[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for atum0:AAK87844.1

[Show Plain Result]


## Summary of Sequence Search
    1::378
    1::378       0.0 100%  378 aa  MURG_AGRT5 RecName:
    1::371     e-131  73%  374 aa  MURG_RHIEC RecName:
    1::371     e-129  71%  374 aa  MURG_RHIL3 RecName:
    1::371     e-128  71%  374 aa  MURG_RHIE6 RecName:
    1::370     e-128  68%  373 aa  MURG_RHISN RecName:
    1::371     e-127  70%  374 aa  MURG_RHILW RecName:
   16::370     e-120  68%  374 aa  MURG_AGRRK RecName:
   16::335     e-118  72%  374 aa  MURG_SINMW RecName:
   18::369     e-116  62%  373 aa  MURG_AGRVS RecName:
   16::371     e-115  65%  374 aa  MURG_RHIME RecName:
    6::377     e-113  58%  379 aa  MURG_BRUSU RecName:
    1::371     e-113  59%  375 aa  MURG_RHILO RecName:
    6::377     e-112  58%  379 aa  MURG_BRUSI RecName:
    6::377     e-112  58%  379 aa  MURG_BRUO2 RecName:
    6::377     e-112  58%  379 aa  MURG_BRUC2 RecName:
    6::377     e-111  58%  379 aa  MURG_BRUAB RecName:
    6::377     e-111  58%  379 aa  MURG_BRUA2 RecName:
    6::377     e-111  58%  379 aa  MURG_BRUA1 RecName:
    6::377     e-110  57%  379 aa  MURG_BRUME RecName:
    6::377     e-110  57%  379 aa  MURG_BRUMB RecName:
    6::372     e-108  56%  375 aa  MURG_MESSB RecName:
    1::371     e-107  56%  375 aa  MURG_OCHA4 RecName:
    3::371     2e-84  44%  378 aa  MURG_BART1 RecName:
    3::371     2e-81  43%  378 aa  MURG_BARHE RecName:
    3::371     8e-81  49%  378 aa  MURG_BARBK RecName:
    3::371     2e-75  40%  378 aa  MURG_BARQU RecName:
    6::290     2e-73  49%  370 aa  MURG_NITHX RecName:
    7::291     1e-72  50%  367 aa  MURG_BRASO RecName:
    7::292     2e-72  51%  370 aa  MURG_METPB RecName:
    6::365     7e-72  42%  366 aa  MURG_RHOPA RecName:
    8::324     9e-72  49%  369 aa  MURG_METRJ RecName:
    7::292     1e-71  51%  369 aa  MURG_METC4 RecName:
    7::292     2e-71  51%  369 aa  MURG_METEP RecName:
    6::364     4e-70  42%  366 aa  MURG_RHOP2 RecName:
    9::362     2e-67  40%  398 aa  MURG_ERYLH RecName:
    6::364     4e-67  40%  366 aa  MURG_RHOPS RecName:
    7::291     4e-67  49%  367 aa  MURG_BRASB RecName:
    6::286     9e-67  49%  362 aa  MURG_PARDP RecName:
    6::290     8e-66  47%  366 aa  MURG_BRAJA RecName:
    6::290     1e-65  47%  368 aa  MURG_NITWN RecName:
    7::292     1e-65  50%  372 aa  MURG_METS4 RecName:
    6::364     2e-65  39%  374 aa  MURG_RHOP5 RecName:
    7::291     6e-65  46%  375 aa  MURG_RHOPB RecName:
   19::376     4e-64  40%  387 aa  MURG_RHORT RecName:
    1::288     7e-64  46%  379 aa  MURG_RHOCS RecName:
    5::291     3e-63  44%  371 aa  MURG_MAGSA RecName:
    8::387     2e-62  39%  387 aa  MURG_ZYMMO RecName:
    1::356     9e-62  40%  361 aa  MURG_ROSDO RecName:
    1::360     1e-61  37%  367 aa  MURG_JANSC RecName:
    1::285     7e-61  47%  364 aa  MURG_RHOS4 RecName:
    1::285     2e-60  47%  364 aa  MURG_RHOS1 RecName:
    7::368     5e-60  35%  368 aa  MURG_MARMM RecName:
    1::285     5e-59  46%  364 aa  MURG_RHOS5 RecName:
   15::365     9e-59  36%  365 aa  MURG_PHEZH RecName:
    9::362     9e-59  37%  388 aa  MURG_NOVAD RecName:
