLGVSKDADEREIKKAYKRLAMKYHPDDAGAEEKFKEVKEAYEILTDANLRARYD---------
DNAJ_ACIAD      --DYYEVLGVSKTASDDEIKKAYRKLAMKYHPDRNPDNDKFKEASEAYEVLSDSEKRSMYDRMGHN----
DNJB3_HUMAN     MVDYYEVLDVPRQASSEAIKKAYRKLALKWHPDKNPENKEFKQVAEAYEVLSDAKKRDIYD---------
DNJB1_MOUSE     --DYYQTLGLARGASDDEIKRAYRRQALRYHPDKNGAEEKFKEIAEAYDVLSDPRKREIFD---------
DNAJ_TROW8      MEDLYGILGVDHDASVDEIRRAYRRLARELHPDINPDADRFKAVTHAYNILSDPEQRQRYD---------
DNAJ_SHEPW      --DFYEVLGVGRDASEREVKKAYKRLAMKFHPDNPGDKESFKEVKEAYEILTDSDKKAAYDQFGH-----
DNAJ_SERP5      --DYYEILGVSKTAEEREIKKAYKRLAMKFHPDRNQEQDRFKEIKEAYEILTDAQKRAAYDQYGH-----
DNAJ_PROVI      --DYYEILGVGRSADKDEIKKAYRKLALKYHPDKNPDNDHFKEVNEAYEVLSNDDKRRRYD---------
DNAJ_PARL1      --DFYDVLGVSRNASADELKKAYRSLAKKYHPDQNGDKERFKELNEAYDALKDEQSRAAYDQFGH-----
DNAJ_DINSH      --DYYDVLGVSKGASPDEIKKGFRKKAKELHPDRNSDNAQFKEANEAYDILKDPDKKAAYDRYGH-----
DNAJ_CHLCV      -MDYYDVLGVSKTASPEEIKKSYRKLAVKYHPDKNGDAERFKEVSEAYEVLSDPQKRESYDRYG------
DNAJ_BACWK      --DYYEVLGLSQGASKDEIKKAYRRLAKKYHPDVSKEEEKFKEVQEAYEVLSDDQKRAQYDQFGH-----
DNAJ2_NOCFA     --DYYKELGVSSTASQDEIKKAYRKLARDLHPDANGDSERFKAVSEAHAVLSDPAKRKEYDET-------
DNAJ1_AQUAE     --DYYEILGVNRDATKEEIKKAYRKLVRIYHPDINPDQEKFKEINEAYHVLIDDERRSEYD---------
DJB11_RAT       --DFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDEKFQDLGAAYEVLSDSEKRKQYDTYG------
DJB11_PONAB     --DFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDEKFQDLGAAYEVLSDSEKRKQYDTYG------
DJB11_MOUSE     --DFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDEKFQDLGAAYEVLSDSEKRKQYDTYG------
DJB11_HUMAN     --DFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDEKFQDLGAAYEVLSDSEKRKQYDTYG------
DJB11_CANFA     --DFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDEKFQDLGAAYEVLSDSEKRKQYDTYG------
DJB11_BOVIN     --DFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDEKFQDLGAAYEVLSDSEKRKQYDTYG------
DNJC7_SCHPO     --DHYKILGVSKEATDIEIKKAYRKLALVYHPDNAGNLEAEARFKEAYTILSDPESRRRFD---------
DNJB4_MOUSE     --DYYHILGIDKGATDEDVKKAYRKQALKFHPDSPQAEEKFKEVAEAYEVLSDPKKREIYD---------
DNAJ_STRA1      ----YDRLGVSKDASQDEIKKAYRRMSKKYHPDEAGAEEKYKEVQEAYETLSDTQKRAAYD---------
DNAJ_RHOP2      ----YETLEVERSADESTLKSAFRKLAMKWHPDNPGDASKFKEINEAYEVLKDGDKRAAYD---------
DNAJ_METNO      --DYYEVLGVARTAGEGELKSAFRKLAMAYHPDNPGDKEKFKEVNEAYQTLSDGQKRAAYDRFGH-----
DNAJ_LACPL      --DLYKVLGVEKDASQDEIKKAYRKLSKKYHPDEPGAEEKFKAVNEAYETLGDAQKR-------------
DNAJ_LACLS      ----YERLGVDKNASQDEIKKAYRKMSKKYHPDEEGAEDKYKEVQEAYETLSDEQKRAAYDQYG------
DNAJ_LACLM      ----YERLGVDKNASQDEIKKAYRKMSKKYHPDEEGAEDKYKEVQEAYETLSDEQKRAAYDQYG------
DNAJ_HAES2      --DYYEILGVQKGADDKEIKRAYKRLAMKYHPDTKGDEEKFKEINEAYEVLADKEKRAMYD---------
DNAJ_HAES1      --DYYEILGVQKGADDKEIKRAYKRLAMKYHPDTKGDEEKFKEINEAYEVLADKEKRAMYD---------
DNAJ_CYAP8      --DYYETLGVDRNASKEDIKRAYRRLARKYHPDEAGAEDRFKEINRAYEVLSEPETRARYD---------
DNAJ_CLOD6      --DYYEVLGISKGAEAQEIKKAYRKLAMKYHPDNPGDEEKFKEINEAYEVLSDDTKRKTYD---------
DNAJ_CHLTR      -MDYYTILGVAKTATPEEIKKAYRKLAVKYHPDKNGDAERFKEVSEAYEVLGDAQKRESYDRYGKD----
DNAJ_CHLTB      -MDYYTILGVAKTATPEEIKKAYRKLAVKYHPDKNGDAERFKEVSEAYEVLGDAQKRESYDRYGKD----
DNAJ_CHLTA      -MDYYTILGVAKTATPEEIKKAYRKLAVKYHPDKNGDAERFKEVSEAYEVLGDAQKRESYDRYGKD----
DNAJ_CHLT2      -MDYYTILGVAKTATPEEIKKAYRKLAVKYHPDKNGDAERFKEVSEAYEVLGDAQKRESYDRYGKD----
DNAJ_CHLMU      -MDYYTILGVAKTATPEEIKKAYRKLAVKYHPDKNGDAERFKEVSEAYEVLGDAQKRESYDRYGKD----
DNAJ_CHLFF      -MDYYDVLGVSKTASPEEIKKAYRKLAVKYHPDKNGDAERFKEVSEAYEVLSDAQKRESYDRYGKD----
DNAJ_BURP8      --DYYQVLGVAKNASDDEIKKAYRKLAMKHHPDRNPGNEHFKEAKEAYEMLSDSQKRAAYDQYGHDPNM-
DNAJ_BACCR      --DYYEVLGLSKGASTDEIKKAYRRLAKKYHPDVSKEEEKFKEVQEAYEVLSDDQKRAQYDQFGH-----
DNAJ_BACCN      --DYYEVLGVSKSASKDEIKKAYRRLAKKYHPDVSKEEEKFKEVQEAYEVLSDEQKRAQYD---------
DNAJ_BACC4      --DYYEVLGLSKGASTDEIKKAYRRLAKKYHPDVSKEEEKFKEVQEAYEVLSDDQKRAQYDQFGH-----
DNAJ_BACC2      --DYYEVLGLSKGASTDEIKKAYRRLAKKYHPDVSKEEEKFKEVQEAYEVLSDDQKRAQYDQFGH-----
DNAJ_ACICJ      --DYYELLGVSRGASADELKKAYRKLAMQYHPDNPGDAQKFKDINEAYDVLKDEQKRAAYDRFGH-----
XDJ1_YEAST      ----YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDKFKEITAAYEILSDPEKKSHYD---------
TID_DROME       --DYYATLGVAKNANGKDIKKAYYQLAKKYHPDTNKEGRKFQEVSEAYEVLSDEQKRREYDTYG------
DNJA1_DICDI     ----YERLGVKPDCTEDELKKAYRKMAVKYHPDKNGPGKKFKDISEAYEVLSDPEKRKMYDSYG------
DNJ6B_XENLA     MVEYYDVLGVQRNSSPDDIKKAYRRLALKWHPDKNPDNKEFKEVAEAYEVLSDSKKRDIYDKYG------
DNAJ_SYNP2      --DFYEILGVSRDCGKDELKRAYRRLARQYHPDDPGAEEKFKEINRAYEVLSEPETRARYD---------
DNAJ_STRT2      ----YDRLGLSKDASQDEIKRAYRKLSKKYHPDEPGAEEKYKEILEAYETLSDAQKRAAYDQYGPD----
DNAJ_STRT1      ----YDRLGLSKDASQDEIKRAYRKLSKKYHPDEPGAEEKYKEILEAYETLSDAQKRAAYDQYGPD----
DNAJ_STACT      --DYYEVLGVSKDASKDEIKKAYRKLSKKYHPDEEGAEEKFKEISEAYEVLSDENKR-------------
DNAJ_STAAW      --DYYEVLGISKDASKDEIKKAYRKLSKKYHPDEEGADEKFKEISEAYEVLSDDNKR-------------
DNAJ_STAAU      --DYYEVLGISKDASKDEIKKAYRKLSKKYHPDEEGADEKFKEISEAYEVLSDDNKR-------------
DNAJ_STAAT      --DYYEVLGISKDASKDEIKKAYRKLSKKYHPDEEGADEKFKEISEAYEVLSDDNKR-------------
DNAJ_STAAS      --DYYEVLGISKDASKDEIKKAYRKLSKKYHPDEEGADEKFKEISEAYEVLSDDNKR-------------
DNAJ_STAAR      --DYYEVLGISKDASKDEIKKAYRKLSKKYHPDEEGADEKFKEISEAYEVLSDDNKR-------------
DNAJ_STAAN      --DYYEVLGISKDASKDEIKKAYRKLSKKYHPDEEGADEKFKEISEAYEVLSDDNKR-------------
DNAJ_STAAM      --DYYEVLGISKDASKDEIKKAYRKLSKKYHPDEEGADEKFKEISEAYEVLSDDNKR-------------
DNAJ_STAAE      --DYYEVLGISKDASKDEIKKAYRKLSKKYHPDEEGADEKFKEISEAYEVLSDDNKR-------------
DNAJ_STAAC      --DYYEVLGISKDASKDEIKKAYRKLSKKYHPDEEGADEKFKEISEAYEVLSDDNKR-------------
DNAJ_STAAB      --DYYEVLGISKDASKDEIKKAYRKLSKKYHPDEEGADEKFKEISEAYEVLSDDNKR-------------
DNAJ_STAA9      --DYYEVLGISKDASKDEIKKAYRKLSKKYHPDEEGADEKFKEISEAYEVLSDDNKR-------------
DNAJ_STAA8      --DYYEVLGISKDASKDEIKKAYRKLSKKYHPDEEGADEKFKEISEAYEVLSDDNKR-------------
DNAJ_STAA3      --DYYEVLGISKDASKDEIKKAYRKLSKKYHPDEEGADEKFKEISEAYEVLSDDNKR-------------
DNAJ_STAA2      --DYYEVLGISKDASKDEIKKAYRKLSKKYHPDEEGADEKFKEISEAYEVLSDDNKR-------------
DNAJ_STAA1      --DYYEVLGISKDASKDEIKKAYRKLSKKYHPDEEGADEKFKEISEAYEVLSDDNKR-------------
DNAJ_SHEPA      --DYYEVLGVGRDTSEREIKKAYKRLAMKFHPDNPGDKENFKEVKEAYEILTDSDKKAAYDQFGH-----
DNAJ_PSYCK      --DFYEILGVSKTADNKEIKRAYRKLAMKYHPDRNSEDEKFKEASMAYEVLSSEEKRSAYDRMGH-----
DNAJ_PSYA2      --DFYEILGVSKTADNKEVKRAYRKLAMKYHPDRNSDDDKFKEASMAYEVLSSEEKRSAYDRMGH-----
DNAJ_PELCD      --DYYEVLGVHRNASETEIKKAYRKLAIKYHPDNAGDEDKFKEISEAYSILSDTQQRVIYD---------
DNAJ_MYCMO      --DYYEILGLTKSASKDEIKKAYRTLAKTYHPDVNKEEEKFKEITEAYEILNDDVKREQYNQFGH-----
DNAJ_LYSSC      --DYYEVLGLTKSATKDEIKKAYRKLSKQYHPDEPGADEKFKEIAEAYEVLSDDQKKARYDQFGHE----
DNAJ_LACLA      ----YERLGVDKNASQDEIKKAYRKMSKKYHPDEEGAEEKYKEVQEAYETLSDEQKRAAYD---------
DNAJ_EHRCJ      --DYYELLGVSKNATSEEIKKAYRKMALKYHPDTNPGNEKFKELSEAYDVLIDQDKRAAYDKYGHN----
DNAJ_BURXL      --DYYEVLGVAKNASDDEIKKAYRKLAMKHHPDGNKDAEHFKEVKEAYEMLSDSQKRAAYDQYGHDPNM-
DNAJ_BURPP      --DYYEVLGVAKNASDDEIKKAYRKLAMKHHPDGNKDAEHFKEVKEAYEMLSDSQKRAAYDQYGHDPNM-
DNJB8_HUMAN     MANYYEVLGVQASASPEDIKKAYRKLALRWHPDKNPDNKEFKLVSEAYEVLSDSKKRSLYDRAGCD----
DNAJ_WOLSU      --DYYEILEIERSASGEEIKKAYRKMAMKYHPDSSEAEEMFKRVNEAYQVLSDEGKRQLYDRYG------
DNAJ_WIGBR      --DYYDILGISKNASDREIKTAYKRLAVKFHPDRNPGNSKFKEIKEAYEVLLDPKKRAAYNQYGH-----
DNAJ_STRMU      ----YDRLGVSKDASQDEIKKAYRRMSKKYHPDEPGAEEKYKEIQEAYDTLGDEQKRAAYDQYG------
DNAJ_STRA5      ----YDRLGVSKDASQDEIKKAYRRMSKKYHPDETGAEEKYKEVQEAYETLSDTQKRAAYD---------
DNAJ_STRA3      ----YDRLGVSKDASQDEIKKAYRRMSKKYHPDETGAEEKYKEVQEAYETLSDTQKRAAYD---------
DNAJ_SACD2      --DYYEVLGVSKDVSPQELKKAYRKVAMKYHPDRNSDDDKFKEASEAYEVLSDAQKRAAYD---------
DNAJ_RHOPB      ----YETLEVDRSADDSSLKAAFRKLAMKWHPDNPGDASRFKEINEAYEVLKDGDKRAAYDRYGH-----
DNAJ_ORITI      -LDYYQVLGVSRTASQEEIKRAYRKLVLKYHPDNPGDEQKIKNINEAYDILKDEKKRSAYDQLGH-----
DNAJ_ORITB      -LDYYQVLGVSRTASQEEIKRAYRKLVLKYHPDNPGDEQKIKNINEAYDILKDEKKRSAYDQLGH-----
DNAJ_LACGA      --DYYDVLGVDKNASESDINKAYRKLAKKYHPDEPGAEEKYKEVNEAYEVLHDKQKKAQYD---------
DNAJ_HAEDU      --DYYEVLGLQKGATEKDIKRAYKRLAAKYHPDSKDSEEKFKQITEAYEILTDDQKRAAYDQYGH-----
DNAJ_COLMA      --DYYETLEVSQDASEKEIKKAYKKLAMKYHPDTQGDEETFKEVKEAYEILNDDQKRAAYDQYGH-----
DNAJ_BACHD      --DYYEVLGVDRNASADEVKKAYRKLARKYHPDKAPDAEKFKEVKEAFDTLSDPQKKAHYDQFGHDP---
DNAJ_VIBPA      --DFYEVLGVSRDASERDIKKAYKRLAMKFHPDNQGDADKFKEVKEAYEVLTDSQKKAAYD---------
DNAJ_SYNJA      --DYYEILGVSRDSSKEEIKRAYRRLARKYHPDEPGAEDRFKEINRAYEVLSDDELRARYD---------
DNAJ_STRPY      ----YDRLGVSKDASQDDIKKAYRKMSKKYHPDEAGAEQKYKDVQEAYETLSDSQKRAAYD---------
DNAJ_STRP8      ----YDRLGVSKDASQDDIKKAYRKMSKKYHPDEAGAEQKYKDVQEAYETLSDSQKRAAYD---------
DNAJ_STRP6      ----YDRLGVSKDASQDDIKKAYRKMSKKYHPDEAGAEQKYKDVQEAYETLSDSQKRAAYD---------
DNAJ_STRP3      ----YDRLGVSKDASQDDIKKAYRKMSKKYHPDEAGAEQKYKDVQEAYETLSDSQKRAAYD---------
DNAJ_STRP1      ----YDRLGVSKDASQDDIKKAYRKMSKKYHPDEAGAEQKYKDVQEAYETLSDSQKRAAYD---------
DNAJ_STRM5      --DYYEVLGVARTANDEELKKAYRRCAMKFHPDNPGDAASFKECKEAYEVLSDGNKRRMYDSHGH-----
DNAJ_SHESR      --DYYEVLGVGRDASEREIKKAYKRLAMKFHPDNPGDEASFKEVKEAYEILTDANKKAAYDQFGH-----
DNAJ_SHESM      --DYYEVLGVGRDASEREIKKAYKRLAMKFHPDNPGDEASFKEVKEAYEILTDANKKAAYDQFGH-----
DNAJ_SHESH      --DYYEVLSVSRDASEREIKKAYKRLAMKFHPDRNPGDKQFKEVKEAYEILTDADKKAAYDQFGH-----
DNAJ_SHESA      --DYYEVLGVGRDASEREIKKAYKRLAMKFHPDNPGDEASFKEVKEAYEILTDANKKAAYDQFGH-----
DNAJ_SHEON      --DYYEVLGVGRDASEREIKKAYKRLAMKFHPDNPGDEASFKEVKEAYEILTDANKKAAYDQFGH-----
DNAJ_SHELP      --DYYEVLGVGRDASEREIKKAYKRLAMKFHPDNPGDEASFKEVKEAYEILTDSDKKAAYDQFGH-----
DNAJ_SHEHH      --DFYEVLGVGRDASEREIKKAYKRLAMKFHPDRNPGNKEFKEVKEAYEILTDGDKKAAYDQFGH-----
DNAJ_GLOVI      --DLYETLNVSRDASKEDIKRAYRKLARQYHPDDAGAEDTFKELSRAYEVLSDDDQRARYD---------
DNAJ_ECO5E      --DYYEILGVSKTAEEREIKKAYKRLAMKYHPDNQGDKEKFKEIKEAYEVLTDSQKRAAYD---------
DNAJ_CHLPN      -MDYYSILGISKTASAEEIKKAYRKLAVKYHPDKNGDAKRFKEVSEAYEVLSDPQKRDSYD---------
DNAJ_ACAM1      --DYYDILGVSRSADPDELKRSYRRLARKYHPDEPGAEDKFKEINKAYETLSDPQMRGRYD---------
DNAJ6_ARATH     ----YEVLGVERRATSQEIRKAYHKLALKLHPDKNQDDDKFQQLQKVISILGDEEKRAVYDQTG------
CSP_TORCA       ----YIVLGLDKNASPEDIKKSYRKLALKYHPDKNPDSEKFKEINNAHAILTDATKRNIYDKYG------
DNAJ_TROWT      MEDLYGILGVDHNASVDEIRRAYRRLARELHPDINPDADRFKAVTHAYNILSDPEQRQRYD---------
DNAJ_SYNJB      --DYYEILGVSRDSSKEEIKRAYRRLARKYHPDEPGAEERFKEINRAYEVLSDNELKARYD---------
DNAJ_STRU0      ----YDRLGVSKDASQDEIKKAYRKMSKKYHPDEPGAEQKYKDVQEAYETLSDAQKRSAYD---------
DNAJ_SHEB9      --DYYEVLGVSRDTSEREIKKAYKRLAMKFHPDNPGDEANFKEIKEAYEILTDADKKAAYDQFGH-----
DNAJ_SHEB8      --DYYEVLGVSRDTSEREIKKAYKRLAMKFHPDNPGDEANFKEIKEAYEILTDADKKAAYDQFGH-----
DNAJ_SHEB5      --DYYEVLGVSRDTSEREIKKAYKRLAMKFHPDNPGDEANFKEIKEAYEILTDADKKAAYDQFGH-----
DNAJ_SHEB2      --DYYEVLGVSRDTSEREIKKAYKRLAMKFHPDNPGDEANFKEIKEAYEILTDADKKAAYDQFGH-----
DNAJ_PARUW      MADYYEILEVARGATPEEIKKAYRKKAVQYHPDKNGDADRFKEISEAYEVLSDEKKRQVYDRYG------
DNAJ_LACLC      ----YERLGVDKNASQDEIKKAYRKMSKKYHPDEEGAEDKYKEVQEAYETLSDEQKRAAYD---------
DNAJ_HAEIN      --DYYEVLGLQKGASEDEIKRAYKRLASKHHPDKNQGSEKFKEINEAYEVLGDDQKRAAYDQYGH-----
DNAJ_COXBN      --DYYEVLGVNRNATEAEVKKAFRRLAMKYHPDNPGDKDKFKEAREAYEVLCDSRKRASYDQFGH-----
DNAJ_COXB2      --DYYEVLGVNRNATEAEVKKAFRRLAMKYHPDNPGDKDKFKEAREAYEVLCDSRKRASYDQFGH-----
DNAJ_COXB1      --DYYEVLGVNRNATEAEVKKAFRRLAMKYHPDNPGDKDKFKEAREAYEVLCDSRKRASYDQFGH-----
DNJC9_HUMAN     --DLYRVLGVRREASDGEVRRGYHKVSLQVHPDRVGEGDRFQILGKVYSVLSDREQRAVYDEQG------
DNAJ_VESOH      --DFYEILGIAKNTDVKQIKKAYKRLAMKHHPDRVKDNKEFKEIQKAYAILSDTQKRQAYDQFGH-----
DNAJ_TETHA      --DYYEVLGVDKGASDDEIKKAYRKLSKKYHPDVNQEAEKFKKFQKPMNTLSDPQKRAAYD---------
DNAJ_RHOCS      --DYYEVLGVQKGASADDLKKAYRKLAMQYHPDNQGDEQKFKEISEAYDVLKDDQKRAAYDRFGH-----
DNAJ_OCEIH      --DYYEILGIDKSASQDEIKKNYRKLARKYHPDVNKEAEKFKEVKEAYEVLSDDQKRAQYD---------
DNAJ_HAHCH      --DYYEVLGVSRDVDGKEVKKAYRRLAMKYHPDNPGDAEMFKEATEAYDVLSDDQKRAAYD---------
DNAJ_HAEI8      --DYYEVLGLQKGASEDDIKRAYKRLASKHHPDKNQGSEKFKEINEAYEVLGDDQKRAAYDQYGH-----
DNAJ_EHRCR      --DYYDLLGVSKSATPEEIKKAYRKMALKYHPDKNPGNEKFKELSEAYDVLIDQDKRAAYDKYGHN----
DNAJ_CAMJJ      -ISYYELLEITQNADKETIKKAYRKMALKYHPDNQGDKEKFKLVNEAYEVLSNDEKRAIYDRYGKD----
DNAJ_ACTPJ      --DYYEVLGLQKGASENDIKRAYKRLASKHHPDSKDAEEKFKEINEAYEVLGDAEKRAAYDQYGH-----
DNAJ_ACTP2      --DYYEVLGLQKGASENDIKRAYKRLASKHHPDSKDAEEKFKEINEAYEVLGDAEKRAAYDQYGH-----
DNAJ2_COREF     --DYYADLGVSKNASAEDIKKAYRKLARENHPDKNGDEDRFKKAAEAYDVVGDETKRREYDD--------
YAY1_SCHPO      ----YDLLGISTDATAVDIKKAYRKLAVKYHPDKNGASEKFQKISEAYQVLGDEKLRSQYDQFG------
DNAJ_STRMK      --DYYEVLGVARTATDDELKKAYRRCAMKFHPDNPGDAASFKECKEAYEVLSDGNKRRMYDSHGH-----
DNAJ_STAS1      --DYYEVLGVSKSASKDEIKKAYRKLSKQYHPDEEGADEKFKEISEAYEVLSDENKR-------------
DNAJ_STAES      --DYYEVLGVNKSASKDEIKKAYRKLSKKYHPDEEGADEKFKEISEAYEVLSDENKR-------------
DNAJ_STAEQ      --DYYEVLGVNKSASKDEIKKAYRKLSKKYHPDEEGADEKFKEISEAYEVLSDENKR-------------
DNAJ_SHEFN      --DYYEVLGVGRDTSEREIKKAYKRLAMKFHPDNPGDEASFKEIKEAYEILTDSDKKAAYDQFGH-----
DNAJ_ROSDO      --DYYEVLGVSKGASSDDIKKGYRRKAKELHPDRNKDDAQFKEANEAYEVLKDADKKAAYDRYGH-----
DNAJ_POLNA      --DYYDTLGVPKNASDEDIKKAYRKLAMKHHPDNQGDEDKFKEAKEAYEMLSDAQKRAAYDQYGH-----
DNAJ_MYCPN      --DYYEVLGVSRSATAQDIKRAFRKLAMQYHPDHKGEGEKFKEVNEAYEVLSDTEKRGMYDRFGHE----
DNAJ_MYCGE      --DYYEVLGISKNASSQDIKRAFRKLAMQYHPDQKQNEEKFKEVNEAYEVLSDEEKRKLYDQFGHE----
DNAJ_METPB      --DYYEVLGVAKTASESELKVAFRKLAMVHHPDNPGDKEKFKEVNEAYQCLSDGEKRAAYDRFGH-----
DNAJ_METEP      --DYYEVLGVAKTASESELKVAFRKLAMVHHPDNPGDKEKFKEVNEAYQCLSDGQKRAAYDRFGH-----
DNAJ_METC4      --DYYEVLGVAKTASESELKVAFRKLAMVHHPDNPGDKEKFKEVNEAYQCLSDGQKRAAYDRFGH-----
DNAJ_HAEIG      --DYYEVLGLKKGASENDIKRAYKRLASKHHPDKNQGSEKFKEINEAYEVLGDDQKRAAYDQYGH-----
DNAJ_DESVM      --DYYEVLGVARDASEDEIKRQYRKLALQYHPDRNPDNQMFKEAAEAYDVLRDADKRARYD---------
DNAJ_CHLPD      --DYYEVLGLSRSATKDEIKKAYRKLAMQYHPDKNPDNEHFKEVNEAYEALSNDDKRRRYD---------
DJC25_XENLA     ----YDVLGVSRDANKGDIARAYRQLARKYHPDRGPDGEKFILVATAYETLKDEETRKDYD---------
DJC18_MACFA     ----YEILGVSRDASDEELKKAYRKLALKFHPDKNGATDAFKAIGNAFAVLSNPDKRLRYDEYG------
DJC18_HUMAN     ----YEILGVSRDASDEELKKAYRKLALKFHPDKNGATDAFKAIGNAFAVLSNPDKRLRYDEYG------
DJC18_BOVIN     ----YEILGVSRDASDEELKKAYRKLALKFHPDKNGATDAFKAIGNAFAVLSNPDKRLRYDEYG------
DPH4_ASHGO      ----YDILGIAVDAEPLEVRQAYRQRLLEAHPDKQGDKGAVTRIQQAYRVLSDPTQR-----SAYDGELA
DNJB7_HUMAN     MVDYYEVLGLQRYASPEDIKKAYHKVALKWHPDKNPENKEFKEVAEAYEVLSNDEKRDIYDKYG------
DNAJ_SHEDO      --DYYEVLGVGRDSSERDIKKAYKRLAMKFHPDNPGDEASFKEIKEAYEILTDGDKKAAYDQFGH-----
DNAJ_GLUOX      -IDYYESLEVSRTASQDELKKAFRKQAMRYHPDNPGDDQKFKEINEAYDVLKDEQKRAAYDRYGHD----
DNAJ_GLUDA      -LDYYAVLEVTRDANGDELKKAYRRLAMQYHPDNPGDASRFKEINEAYDILKDEQKRAAYD---------
DNAJ_EHRRW      --DYYDLLGLSKNATPEEIKKAYRKMALKYHPDKNGDEEKFKELSEAYDVLIDKDKRAAYDRYGH-----
DNAJ_EHRRG      --DYYDLLGLSKNATPEEIKKAYRKMALKYHPDKNGDEEKFKELSEAYDVLIDKDKRAAYDRYGH-----
DNAJ_CLOPE      --DYYEVLGLQKGASDDEIKRAFRKMAMKYHPDNPGDEENFKEVNEAYDVLKDPDKKAKYD---------
DNAJ_CAMJR      -ISYYEILEITQNADKETIKKAYRKMALKYHPDNQGDKEKFKLVNEAYEVLSNDEKRAIYDRYGKD----
DNAJ_CAMJE      -ISYYEILEITQNADKETIKKAYRKMALKYHPDNQGDKEKFKLVNEAYEVLSNDEKRAIYDRYGKD----
DNAJ_CAMJD      -ISYYEILEITQNADKETIKKAYRKMALKYHPDNQGDKEKFKLVNEAYEVLSNDEKRAIYDRYGKD----
DNAJ_BUCAT      --DYYQILGIPKSAEEREIKKAYKKLAMKYHPDNQGDKTKFKEIKEAYEILINEEKRSAYDQYGH-----
DNAJ_BUCAI      --DYYQILGIPKSAEEREIKKAYKKLAMKYHPDNQGDKTKFKEIKEAYEILINEEKRSAYDQYGH-----
DNAJ_BUCA5      --DYYQILGIPKSAEEREIKKAYKKLAMKYHPDNQGDKTKFKEIKEAYEILINEEKRSAYDQYGH-----
DNAJ_BLOPB      --DYYEILGISKNADEREIKKSYKRLAMKFHPDRNPGNTKFKEIKEAYEVLSNSEKRAAYDQYGH-----
DNAJ_ANAMM      --DYYEILEVSRNASAEEIKKSYRKMVFKYHPDKNGDEEKFKKISEAYEVLSNPEKRAAYDRYGH-----
DNAJ_ANAMF      --DYYEILEVSRNASAEEIKKSYRKMVFKYHPDKNGDEEKFKKISEAYEVLSNPEKRAAYDRYGH-----
DJC25_XENTR     ----YDVLGVSRDASKGDIARAYRQLARKYHPDPGPDGEKFLLVATAYETLKDEETRKDYD---------
YCJ3_SCHPO      ----YLALGLPKDATSDQIKESYYRLSRLFHPDKAAAEEKFQIIQHAYEVLSDPSKKEIYDNFG------
SEC63_PONAB     --NPYEVLNLDPGATVAEIKKQYRLLSLKYHPDKGGDEVMFMRIAKAYAALTDEESRKNWEEFG------
SEC63_MOUSE     --NPYEVLNLDPGATVAEIKKQYRLLSLKYHPDKGGDEVMFMRIAKAYAALTDEESRKNWEEFG------
SEC63_HUMAN     --NPYEVLNLDPGATVAEIKKQYRLLSLKYHPDKGGDEVMFMRIAKAYAALTDEESRKNWEEFG------
DNJ49_ARATH     --DYYAILGLEKNCSVDEIRKAYRKLSLKVHPDKNGSEEAFKKVSKAFTCLSDGNSRRQFDQVG------
DNAJ_XANCP      --DYYEVLGVARGASDEELKKAYRRCAMKYHPDNPGDAATFKECKEAYEVLSDGNKRRAYDAHGH-----
DNAJ_XANCB      --DYYEVLGVARGASDEELKKAYRRCAMKYHPDNPGDAATFKECKEAYEVLSDGNKRRAYDAHGH-----
DNAJ_XANC8      --DYYEVLGVARGASDEELKKAYRRCAMKYHPDNPGDAATFKECKEAYEVLSDGNKRRAYDAHGH-----
DNAJ_SILPO      --DYYDVLGVSKGASADEIKKAYRGKAKELHPDRNKDNPDFKEVNEAYEVLKDAEKKAAYDRFGH-----
DNAJ_HALSA      --DFYDVLGVSRDATEDEIMQAYRDQVSEYHPDVSDDEEKFKKIQKAKDVLTDEETRQQYDQLGHE----
DNAJ_HALS3      --DFYDVLGVSRDATEDEIMQAYRDQVSEYHPDVSDDEEKFKKIQKAKDVLTDEETRQQYDQLGHE----
DNAJ_CAMJ8      -ISYYEILEITQSADKETIKKAYRKMALKYHPDNQGDKEKFKLVNEAYEVLSNDEKRAIYDRYGKD----
DNAJ_BUCCC      --DYYTTLNISNTASQLDIKRAYKKLAIKYHPDRNQGNEKFKKIKQAYEILSDTKKRNLYDQYGH-----
DNAJ_ANAPZ      --DYYDLLGVSRGASEEEIKKSYRKKVFEYHPDRNPGNEKFKKISEAYDVLTDSDKRAAYDRYGH-----
DNAJ_ACEAC      -LDYYAILEVSRTATADELKKSYRKLAMKYHPDPGDDAAEFKEINQAYDILKDEQKRAAYDQYGH-----
DNAJ2_AQUAE     --DYYEILGVPRNASQEEIKKAYRRLVRKYHPDXXXXXXXXXXINEAYQVLSDPEKRKLYDMYGH-----
DNAJ_SHEWM      --DYYEVLSVGRDASEREIKKAYKRLAMKFHPDNPGDETSFKEVKEAYEILTDSDKKAAYDQFGH-----
DNAJ_RHOSK      --DYYEVLGVSRTASADELKKAYRTKAKELHPDRNADNAQFKEVNEAYDVLRDADKKAAYD---------
DNAJ_RHOS5      --DYYEVLGVSRGASADELKKAYRTKAKELHPDRNADNAQFKEVNEAYDVLRDADKKAAYD---------
DNAJ_RHOS4      --DYYEVLGVSRTASADELKKAYRTKAKELHPDRNADNAQFKEVNEAYDVLRDADKKAAYD---------
DNAJ_RHOS1      --DYYEVLGVSRTASADELKKAYRTKAKELHPDRNADNAQFKEVNEAYDVLRDADKKAAYD---------
DNAJ_PORGI      --DYYEVLGVSKNATDDELKKAYRKKAIQYHPDKNGDEEHFKEVAEAYDVLSDPQKRSQYD---------
DNAJ_CLOB8      --DYYELLGLQKGASDDEIKRAFRKLAVKYHPDRNQGNEKFKEINEAYQVLSDPEKKAKYD---------
DNAJ_BUCAP      --DYYQILGIPKSAEEREIKKAYKRLAMKYHPDNQGDENKFKEIKEAYEILINEEKRTAYDQYGH-----
DNAJ_BDEBA      --DYYEILGVEKGADQDTIKKAYRKLAMQFHPDNXXXXXXXXXXXXXYEVLSDAQKRAQYDRFGHD----
DNAJ_ACHLA      --DYYDVLGISKSASQDEIKKAYRSLAKKYHPDVSKEKDKFKEVQEAYDVLNDSNKKAQYDRFGH-----
DJC11_PONAB     --DYYSLLNVRREASSEELKAAYRRLCMLYHPDKHRDPELFNLVHQAYEVLSDPQTRAIYDIYG------
DJC11_MOUSE     --DYYSLLNVRREASSEELKAAYRRLCMLYHPDKHRDPELFNLVHQAYEVLSDPQTRAIYDIYG------
DJC11_HUMAN     --DYYSLLNVRREASSEELKAAYRRLCMLYHPDKHRDPELFNLVHQAYEVLSDPQTRAIYDIYG------
DNJB9_PONAB     ----YDILGVPKSASERQIKKAFHKLAMKYHPDKNKSPDKFREIAEAYETLSDANRRKEYDTLGH-----
DNJB9_HUMAN     ----YDILGVPKSASERQIKKAFHKLAMKYHPDKNKSPDKFREIAEAYETLSDANRRKEYDTLGH-----
DNAJ_STRR6      ----YDRLGVSKNASADEIKKAYRKLSKKYHPDEPGAEDKYKEVQEAYETLSDDQKRAAYD---------
DNAJ_STRPN      ----YDRLGVSKNASADEIKKAYRKLSKKYHPDEPGAEDKYKEVQEAYETLSDDQKRAAYD---------
DNAJ_RUTMC      --DYYEILGVAKNADAKQIKKAYKRLAMKHHPDKASAEKKFKEIQKAYAILSDVQKRQAYD---------
DNAJ_RHOCA      -VDFYEVLGVSKGASAEEIKKAYRSKAKELHPDQSAAEAQFKEVNGAYDVLKDGDKKAAYDRYGH-----
DNAJ_PORG3      --DYYEVLGVSKNATDDELKKAYRKKAIQYHPDKNGDEEHFKEVAEAYDVLSDPEKRSRYD---------
DNAJ_FRATW      ----YEILNVSKTASGVEIKRAYRKLAMEYHPDNPGDKEKFKEISEAYEILSDDSKRSRYDQFGH-----
DNAJ_FRATT      ----YEILNVSKTASGVEIKRAYRKLAMEYHPDNPGDKEKFKEISEAYEILSDDSKRSRYDQFGH-----
DNAJ_FRAT1      ----YEILNVSKTASGVEIKRAYRKLAMEYHPDNPGDKEKFKEISEAYEILSDDSKRSRYDQFGH-----
DNAJ_FRAP2      ----YEILNVSKTASGVEIKRAYRKLAMKYHPDRNPDDKEFKEISEAYEILSDDGKRSRYDQFGH-----
DNAJ_EXISA      --DYYEVLGLDKSASAQDIKRAYRKLARQYHPDINQEADKFKEIGEAYEVLSDEQKRAQYD---------
DNAJ_BEII9      --DFYEVLGVTKTCTEAEMKVAFRKAAMQWHPDRNPGNEQFKEINEAYQTLSDGQKRAAYDRYGH-----
DNAJ_AERS4      --DFYEVLGVSKGADEREIKKAYKPLAMKFHPDNQGDAEKFKEVKEAYEILTDENLRARYD---------
DJC25_HUMAN     --DCYEVLGVSRSAGKAEIARAYRQLARRYHPDPGDEGEAFLLVATAYETLKDEETRKDYD---------
DNJC2_MOUSE     --DHYAVLGVRYTATQRQIKAAHKAMVLKHHPDKRGDNDYFTCITKAYEMLSDPVKRRAFNDPTFDPSKS
DNJC2_MACFA     --DHYAVLGVRYKATQRQIKAAHKAMVLKHHPDKRGDNDYFTCITKAYEMLSDPVKRRAFNDPTFDPSKS
DNJC2_HUMAN     --DHYAVLGVRYKATQRQIKAAHKAMVLKHHPDKRGDNDYFTCITKAYEMLSDPVKRRAFNDPTFDPSKS
DNJC2_BOVIN     --DHYAVLGVRYKATQRQIKAAHKAMVLKHHPDKRGDNDYFTCITKAYEMLSDPVKRRAFNDPTFDPSKS
DNAJ_PSEST      --DFYEVLGVERGASEAELKKAYRRLAMKHHPDNPGDXXXXXXXXXXXXVLSDPSKRAAYDQYGHDPQM-
DNAJ_PASHA      --DYYEVLGLSKGASEKDIKRAYKRLAAKHHPDSKESEEKFKEITEAYDVLTDSEKKAMYDQYGH-----
DNAJ_MYCMS      --DYYEVLGVSKTASEQEIRQAYRKLAKQYHPDSPDAHDKMVEINEAADVLLDKDKRKQYDSSGFSSNFA
DNAJ_METMA      --DYYEILGLSKDSSVEDIKKTYRKLALQYHPDRNGAEEKFKEISEAYAVLSDAEKRAQYDRFGH-----
DNAJ_FRATU      ----YEILNISKTASGVEIKRAYRKLAMKYHPDNPGDKEKFKEISEAYEILSDDSKRSRYDQFGH-----
DNAJ_FRATH      ----YEILNISKTASGVEIKRAYRKLAMKYHPDNPGDKEKFKEISEAYEILSDDSKRSRYDQFGH-----
DNAJ_FINM2      ----YEILEVNENATQEEIKKSYRRLAKKYHPDNSGDSEKFKEINGAYEVLGDKEKRKKYDMYG------
DNAJ_COXBU      --DYYEVLGVNLNATEAEVKKAFRRLAMKYHPDNPGDKDKFKEAREAYEVLCDSRKRASYDQFGH-----
DNAJ_COXBR      --DYYEVLGVNLNATEAEVKKAFRRLAMKYHPDNPGDKDKFKEAREAYEVLCDSRKRASYDQFGH-----
DNAJ_CLOAB      --DYYEVLGLEKGASDDEIKKAFRKLAIKYHPDKNRGNEKFKEINEAYQVLSDPDKKANYD---------
DNAJ_ALHEH      --DYYEALGVARNASDSEIKKAYRRMAMKYHPDNPGDXXXXXXXXXXYEILSDPQKRAAYDQFGH-----
DJC25_RAT       --DCYEVLGVSRSASKAEIARAYRQLARRYHPDXXXSAEAFLLVATAYETLKDEETRKDYD---------
DJC25_MOUSE     --DCYEVLGVSRSASKAEIARAYRQLARRYHPDXXXSAEAFLLVATAYETLKDEETRKDYD---------
CWC23_SCHPO     -IDYYELLGINEDAQDQEIHRAWRKTSLKYHPDKNPNAEKFHMLQLAYNALIDVQLRKAYDSERFAKLAR
YNF5_SCHPO      ----YEILDLKKTCTDTEIKKSYKKLALQLHPDKNSADEAFKMVSKAFQVLSDPNLRAHYDRTGMDPE--
DNJB9_RAT       ----YDILGVPKSASERQIKKAFHKLAMKYHPDKNKSPDKFREIAEAYETLSDANRRKEYDIIGH-----
DNAJ_PARDP      --DYYEVLGVARGASADEIKKAYRAKAKQLHPDRNKDCKAFKEVNEAYECLKDDQKKAAYD---------
DNAJ_METAC      --DYYEILGLPKDASVEDIKKTYRKLALQYHPDRNGAEDKFKEISEAYAVLSDTEKRAQYDRFGH-----
DNAJ_JANSC      --DYYEVLGVSKGASADEIKKGFRTKAKELHPDRNADNSQFKEANEAYDVLKDADKKAAYDRFGH-----
DNAJ_CLONN      --DYYEVLGLSKGASDDEIKKAYRKLAMKYHPDRNQGNEKFKDINEAYQVLSDPQKKANYD---------
DNAJ_BACSH      --DYYEVLGLTKDE----IKKAYRKLSKQYHPDLNGADEKFKEIAEAYEVLSDDQKKARYDQFGHE----
DNAJ2_CORGL     ----YADLGVSSSASEDEIKKAYRKLARENHPDKNGDEDRFKKAAEAYDVLGDDKKRKEYDE--------
CBPA_ECOSM      --DYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDRFKEVAEAWEVLSDEQRRAEYDQMWQDPQFS
CBPA_ECOLU      --DYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDRFKEVAEAWEVLSDEQRRAEYDQMWQDPQFS
CBPA_ECO7I      --DYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDRFKEVAEAWEVLSDEQRRAEYDQMWQDPQFS
CBPA_ECO5E      --DYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDRFKEVAEAWEVLSDEQRRAEYDQMWQDPQFS
CBPA_ECO57      --DYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDRFKEVAEAWEVLSDEQRRAEYDQMWQDPQFS
DNJC5_RAT       ----YHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDADKFKEINNAHAILTDATKRNIYDKYG------
DNJC5_MOUSE     ----YHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDADKFKEINNAHAILTDATKRNIYDKYG------
DNJC5_HUMAN     ----YHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDADKFKEINNAHAILTDATKRNIYDKYG------
DNJC5_BOVIN     ----YHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDADKFKEINNAHAILTDATKRNIYDKYG------
DNJ5B_BOVIN     ----YEILGLHKGASNEEIKKTYRKLALKHHPDKNGAAEKFKEINNAHTILTDMSKRNIYDKYG------
DNJ20_ARATH     ----YDLLGVTESVTLPEIKQAYKQLARKYHPDVSPPDDRFIRVQEAYETLSDPRRRVLYD---------
DNAJ_ONYPE      --DYYHILGLDKDASPEDIKKAYRSLAKKYHPDISKEANKFKEVQEAYSVLGDASKKSNYD---------
DNAJ_MYCCT      --DYYEVLGVSKTASEQEIRQAYRKLAKQYHPDSPDAHDKMVEINEAADVLLDKDKRKQYDQFGH-----
DNAJ_METPP      --DYYETLGVAKNASEEDIKKAYRKLAMKHHPDNQGDGXXXXXXXXXYEMLSDAQKRAAYDQYGHDPNM-
DNAJ_CLOBB      --DYYEVLGLQKGASDDEIKKAFRKLAIKYHPDKNKGNEKFKEINEAYQVLSDPEKKSNYD---------
DNAJ_CLOBA      --DYYEVLGLQKGASDDEIKKAFRKLAIKYHPDKNKGNEKFKEINEAYQVLSDPEKKSNYD---------
DNAJ2_SYNY3     ----YQILGVPRNATAEEIKKSFRKLARQYHPDVNPNDEKFKDINEAYDVLSDETKRRELD---------
DJC14_MOUSE     -LNPFHVLGVEATASDTELKKAYRQLAVMVHPDKNHHEEAFKILRAAWDIVSNPERRKEYE---------
DJC14_BOVIN     -LNPFHVLGVEATASDVELKKAYRQLAVMVHPDKNHHEEAFKVLRAAWDIVSNPERRKEYE---------
DJC11_BOVIN     --DYYSLLNVRREASCEELKAAYRRLCMLYHPDKHRDPELFNLVHQAYEVLSDPQTRAIYDIYG------
DJC10_PONAB     --DFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNFLKINRAYEVLKDEDLRKKYDKYG------
DJC10_HUMAN     --DFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPDFLKINRAYEVLKDEDLRKKYDKYG------
CSP_XENLA       ----YHVLGLDKNATTDDIKKCYRKLALKYHPDKNPDSEKFKEINNAHGILADSTKRNIYDKYG------
CBPA_SHISS      --DYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDRFKEVAEAWEVLSDEQRRAEYD---------
CBPA_SHIFL      --DYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDRFKEVAEAWEVLSDEQRRAEYD---------
CBPA_SHIF8      --DYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDRFKEVAEAWEVLSDEQRRAEYD---------
CBPA_SHIBS      --DYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDRFKEVAEAWEVLSDEQRRAEYD---------
CBPA_SHIB3      --DYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDRFKEVAEAWEVLSDEQRRAEYD---------
CBPA_SALTY      --DYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDRFKEVAEAWEVLSDEQRRAEYD---------
CBPA_SALTI      --DYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDRFKEVAEAWEVLSDEQRRAEYD---------
CBPA_SALSV      --DYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDRFKEVAEAWEVLSDEQRRAEYD---------
CBPA_SALPK      --DYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDRFKEVAEAWEVLSDEQRRAEYD---------
CBPA_SALPC      --DYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDRFKEVAEAWEVLSDEQRRAEYD---------
CBPA_SALPB      --DYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDRFKEVAEAWEVLSDEQRRAEYD---------
CBPA_SALPA      --DYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDRFKEVAEAWEVLSDEQRRAEYD---------
CBPA_SALNS      --DYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDRFKEVAEAWEVLSDEQRRAEYD---------
CBPA_SALHS      --DYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDRFKEVAEAWEVLSDEQRRAEYD---------
CBPA_SALG2      --DYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDRFKEVAEAWEVLSDEQRRAEYD---------
CBPA_SALEP      --DYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDRFKEVAEAWEVLSDEQRRAEYD---------
CBPA_SALDC      --DYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDRFKEVAEAWEVLSDEQRRAEYD---------
CBPA_SALAR      --DYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDRFKEVAEAWEVLSDEQRRAEYD---------
CBPA_SALA4      --DYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDRFKEVAEAWEVLSDEQRRAEYD---------
CBPA_ESCF3      --DYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDRFKEVAEAWEVLSDEQRRAEYD---------
CBPA_ECOUT      --DYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDRFKEVAEAWEVLSDEQRRAEYD---------
CBPA_ECOSE      --DYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDRFKEVAEAWEVLSDEQRRAEYD---------
CBPA_ECOLI      --DYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDRFKEVAEAWEVLSDEQRRAEYD---------
CBPA_ECOLC      --DYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDRFKEVAEAWEVLSDEQRRAEYD---------
CBPA_ECOL6      --DYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDRFKEVAEAWEVLSDEQRRAEYD---------
CBPA_ECOL5      --DYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDRFKEVAEAWEVLSDEQRRAEYD---------
CBPA_ECOK1      --DYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDRFKEVAEAWEVLSDEQRRAEYD---------
CBPA_ECOHS      --DYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDRFKEVAEAWEVLSDEQRRAEYD---------
CBPA_ECODH      --DYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDRFKEVAEAWEVLSDEQRRAEYD---------
CBPA_ECOBW      --DYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDRFKEVAEAWEVLSDEQRRAEYD---------
CBPA_ECO8A      --DYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDRFKEVAEAWEVLSDEQRRAEYD---------
CBPA_ECO81      --DYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDRFKEVAEAWEVLSDEQRRAEYD---------
CBPA_ECO55      --DYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDRFKEVAEAWEVLSDEQRRAEYD---------
CBPA_ECO45      --DYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDRFKEVAEAWEVLSDEQRRAEYD---------
CBPA_ECO27      --DYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDRFKEVAEAWEVLSDEQRRAEYD---------
CBPA_ECO24      --DYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDRFKEVAEAWEVLSDEQRRAEYD---------
CBPA_CITK8      --DYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDRFKEVAEAWEVLSDEQRRAEYD---------
YR260_MIMIV     --DLYEILGLTPSASEEDIKKAYRKLAIKYHPDKNKGNEMFKKINHANSILSNSEKRRVYDQYG------
RSP1_SCHPO      -VDYYTILGAESTSSYVEIRQQYLKLVLRYHPDRNPGREQFQLIQKAHEVLKDPKLRELFD---------
MDJ1_SCHPO      MTDPYKTLGVXXXXXXXXXXXXXXXLAKQYHPDANPDKDKFVEIKQAYEVLQDPKKKKAFDTYG------
DNJB3_MACFU     MANYYEVLGVQVQRFPEDIKKAYRKLALKWHPDKNPDNKEFKQVAEAYEVLSDAKKRDVYDRYG------
DNAJ_PICTO      --DYYAILGVDRNASQDDIKKAFRELAKKYHPDANXXXXXXXXXXXXXXVLSDPQKRKQYDETG------
DNAJ_METRJ      --DYYEILGVTKTATEGEMKVAFRKLAMTYHPDNPGDKDKFKEINEAYQCLSDGQKRAAYD---------
DNAJ_MESFL      --DYYEVLGVSKTSTEQEIKSAYRKLAKKYHPDESGAEEKFKEVNEAASVLLDADKKAKYD---------
DNAJ_CHLCH      --DYYETLGVTRSSNKDDIKKAYRKLAVQYHPDKNPGNEHFKEVNEAYEVLSNDDKRRRYD---------
DJC14_RAT       -LNPFHVLGVEATASDIELKKAYRQLAVMVHPDKNHHEEAFKVLRAAWDIVSNPERRKEYE---------
CBPA_SHIDS      --DYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDHFKEVAEAWEVLSDEQRRAEYD---------
SEC63_YEAST     LFDPYEILGISTSASDRDIKSAYRKLSVKFHPDKLAKGETYVQITKAYESLTDELVRQNYLKYGH-----
DNJC7_DICDI     --DYYKILGVSKEAGETEIKKAYRKLALQYHPDKNNQEKMFKDIGEAYSVLSDEKKKRQYD---------
DNJC2_RAT       --DHYAVLGVRYKATQRQIKAAHKTMVLKHHPDKRGDNDYFTCITKAYEMLSDPVKRRAFNDPTFDPSKS
DNJ20_CAEEL     --DFYKILGVXXXXXXXXXXXXYRKLAKELHPDRNQDNEKFQDLSSAYEVLSDKEKRAMYDRHG------
DNJ11_ARATH     ----YDVLEVPLGATSQDIKSAYRRLARICHPDSSSSADEFMKIHAAYCTLSDPEKRSVYD---------
DNAJ_RALEJ      --DYYEVLGVGKNASDDEIKKAYRKLAMKYHPDRNPDXXXXXXXXXAYEMLSDAEKKAAYDQYGHDPNM-
DNAJ_MACCJ      --DYYEVLGLSKGASKEEIKRAYKKLSKKYHPDINKEADKFKEIAEAYEVLSDDQKKAQYD---------
DNAJ_LEPCP      --DYYEVLGVGKTASEDEIKKAYRKLAMKHHPDNQGDGXXXXXXXXXYEMLSDAQKRAAYDQFGH-----
DJC10_RAT       ----YSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPDFLKINRAYEVLKDEDLRKKYDKYG------
DJC10_MOUSE     ----YSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPDFLKINRAYEVLKDEHLRKKYDKYG------
CBPA_SALCH      --DYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPNRFKEVAEAWEVLSDEQRRAEYD---------
DNJB9_MOUSE     ----YDILGVPKSASERQIKKAFHKLAMKYHPDKNKSPDKFREIAEAYETLSDANSRKEYDTIGH-----
DNJ5B_MOUSE     ----YEILGLHKGASCEEIKKTYRKLALRHHPDKNPDAEKFKEINNAHTILTDTSKRNIYDKYG------
DNJ5B_HUMAN     ----YEILGLHKGASNEEIKKTYRKLALKHHPDKNPDDEKFKEINNAHAILTDISKRSIYDKYG------
DNAJ_WOLPM      --DYYDLLEVGRNASIDEIKKAYKKLALRYHPDRNPGNEKFKEVTAAYEVLSDSEKRAGYDRYGHE----
DNAJ_TERTT      --DYYEVLGVARDVSEQDLKKAYRKVAMKFHPDRNPDXXXXXXXXXXYEVLSDKQKRAAYD---------
DNAJ_RHOBA      ----YEVLKVERTATKQQVDRAYRKLAIKYHPDSNRDDAKFKEATEAYEVLSDANKRARYDQYGH-----
DNAJ_TOLAT      --DYYEILGVERSADEREIKKAYKRLAMKFHPDRNPDNXXXXXXXXXXXILSDAQKRAAYDKFGHDPNQA
DNAJ_LARHH      --DFYDVLGVNRDASDDDIKKAYRKLAMKYHPDRNPDSKDXXXXXXXXXILSDAQKRAAYDQYGHDPQ--
DNAJ_HELPY      ----YEILEVEKHSNQETIKKSYRKLALKYHPDNAGDEEKFKLINEAYGVLSDEKKRALYDRYG------
DNAJ_CLOK5      --DYYEILGLDKGASDQDIKKAFRKLALKYHPDRNPNDEKFKEINEAYQVLTDPQKK-------------
DNAJ2_PROAC     --DYYKILGVSKDAKPEEIKKAFRKIARDNHPDSPGDKAAEARFKEASEVLSNAKKRKEYD---------
DJC25_DROME     ----YDVLGVTRESSKSEIGKAYRQLARRYHPDLHRGAEQFKLVATAYEILRDEESRTDYD---------
XDJ1_SCHPO      ----YDILEVHFEASAEEIKKSYKRLALLHHPDKAPAAERFRGVQEAYDILKDPESREMYDMYGMNSDSN
DNJ72_ARATH     MVDHYQVLGVTRNATKKEVKDAFRRLAIKYHPDKHAQSPEHVRVSEAYEVLNDDLKRASYN---------
DNAJ_ENTS8      --DYYEILGVPKTADEREIKKAYKRLAMKFHPDNQGDXXXXXXXXXXYEILTDAQKRAAYDQYGH-----
DNAJ_CAMLR      ----YEILEISQTSDKETIKKAYRKMALKYHPDNQGDEEKFKLVNEAYEVLSNDEKRSIYD---------
DNAJ8_ARATH     -MDPYKTLKIRPDSSEYEVKKAFRQLAKKYHPDGSNCGVQFQTINEAYDIVLKQIKNQMEGTEEFEP---
DNAJ1_AZOSE     --DPHSLLGLSPGAGEREIKHAFRRLAMRWHPDRNADPEHFKRLRAAYE---------------------
ST_SV40         ------LLGLERSANIPLMRKAYLKKCKEFHPDKGGDEEKMKKMNTLYKKMEDGVK--------------
LT_SV40         ------LLGLERSANIPLMRKAYLKKCKEFHPDKGGDEEKMKKMNTLYKKMEDGVK--------------
DNAJ_RALPJ      --DYYEVLGVGKNASDDEIKKAYRKLAMKYHPDRNPDSXXXXXXXXXYEMLSDAEKKAAYDQYGHDPNM-
DNAJ_HELPJ      ----YEILEVEKHSNQETIKKSYRKLALKYHPDNAGDEEKFKLINEAYGVLGDEKKRALYDRYG------
CAJ1_YEAST      ----YDILGIKPEATPTEIKKAYRRKAMETHPDKHPDDAKFQAVGEAYQVLSDPGLRSKYDQFG------
DNJC3_DICDI     --DYYKILGIQKSATPEEIKKAFKKLAIKNHPDKSTETDKYMDINEAYEALKDEEKRKRYD---------
DNAJ_SHESW      --DYYEVLGVGRDASEREIKKAYKRLAMKFHPDNPGDXXXXXXXXXXYEILTDTDKKAAYDQFGH-----
DNAJ_SHEPC      --DYYEVLGVGRDASEREIKKAYKRLAMKFHPDNPGDXXXXXXXXXXYEILTDTDKKAAYDQFGH-----
DNAJ_HALMA      --DFYEILGVSRDASEDEIQEAYREKAREYHPDVSDDPDXXXXXXXXXXVLTDEEKRQMYDQMGHE----
DNAJ_DESVV      --DYYEVLGVARDASEDDIKRAYRKLALQYHPDRNPDXXXXXXXXXXYDVLRDGEKRARYD---------
DNAJ_DESVH      --DYYEVLGVARDASEDDIKRAYRKLALQYHPDRNPDXXXXXXXXXXYDVLRDGEKRARYD---------
DJC30_MOUSE     ----YELLGVPSTATQAQIKAAYYRQSFLYHPDSAEAAERFTRVSEAYLVLGSTILRR-----KYDRGLL
DPH4_DEBHA      ----YKVLGVVPTCNDLDIKSAYKEMLLAHHPDKNGNASTINSIQEAYKTLIDPELRDQYDDS-------
DNJ13_ARATH     ----YALLNLSPEASDEEIRKAYRQWAQVYHPDKIQSTENFQRICEAYEILSDETKRLIYDLYGME----
DNAJ_PEWBP      --DYYEVLELSRDAKLDDIKKAYRRLSKKYHPDEANADAKFKEVQEAFDVLSNTNKRAQYDQMGHN----
DNAJ_KLEP7      --DYYEILGVSKTAEEREIKKAYKRLAMKYHPDNQGDXXXXXXXXXXYEILTDAQKRAAYDQYGH-----
DNAJ_KLEP3      --DYYEILGVSKTAEEREIKKAYKRLAMKYHPDNQGDXXXXXXXXXXYEILTDAQKRAAYDQYGH-----
DNAJL_MYCPN     ----YDLLELPQTATLQEIKTAYKRLAKRYHPDINKQGDTFVKINNAYAVLSDTTQKAEYD---------
Y6693_DROME     --DVYKLMELARGAGEKEVKKAYHKLSLLVHPDKAESTEKFKVLSKLYQVLTDTQKRALYDEQG------
DNJC9_MOUSE     --DLYQVLGVRREASDGEVRRGYHKVSLQVHPDRVEEDQRFQILGRVYAVLSDKEQKAVYDEQG------
DNAJ_METFK      --DYYEVLGVNRDATDEEIKKAYRKLAMKYHPDRNPDNXXXXXXXXXXXVLSDDQKRAAYDQYGH-----
DNAJ_CUPTR      --DYYEVLGVGKNASDDEIKKAYRKLAMKFHPDRNPDSKDXXXXXXXXXMLSDPEKKAAYDQYGHDPNM-
DNAJL_MYCGE     ----YDLLELPTTASIKEIKIAYKRLAKRYHPDVNKLGSQFVEINNAYSILSDPNQKEKYD---------
DJC10_XENLA     --------GVSKAATNREIRQAFKKLALKLHPDKNKDPDKFLKINRAYEVLKDEDLRKKYDKYG------
CSP_DROME       ----YEILGLPKTATGDDIKKTYRKLALKYHPDKNPDADKFKEVNRAHSILSNQTKRNIYDNYG------
DNAJ_SODGM      --DYYEILGVSRDAEEREIKKAYKRQAMKFHPDNXXXXXXXXXXXXXYEVLTDAQKRAAYD---------
DNAJ_HALWD      --DFYDVLGVSRNADGDDIKQAYRKKAAKYHPDVSDDXXXXXXXXXXXXVLTDGEKRQMYDQLGHD----
DNAJ_ENT38      --DFYEILGVPKTAEEREIKKAYKRLAMKFHPDNQGDXXXXXXXXXXYEILTDAQKRAAYDQYGH-----
DNAJ_DESDG      --DYYEVLGVSRDAADDEIKRAYRKKAMEFHPDRNPDNXXXXXXXXXYDVLRDAEKRARYD---------
DNAJ_BREBN      --DLYEVLGVXXXXXXXXXXXXYRKLARQYHPDVNKEAEKFKEVKDAYDILSEPQKRAQYDRFGHDP---
DJC30_HUMAN     ----YDLLGVPSTATQAQIKAAYYRQCFLYHPDSAEAAERFTRISQAYVVLGSATLRR-----KYDRGLL
MU184_SCHPO     -VDYYAILKLQKNATFQQIRKQYLFLALQYHPDRNGDEERFQRLQLAHEVLSDATKRLIYD---------
HSCB_CUPTR      -------LPVQYGVDEAALDAAYRTVQSQAHPDKAGDAERRVAMQEAYRTLRQPLRRATY----------
DNJ10_ARATH     ----YDVLGVSPTATESEIKKAYYIKARQVHPDKNPNDPQFQVLGEAYQVLSDSGQRQAYDACGKSGIST
DNAJ_METSS      --DYYEVLGVNRDASDEEIKKSYRKLAMKYHPDRNPDNXXXXXXXXXXXVLSDEQKRAAYDQYGH-----
DJC14_HUMAN     -LNPFHVLGVEATASDVELKKAYRQLAVMVHPDKNHHEEAFKVLRAAWDIVSNAEKRKEYE---------
DJC11_DICDI     -VDFYSILNISRNATDDEIKIAFKKLAFTYHPDKQTNEELFTLITLAKDTLSDPKLRAIYDQFG------
ST_BFPYV        ------LLCLPVTATAADIKTAYRRTALKYHPDKGGDEEKMKELNTLMEEFRE-----------------
LT_BFPYV        ------LLCLPVTATAADIKTAYRRTALKYHPDKGGDEEKMKELNTLMEEFRE-----------------
DNJC7_PONAB     --DYYKILGVDKNASEDEIKKAYRKRALMHHPDSGASAEXXXXVGEAFTILSDPKKKTRYD---------
DNJC7_MOUSE     --DYYKILGVDKNASEDEIKKAYRKRALMHHPDSGASAEXXXXVGEAFTILSDPKKKTRYD---------
DNJC7_HUMAN     --DYYKILGVDKNASEDEIKKAYRKRALMHHPDSGASAEXXXXVGEAFTILSDPKKKTRYD---------
DNAJ_RALME      --DYYEVLGVGKNASDDEIKKAYRKLAMKHHPDRNPDNXXXXXXXXXXXMLSDPEKKAAYDQYGHDPNM-
DNAJ_PELUB      --DFYDVLGVSKSASPEELKSAYRKLAVKYHPDKNGDEDKFKEAGEAYGVLSDKEKKQNYDN--------
DNAJ_DESAD      ----YEVLEVSREAQEGEIKRAYRKKAMEFHPDNXXXXXXXXXXXXXYDVLRDPEKRSRYDRFGH-----
DNAJ_DELAS      --DFYEVLGVAKNASDDDIKKAYRKLAMKYHPDNQGDXXXXXXXXXXYEMLSDSNKRAAYDQYGH-----
DNAJ_CHLP8      --DYYEILGVSRSADKDEIKKAYRKLALKYHPDKNPD---------------------------------
YIS4_YEAST      ----YDLLGVSTTASSIEIKKAYRKKSIQEHPDKNPNDERFQAISEAYQVLGDDDLRAKYDKYG------
ST_POVBA        ------LLGLERAANLPLMRKAYLKKCKEFHPDKGGDEDKMKRMNTLYKKMEQDVK--------------
LT_POVBA        ------LLGLERAANLPLMRKAYLKKCKEFHPDKGGDEDKMKRMNTLYKKMEQDVK--------------
DPH4_KLULA      ----YEILGIESDASNIEIKRAYRAMLLETHPDKSGSSHSVTDIQEAYQTLIDQDLRKKYDE--------
DNAJ_THISH      --DYYEILGVAKNASEAELKKAFRRLAMKHHPDNPGDXXXXXXXXXXXXILTDPQKRAAYDQFGH-----
DNAJ_AZOSB      --DYYEVLGVNRDAGDDEIKKAYRKLAMKYHPDRNPD---------------------------------
YR266_MIMIV     ----YQILDVDNTATKQQITQSYKKLVRKYHPDRNKNPEKFKLIQSSYEVLSDDLKRLNYD---------
JDP_BOMMO       --DYYALLGCDENSTVEQITAEYKILALQHHPDK-NDGEKFQKLKEAKEILCDPSKRALYD---------
HSCB_PSEU5      ------------ELDLAQLADRYRELARQVHPDRFADAERSANLNEAYQTLKSPSRRALLALEGHDVPLE
HSCB_PSEPF      --------------DLEQLATRYRELARGVHPDRFADAEQSARLNDAYQTLKSPAQRALLTISGHEVPME
DNJC3_RAT       --DYYKILGVKRNAKKQEIIKAYRKLALQWHPDNXXXXXXXXXXXXXXXVLSDPEMRRKFDD-GEDPLDA
DNAJ_ACIAC      --DFYEVLGVPKNASDEEIKKAYRKLAMKHHPDNQGDXXXXXXXXXXXXMLSDPQKRAAYDQFGHDPNM-
APJ1_YEAST      ----YDSLNVTAAASTSEIKKAYRNAALKYHPDKNNHTEEFQEICQAYEILKDNRLRALYDQYG------
DNAJ_YERPY      --DYYEVLGVSRDAEEREIKKAYKRLAMKFHPD-------------------------------------
DNAJ_YERPS      --DYYEVLGVSRDAEEREIKKAYKRLAMKFHPD-------------------------------------
DNAJ_YERPP      --DYYEVLGVSRDAEEREIKKAYKRLAMKFHPD-------------------------------------
DNAJ_YERPN      --DYYEVLGVSRDAEEREIKKAYKRLAMKFHPD-------------------------------------
DNAJ_YERPG      --DYYEVLGVSRDAEEREIKKAYKRLAMKFHPD-------------------------------------
DNAJ_YERPE      --DYYEVLGVSRDAEEREIKKAYKRLAMKFHPD-------------------------------------
DNAJ_YERPB      --DYYEVLGVSRDAEEREIKKAYKRLAMKFHPD-------------------------------------
DNAJ_YERPA      --DYYEVLGVSRDAEEREIKKAYKRLAMKFHPD-------------------------------------
DNAJ_YERP3      --DYYEVLGVSRDAEEREIKKAYKRLAMKFHPD-------------------------------------
DNAJ_SHISS      --DYYEILGVSKTAEEREIKKAYKRLAMKYHPDNQGDXXXXXXXXXXYEVLTDSQKRAAYD---------
DNAJ_SHIDS      --DYYEILGVSKTAEEREIKKAYKRLAMKYHPDNQGDXXXXXXXXXXYEVLTDSQKRAAYD---------
DNAJ_SHIBS      --DYYEILGVSKTAEEREIKKAYKRLAMKYHPDNQGDXXXXXXXXXXYEVLTDSQKRAAYD---------
DNAJ_SHIB3      --DYYEILGVSKTAEEREIKKAYKRLAMKYHPDNQGDXXXXXXXXXXYEVLTDSQKRAAYD---------
DNAJ_SALTY      --DYYEILGVSKTAEEREIKKAYKRLAMKYHPDNQGDXXXXXXXXXXYEVLTDAQKRAAYD---------
DNAJ_SALTI      --DYYEILGVSKTAEEREIKKAYKRLAMKYHPDNQGDXXXXXXXXXXYEVLTDAQKRAAYD---------
DNAJ_SALSV      --DYYEILGVSKTAEEREIKKAYKRLAMKYHPDNQGDXXXXXXXXXXYEVLTDAQKRAAYD---------
DNAJ_SALPK      --DYYEILGVSKTAEEREIKKAYKRLAMKYHPDNQGDXXXXXXXXXXYEVLTDAQKRAAYD---------
DNAJ_SALPC      --DYYEILGVSKTAEEREIKKAYKRLAMKYHPDNQGDXXXXXXXXXXYEVLTDAQKRAAYD---------
DNAJ_SALPB      --DYYEILGVSKTAEEREIKKAYKRLAMKYHPDNQGDXXXXXXXXXXYEVLTDAQKRAAYD---------
DNAJ_SALPA      --DYYEILGVSKTAEEREIKKAYKRLAMKYHPDNQGDXXXXXXXXXXYEVLTDAQKRAAYD---------
DNAJ_SALNS      --DYYEILGVSKTAEEREIKKAYKRLAMKYHPDNQGDXXXXXXXXXXYEVLTDAQKRAAYD---------
DNAJ_SALHS      --DYYEILGVSKTAEEREIKKAYKRLAMKYHPDNQGDXXXXXXXXXXYEVLTDAQKRAAYD---------
DNAJ_SALG2      --DYYEILGVSKTAEEREIKKAYKRLAMKYHPDNQGDXXXXXXXXXXYEVLTDAQKRAAYD---------
DNAJ_SALEP      --DYYEILGVSKTAEEREIKKAYKRLAMKYHPDNQGDXXXXXXXXXXYEVLTDAQKRAAYD---------
DNAJ_SALDC      --DYYEILGVSKTAEEREIKKAYKRLAMKYHPDNQGDXXXXXXXXXXYEVLTDAQKRAAYD---------
DNAJ_SALCH      --DYYEILGVSKTAEEREIKKAYKRLAMKYHPDNQGDXXXXXXXXXXYEVLTDAQKRAAYD---------
DNAJ_SALA4      --DYYEILGVSKTAEEREIKKAYKRLAMKYHPDNQGDXXXXXXXXXXYEVLTDAQKRAAYD---------
DNAJ_ESCF3      --DYYEILGVSKTAEEREIKKAYKRLAMKYHPDNQGDXXXXXXXXXXYEVLTDSQKRAAYD---------
DNAJ_ECOUT      --DYYEILGVSKTAEEREIKKAYKRLAMKYHPDNQGDXXXXXXXXXXYEVLTDSQKRAAYD---------
DNAJ_ECOSM      --DYYEILGVSKTAEEREIKKAYKRLAMKYHPDNQGDXXXXXXXXXXYEVLTDSQKRAAYD---------
DNAJ_ECOSE      --DYYEILGVSKTAEEREIKKAYKRLAMKYHPDNQGDXXXXXXXXXXYEVLTDSQKRAAYD---------
DNAJ_ECOLU      --DYYEILGVSKTAEEREIKKAYKRLAMKYHPDNQGDXXXXXXXXXXYEVLTDSQKRAAYD---------
DNAJ_ECOLC      --DYYEILGVSKTAEEREIKKAYKRLAMKYHPDNQGDXXXXXXXXXXYEVLTDSQKRAAYD---------
DNAJ_ECOL6      --DYYEILGVSKTAEEREIKKAYKRLAMKYHPDNQGDXXXXXXXXXXYEVLTDSQKRAAYD---------
DNAJ_ECOHS      --DYYEILGVSKTAEEREIKKAYKRLAMKYHPDNQGDXXXXXXXXXXYEVLTDSQKRAAYD---------
DNAJ_ECO8A      --DYYEILGVSKTAEEREIKKAYKRLAMKYHPDNQGDXXXXXXXXXXYEVLTDSQKRAAYD---------
DNAJ_ECO81      --DYYEILGVSKTAEEREIKKAYKRLAMKYHPDNQGDXXXXXXXXXXYEVLTDSQKRAAYD---------
DNAJ_ECO7I      --DYYEILGVSKTAEEREIKKAYKRLAMKYHPDNQGDXXXXXXXXXXYEVLTDSQKRAAYD---------
DNAJ_ECO57      --DYYEILGVSKTAEEREIKKAYKRLAMKYHPDNQGDXXXXXXXXXXYEVLTDSQKRAAYD---------
DNAJ_ECO55      --DYYEILGVSKTAEEREIKKAYKRLAMKYHPDNQGDXXXXXXXXXXYEVLTDSQKRAAYD---------
DNAJ_ECO45      --DYYEILGVSKTAEEREIKKAYKRLAMKYHPDNQGDXXXXXXXXXXYEVLTDSQKRAAYD---------
DNAJ_ECO27      --DYYEILGVSKTAEEREIKKAYKRLAMKYHPDNQGDXXXXXXXXXXYEVLTDSQKRAAYD---------
DNAJ_ECO24      --DYYEILGVSKTAEEREIKKAYKRLAMKYHPDNQGDXXXXXXXXXXYEVLTDSQKRAAYD---------
DJC15_PONAB     -----LILGVSPSAGKAKIRTAHRRVMILNHPDKGGSPYVAAKINEAKDLLE------------------
DJC15_HUMAN     -----LILGVSPSAGKAKIRTAHRRVMILNHPDKGGSPYVAAKINEAKDLLE------------------
ST_POVS1        ------LLGLERAANLPLMRKAYLRKCKEFHPDKGGDEDKMKRMNTLYKKMEQDVK--------------
ST_POVBK        ------LLGLERAANLPLMRKAYLRKCKEFHPDKGGDEDKMKRMNTLYKKMEQDVK--------------
LT_POVS1        ------LLGLERAANLPLMRKAYLRKCKEFHPDKGGDEDKMKRMNTLYKKMEQDVK--------------
LT_POVBK        ------LLGLERAANLPLMRKAYLRKCKEFHPDKGGDEDKMKRMNTLYKKMEQDVK--------------
HSCB_SHESR      ------------DIDTAVLAERYRELQRAVHPDKANDTEQTAQVNDGYQTLKDPIRRHMLSLRGIDHETT
DPH4_CANAL      MISYYKVLGVTPEASIPELKQAYKSKLLTSHPDKIDNSSDIPLIKQAFATLVDPTSRK-----QYDKQLI
DNJC3_MOUSE     --DYYKILGVKRNAKKQEIIKAYRKLALQWHPDNXXXXXXXXXXXXXXXVLSDPEMRKKFDD-GEDPLDA
DNJC3_HUMAN     --DYYKILGVKRNAKKQEIIKAYRKLALQWHPDNXXXXXXXXXXXXXXXVLSDPEMRKKFDD-GEDPLDA
DNJC3_BOVIN     --DYYKILGVKRNAKKQEIIKAYRKLALQWHPDNXXXXXXXXXXXXXXXVLSDPEMRKKFDD-GEDPLDA
DNAJ_MARMS      --DYYDVLGVXXXXXXXXXXXXYRSLANKYHPDKNPDNDKFKELAEAYEILSSDDKRAAYDRFGHD----
DNAJ_FUSNP      --DYYEVLGVDKNASENDIKKAYRKAAMKYHPDKXXXXXXXXXINEAYQVLSDNEKKQQYD---------
DNAJ_FUSNN      --DYYEVLGIDKSASENDIKKAYRKAAMKYHPDKXXXXXXXXXINEAYQILSDSQKKQQYD---------
DJLA_VIBF1      --DAYNLLGISEDADPKTIKRAHRKLMNEHHPDKNMAKEKAQEIQAAYDLIK------------------
TID_DROVI       --DYYATLGVXXXXXXXXXXXXYYELAKKYHPDTNKDSKKFQDVSEAYEVLSDDQKRREYDTYG------
MU185_SCHPO     -MDCYEILQVNHDSDLQEIKANYRKLALQYHPDRNPGNEIFSQINAAYNILSNDDKRK------------
MDJ1_YEAST      --DPYDTLGLKKSATGAEIXXXXXXXXXXXHPDINKEPDKFHDLQNAYEILSDETKRQQYD---------
DNAJ_DICNV      --DLYAILGVCRTANQDEIKKAYRKLSMKWHPDXXXXXXXXXXXXXAYEILSDSQKRASYD---------
DNAJ_ACIBY      --DYYEVLGVSKTASDDEIKKAYRKLAMKYHPDRNPDNXXXXXXXXXXXILSDSEKRSMYDRMGHN----
DNAJ_ACIBT      --DYYEVLGVSKTASDDEIKKAYRKLAMKYHPDRNPDNXXXXXXXXXXXILSDSEKRSMYDRMGHN----
DNAJ_ACIBS      --DYYEVLGVSKTASDDEIKKAYRKLAMKYHPDRNPDNXXXXXXXXXXXILSDSEKRSMYDRMGHN----
DNAJ_ACIBC      --DYYEVLGVSKTASDDEIKKAYRKLAMKYHPDRNPDNXXXXXXXXXXXILSDSEKRSMYDRMGHN----
DNAJ_ACIB5      --DYYEVLGVSKTASDDEIKKAYRKLAMKYHPDRNPDNXXXXXXXXXXXILSDSEKRSMYDRMGHN----
DNAJ_ACIB3      --DYYEVLGVSKTASDDEIKKAYRKLAMKYHPDRNPDNXXXXXXXXXXXILSDSEKRSMYDRMGHN----
DNAJ1_ARATH     ----YDVLGVSPKATREEIKKSFHELAKKFHPDTNRNNRKFQEIREAYETLGNSERREEYDKLQY-----
DJLA_VIBVY      LADAYKILGIDANADGKEVKRAYRKLMNEHHPDKNMAKEKSQEIQSAYDLIK------------------
DJLA_VIBVU      LADAYKILGIDANADGKEVKRAYRKLMNEHHPDKNMAKEKSQEIQSAYDLIK------------------
JAC1_YEAST      --------------DQSRLRKEYRQLQAQHHPDMAQQGEQSSTLNQAYHTLKDPLRR-------------
HSCB_SHESM      ------------DIDTAVLAERYRELQRAVHPDKANDTEQTAQVNDGYQTLKDPIRRHMLSLRGIDHETT
HSCB_SHESA      ------------DIDTAVLAERYRELQRAVHPDKANDTEQTAQVNDGYQTLKDPIRRHMLSLRGIDHETT
DNAJ_TREDE      --DYYEVLGVDKKASNDDIKKAYRKLAIKYHPDKNGDXXXXXXXXXXYEILIDEKKRSMYD---------
DNAJ_SHIFL      --DYYEILGVSKTAEEREIRKAYKRLAMKYHPDNQGDXXXXXXXXXXYEVLTDSQKRAAYD---------
DNAJ_SHIF8      --DYYEILGVSKTAEEREIRKAYKRLAMKYHPDNQGDXXXXXXXXXXYEVLTDSQKRAAYD---------
DNAJ_RICAH      --DYYKILGVSKTASQXXXXXXXXXXXXQYHPDTTDDKDKFKEINRAYDVLKDEQKRAAYDRFGHD----
DNAJ_RHITR      --------------------SAFRKLAMQFHPDKNPDDSKFKEINEAYETLKDPQKRAAYD---------
DNAJ_MYCH2      --DFYKILGVEKSASLTEIKKAYRNLVNIYHPDKNXXXXXXXXXXXXYEILSDETKRKQYDKFGH-----
DNAJ_ECOLI      --DYYEILGVSKTAEEREIRKAYKRLAMKYHPDNQGDXXXXXXXXXXYEVLTDSQKRAAYD---------
DNAJ_ECODH      --DYYEILGVSKTAEEREIRKAYKRLAMKYHPDNQGDXXXXXXXXXXYEVLTDSQKRAAYD---------
DNAJ_ECOBW      --DYYEILGVSKTAEEREIRKAYKRLAMKYHPDNQGDXXXXXXXXXXYEVLTDSQKRAAYD---------
TIM14_BOVIN     -----LILGVSPTANKAKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK-------------
PSI1_SCHPO      ------------------------------HPDKNPNGEKFKEISLAYEVLSDPQRRKLYDQYG------
DNJC3_CHICK     --DYYKILGVKRNARKQEIIKAYRKLASQWHPDNXXXXXXXXXXXXXXXVLTDPEMRRKF-DAGEDPLDA
DNAJ_LEPBP      ----YEVLGVSKGASDDEIKSAYRKLAIKYHPDKNGDXXXXXXXXXXXXVLRDPQKRQAYD---------
DNAJ_LEPBA      ----YEVLGVSKGASDDEIKSAYRKLAIKYHPDKNGDXXXXXXXXXXXXVLRDPQKRQAYD---------
ST_POVJC        ------LLGLDRSANIPVMRKAYLKKCKELHPDKGGDEDKMKRMNFLYKKMEQGVK--------------
LT_POVJC        ------LLGLDRSANIPVMRKAYLKKCKELHPDKGGDEDKMKRMNFLYKKMEQGVK--------------
HSCB_SHEON      ------------DIDTAVLADRYRELQRAVHPDKANDTEQTAQVNDGYQTLKDPIRRHMLSLRGIDHETT
DNJ60_DROME     ----YEVLNIRNDCSTREVRNAFVQLSKLYHPDVKSNAARFVQISEAYKTLIKPERRRDYDDS-------
DNAJ_WOLTR      --DYYKLLGVDRNASTDEIXXXXXXXXXXXHPDRNPGNEKFKEITAAYEVLSDSEKRAGYDRYGHE----
DJC22_PONAB     ----YQVLGLSEGATNEEIHRSYRELVKVWHPDHNLDQTEFLEIQAAYEVLSQPRKPR------------
JDP_MANSE       --DYYALLGCDENSTVEQITAEYKVLALQYHPDNDGDKEKFQQLKEAKETLCEPSKRALYD---------
HSCB_BURM1      --------------DEAALDAAYRAVQTQVHPDAAGDAQKATRANEAYRTLRDPLKRATY----------
DNAJ_THICR      --DYYEILEVSATASEGEIKKAYRKLAMRYHPDRNXXXXXXXXXXXXYEVLSDAQKRQAYD---------
DNAJ_RICFE      --DYYQILGVSKTASQXXXXXXXXXXXXQYHPDTAKDAEKFKEINSAYDVLKDEQKRAAYDRFGHD----
DNAJ_RALSO      --DYYEVLGVGKNASDDEIKKAYRKLAMKYHPDRNPDSXXXXXXXXXXXMLSDADKKAAYDQYGHDPNM-
DNAJ_PROA2      --DYYEVLGVGRSATKDEIKKAYRKLAMKYHPDKNPD---------------------------------
YCB2_PSEDE      -------LGLGASATTADIKAAYKDLVKKHHPDNGGDEERFRAVIQAYQLLK------------------
JEM1_YEAST      --DYYKILGVSPSASSKEIRKAYLNLTKKYHPDQESIHETMSQINEAYETLSDDDKRKEYDLSRSNPR--
JDP_DROME       --DFYGLLHCDENSSPEQIQAEYKVLALQYHPDNSGDKEKFQQLKEAKETLCDPEKRAIYD---------
HSCB_RALSO      ------------EVDDGALNAAYRTVQSRAHPDHASDAERRVAMQEAYQTLRDPLKRATY----------
DNJA1_PONAB     ----YDVLGVKPNATQEEXXXXXXXXXXXXHPDKNNEGEKFKQISQAYEVLSDAKKRELYD---------
DNJA1_HUMAN     ----YDVLGVKPNATQEEXXXXXXXXXXXXHPDKNNEGEKFKQISQAYEVLSDAKKRELYD---------
DNJA1_BOVIN     ----YDVLGVKPNATQEEXXXX