   10::365     1e-58  38%  384 aa  MURG_GRABC RecName:
    8::363     4e-58  38%  392 aa  MURG_SPHAL RecName:
    1::284     4e-58  44%  365 aa  MURG_SILST RecName:
    7::293     2e-56  45%  373 aa  MURG_METNO RecName:
    1::285     5e-56  43%  365 aa  MURG_SILPO RecName:
    1::289     3e-53  43%  365 aa  MURG_GLUOX RecName:
    4::360     3e-53  35%  361 aa  MURG_CAUCR RecName:
    4::360     3e-53  35%  361 aa  MURG_CAUCN RecName:
    4::315     1e-49  36%  356 aa  MURG_RICBR RecName:
    4::315     1e-49  36%  356 aa  MURG_RICB8 RecName:
    9::288     4e-49  38%  366 aa  MURG_HYPNA RecName:
    9::289     5e-48  39%  368 aa  MURG_ACICJ RecName:
    4::303     2e-47  41%  376 aa  MURG_RICRS RecName:
    4::303     2e-47  41%  376 aa  MURG_RICRO RecName:
    4::284     3e-47  40%  359 aa  MURG_ORITB RecName:
    4::303     6e-47  41%  376 aa  MURG_RICPU RecName:
    4::303     8e-47  41%  376 aa  MURG_RICAE RecName:
    4::281     1e-46  38%  354 aa  MURG_RICCK RecName:
    4::284     2e-46  39%  359 aa  MURG_ORITI RecName:
    4::304     4e-45  39%  382 aa  MURG_RICAH RecName:
    4::303     6e-45  40%  376 aa  MURG_RICM5 RecName:
    3::268     2e-44  40%  343 aa  MURG_WOLWR RecName:
    3::268     2e-44  40%  343 aa  MURG_WOLPM RecName:
    4::287     3e-44  37%  360 aa  MURG_RICFE RecName:
    4::303     4e-44  39%  376 aa  MURG_RICCN RecName:
    4::310     2e-43  39%  385 aa  MURG_RICPR RecName:
    4::279     5e-43  37%  356 aa  MURG_ANAMM RecName:
    3::268     7e-43  40%  343 aa  MURG_WOLTR RecName:
    3::265     9e-43  38%  340 aa  MURG_WOLPP RecName:
    8::292     9e-43  41%  370 aa  MURG_MAGSM RecName:
   30::346     2e-42  37%  388 aa  MURG_RHOFD RecName:
    3::333     2e-42  32%  364 aa  MURG_GEOMG RecName:
    3::333     8e-42  32%  364 aa  MURG_GEOSL RecName:
    2::281     3e-41  40%  357 aa  MURG_PSEAE RecName:
    2::281     3e-41  40%  357 aa  MURG_PSEAB RecName:
    2::281     3e-41  40%  357 aa  MURG_PSEA8 RecName:
    2::281     3e-41  40%  357 aa  MURG_PSEA7 RecName:
    3::286     3e-41  31%  365 aa  MURG_GEOUR RecName:
    3::301     5e-41  35%  381 aa  MURG_GEOLS RecName:
    4::310     1e-40  38%  385 aa  MURG_RICTY RecName:
    5::314     2e-40  33%  357 aa  MURG_NITMU RecName:
    2::280     1e-39  40%  356 aa  MURG_PSEMY RecName:
    8::317     3e-39  32%  360 aa  MURG_POLNA RecName:
    4::324     3e-39  35%  360 aa  MURG_DESAD RecName:
    5::280     6e-39  39%  356 aa  MURG_PSEU5 RecName:
    4::308     1e-38  36%  355 aa  MURG_THICR RecName:
    6::287     1e-38  35%  364 aa  MURG_ALTMD RecName:
    1::279     2e-38  37%  357 aa  MURG_NITEU RecName:
    3::284     3e-38  34%  371 aa  MURG_GEOSM RecName:
    3::304     4e-38  38%  379 aa  MURG_PELPD RecName:
    2::281     9e-38  36%  358 aa  MURG_JANMA RecName:
    5::279     1e-37  40%  361 aa  MURG_AERS4 RecName:
    8::285     1e-37  35%  362 aa  MURG_SHEB2 RecName:
    7::282     1e-37  41%  356 aa  MURG_RALEH RecName:
    1::284     1e-37  40%  362 aa  MURG_IDILO RecName:
    3::284     1e-37  33%  358 aa  MURG_GEOBB RecName:
    4::279     1e-37  36%  357 aa  MURG_AZOSE RecName:
    8::285     2e-37  35%  362 aa  MURG_SHEB5 RecName:
    5::280     2e-37  38%  356 aa  MURG_PSEPF RecName:
    7::282     3e-37  41%  356 aa  MURG_RALEJ RecName:
    3::313     3e-37  36%  355 aa  MURG_PSYIN RecName:
    8::285     4e-37  34%  362 aa  MURG_SHEB9 RecName:
    8::285     4e-37  34%  362 aa  MURG_SHEB8 RecName:
    5::279     4e-37  40%  361 aa  MURG_AERHH RecName:
    8::283     7e-37  38%  359 aa  MURG_PSEPW RecName:
   10::288     1e-36  37%  365 aa  MURG_SHEWM RecName:
    5::280     1e-36  37%  356 aa  MURG_PSEF5 RecName:
    8::283     1e-36  37%  359 aa  MURG_PSEP1 RecName:
    8::285     2e-36  34%  362 aa  MURG_SHESW RecName:
    8::285     2e-36  34%  362 aa  MURG_SHEPC RecName:
    8::285     2e-36  35%  362 aa  MURG_SHEON RecName:
    8::285     3e-36  34%  362 aa  MURG_SHESR RecName:
    8::285     3e-36  34%  362 aa  MURG_SHESA RecName:
    8::285     5e-36  34%  362 aa  MURG_SHESM RecName:
    7::284     5e-36  35%  364 aa  MURG_SHELP RecName:
    9::285     5e-36  35%  360 aa  MURG_SHEAM RecName:
   13::291     5e-36  38%  365 aa  MURG_RALSO RecName:
    8::283     5e-36  38%  359 aa  MURG_PSEPK RecName:
    4::281     5e-36  36%  358 aa  MURG_COXBU RecName:
    4::281     5e-36  36%  358 aa  MURG_COXBR RecName:
    4::281     5e-36  36%  358 aa  MURG_COXBN RecName:
    4::281     5e-36  36%  358 aa  MURG_COXB2 RecName:
    4::281     5e-36  36%  358 aa  MURG_COXB1 RecName:
    5::278     8e-36  39%  354 aa  MURG_METCA RecName:
   10::287     1e-35  38%  363 aa  MURG_MARAV RecName:
    8::318     1e-35  42%  367 aa  MURG_BURVG RecName:
    7::280     1e-35  35%  355 aa  MURG_BLOPB RecName:
    8::281     2e-35  35%  354 aa  MURG_SERP5 RecName:
    8::281     2e-35  36%  355 aa  MURG_ECOHS RecName:
    8::287     2e-35  40%  367 aa  MURG_BURCM RecName:
    8::287     2e-35  40%  367 aa  MURG_BURA4 RecName:
    5::285     2e-35  32%  361 aa  MURG_SYNAS RecName:
    5::280     2e-35  36%  356 aa  MURG_PSEFS RecName:
   10::288     3e-35  34%  365 aa  MURG_SHESH RecName:
    8::281     4e-35  35%  355 aa  MURG_SHIDS RecName:
    8::287     4e-35  38%  367 aa  MURG_BURP0 RecName:
   33::314     5e-35  35%  387 aa  MURG_POLSJ RecName:
    3::285     5e-35  30%  366 aa  MURG_GEOSF RecName:
    8::281     7e-35  35%  355 aa  MURG_SHISS RecName:
    8::281     7e-35  35%  355 aa  MURG_SHIFL RecName:
    8::281     7e-35  35%  355 aa  MURG_SHIF8 RecName:
    8::281     7e-35  35%  355 aa  MURG_SHIBS RecName:
    8::283     7e-35  36%  359 aa  MURG_PSEE4 RecName:
    8::281     7e-35  35%  355 aa  MURG_ECOUT RecName:
    8::281     7e-35  35%  355 aa  MURG_ECOSM RecName:
    8::281     7e-35  35%  355 aa  MURG_ECOSE RecName:
    8::281     7e-35  35%  355 aa  MURG_ECOLU RecName:
    8::281     7e-35  35%  355 aa  MURG_ECOLI RecName:
    8::281     7e-35  35%  355 aa  MURG_ECOLC RecName:
    8::281     7e-35  35%  355 aa  MURG_ECOL6 RecName:
    8::281     7e-35  35%  355 aa  MURG_ECOL5 RecName:
    8::281     7e-35  35%  355 aa  MURG_ECOK1 RecName:
    8::281     7e-35  35%  355 aa  MURG_ECODH RecName:
    8::281     7e-35  35%  355 aa  MURG_ECOBW RecName:
    8::281     7e-35  35%  355 aa  MURG_ECO8A RecName:
    8::281     7e-35  35%  355 aa  MURG_ECO81 RecName:
    8::281     7e-35  35%  355 aa  MURG_ECO7I RecName:
    8::281     7e-35  35%  355 aa  MURG_ECO5E RecName:
    8::281     7e-35  35%  355 aa  MURG_ECO57 RecName:
    8::281     7e-35  35%  355 aa  MURG_ECO45 RecName:
    8::281     7e-35  35%  355 aa  MURG_ECO27 RecName:
    8::281     7e-35  35%  355 aa  MURG_ECO24 RecName:
   16::347     7e-35  32%  387 aa  MURG_COLP3 RecName:
    8::287     7e-35  41%  367 aa  MURG_BURPS RecName:
    8::287     7e-35  41%  367 aa  MURG_BURP6 RecName:
    8::287     7e-35  41%  367 aa  MURG_BURMS RecName:
    8::287     7e-35  41%  367 aa  MURG_BURMA RecName:
    8::287     7e-35  41%  367 aa  MURG_BURM9 RecName:
    8::287     7e-35  41%  367 aa  MURG_BURM7 RecName:
    3::289     9e-35  34%  368 aa  MURG_LACF3 RecName:
    8::281     9e-35  35%  355 aa  MURG_ECO55 RecName:
    8::287     9e-35  38%  367 aa  MURG_BURP1 RecName:
    8::281     1e-34  35%  355 aa  MURG_SHIB3 RecName:
    1::312     1e-34  32%  357 aa  MURG_BORPA RecName:
    1::312     1e-34  32%  357 aa  MURG_BORBR RecName:
    8::281     2e-34  36%  355 aa  MURG_SALAR RecName:
    1::285     2e-34  39%  368 aa  MURG_METFK RecName:
    7::283     3e-34  37%  360 aa  MURG_HAHCH RecName:
    8::282     3e-34  35%  355 aa  MURG_YERE8 RecName:
    8::281     4e-34  36%  356 aa  MURG_YERPN RecName:
    8::281     4e-34  36%  356 aa  MURG_YERPG RecName:
    8::281     4e-34  36%  356 aa  MURG_YERPE RecName:
    8::281     4e-34  36%  356 aa  MURG_YERPA RecName:
    8::281     4e-34  35%  363 aa  MURG_ERWCT RecName:
    3::283     4e-34  38%  383 aa  MURG_ANADE RecName:
   10::288     6e-34  33%  365 aa  MURG_SHEVI RecName:
    3::283     6e-34  36%  383 aa  MURG_ANASK RecName:
    3::283     6e-34  36%  383 aa  MURG_ANAD2 RecName:
    8::281     8e-34  34%  355 aa  MURG_SALNS RecName:
    8::281     8e-34  34%  355 aa  MURG_SALG2 RecName:
    8::281     8e-34  34%  355 aa  MURG_SALDC RecName:
    8::281     8e-34  34%  355 aa  MURG_SALCH RecName:
    8::281     8e-34  34%  363 aa  MURG_PECCP RecName:
    6::289     8e-34  37%  376 aa  MURG_PARUW RecName:
    7::282     8e-34  37%  355 aa  MURG_NEIMF RecName:
    8::281     1e-33  36%  355 aa  MURG_PHOLL RecName:
    7::282     1e-33  37%  355 aa  MURG_NEIMB RecName:
    8::281     2e-33  34%  355 aa  MURG_SALEP RecName:
    7::282     2e-33  37%  355 aa  MURG_NEIG2 RecName:
    7::282     2e-33  37%  355 aa  MURG_NEIG1 RecName:
    6::279     2e-33  36%  352 aa  MURG_ERWT9 RecName:
    8::281     2e-33  35%  355 aa  MURG_CITK8 RecName:
    8::281     2e-33  35%  356 aa  MURG_YERPP RecName:
    8::281     2e-33  34%  355 aa  MURG_SALTY RecName:
    8::281     2e-33  34%  355 aa  MURG_SALSV RecName:
    8::281     2e-33  34%  355 aa  MURG_SALPK RecName:
    8::281     2e-33  34%  355 aa  MURG_SALPB RecName:
    8::281     2e-33  34%  355 aa  MURG_SALPA RecName:
    8::281     2e-33  34%  355 aa  MURG_SALHS RecName:
    8::281     2e-33  34%  355 aa  MURG_SALA4 RecName:
    5::280     2e-33  36%  356 aa  MURG_PSE14 RecName:
    7::282     3e-33  39%  355 aa  MURG_NEIM0 RecName:
    3::370     3e-33  29%  371 aa  MURG_HALOH RecName:
    8::281     3e-33  35%  355 aa  MURG_ESCF3 RecName:
    8::287     3e-33  38%  367 aa  MURG_BURCJ RecName:
    8::287     3e-33  39%  367 aa  MURG_BURCH RecName:
    8::287     3e-33  39%  367 aa  MURG_BURCA RecName:
    3::283     3e-33  35%  381 aa  MURG_ANADF RecName:
    8::283     4e-33  35%  359 aa  MURG_PSEPG RecName:
    7::282     5e-33  37%  355 aa  MURG_NEIMA RecName:
    8::287     5e-33  39%  367 aa  MURG_BURCC RecName:
    8::281     8e-33  34%  355 aa  MURG_SALTI RecName:
    8::281     8e-33  34%  356 aa  MURG_KLEP3 RecName:
    6::280     1e-32  35%  358 aa  MURG_PSEHT RecName:
    5::259     1e-32  35%  360 aa  MURG_ACIF5 RecName:
    5::259     1e-32  35%  360 aa  MURG_ACIF2 RecName:
    5::280     2e-32  36%  356 aa  MURG_PSESM RecName:
    8::281     2e-32  34%  355 aa  MURG_ENTS8 RecName:
    7::280     2e-32  33%  353 aa  MURG_VIBSL RecName:
   10::288     2e-32  34%  365 aa  MURG_SHEHH RecName:
    1::284     4e-32  31%  360 aa  MURG_BLOFL RecName:
    8::281     5e-32  34%  356 aa  MURG_YERPY RecName:
    8::281     5e-32  34%  356 aa  MURG_YERPS RecName:
    8::281     5e-32  34%  356 aa  MURG_YERPB RecName:
    8::281     5e-32  34%  356 aa  MURG_YERP3 RecName:
   10::289     5e-32  32%  366 aa  MURG_SHEDO RecName:
    5::280     5e-32  36%  356 aa  MURG_PSEU2 RecName:
    4::331     5e-32  33%  383 aa  MURG_MYXXD RecName:
    8::281     5e-32  34%  356 aa  MURG_KLEP7 RecName:
    8::287     5e-32  39%  367 aa  MURG_BURM1 RecName:
    7::280     7e-32  33%  355 aa  MURG_VIBVY RecName:
    7::280     7e-32  33%  355 aa  MURG_VIBHB RecName:
    7::280     9e-32  33%  355 aa  MURG_VIBVU RecName:
    1::281     9e-32  37%  357 aa  MURG_POLSQ RecName:
    4::310     2e-31  33%  361 aa  MURG_ACIBL RecName:
   15::304     2e-31  35%  382 aa  MURG_PSEA6 RecName:
    4::290     2e-31  36%  409 aa  MURG_CLOD6 RecName:
    4::272     3e-31  34%  347 aa  MURG_SULSY RecName:
   11::290     3e-31  31%  367 aa  MURG_SHEFN RecName:
    5::315     3e-31  34%  359 aa  MURG_NITOC RecName:
    1::294     3e-31  35%  370 aa  MURG_CALS8 RecName:
    8::287     3e-31  38%  367 aa  MURG_BURS3 RecName:
    5::280     4e-31  35%  355 aa  MURG_HAEDU RecName:
    3::368     4e-31  29%  373 aa  MURG_DESAP RecName:
    5::276     4e-31  35%  351 aa  MURG_ACTP2 RecName:
    6::278     5e-31  33%  351 aa  MURG_HAEIN RecName:
    1::278     5e-31  33%  351 aa  MURG_HAEIE RecName:
    6::278     6e-31  33%  351 aa  MURG_HAEIG RecName:
    6::278     6e-31  33%  351 aa  MURG_HAEI8 RecName:
    3::318     8e-31  31%  362 aa  MURG_PEDPA RecName:
    9::319     8e-31  35%  372 aa  MURG_BURPP RecName:
    1::312     8e-31  32%  357 aa  MURG_BORPD RecName:
    5::276     8e-31  36%  351 aa  MURG_ACTPJ RecName:
    5::276     8e-31  36%  351 aa  MURG_ACTP7 RecName:
    8::281     1e-30  33%  354 aa  MURG_VIBFM RecName:
    8::281     1e-30  33%  354 aa  MURG_VIBF1 RecName:
    3::288     1e-30  32%  366 aa  MURG_THEYD RecName:
    1::281     1e-30  37%  356 aa  MURG_RALME RecName:
    3::289     1e-30  34%  369 aa  MURG_CLOTH RecName:
   10::288     2e-30  33%  365 aa  MURG_SHEPA RecName:
    8::279     2e-30  33%  354 aa  MURG_PASMU RecName:
    3::291     2e-30  32%  370 aa  MURG_LACRJ RecName:
    3::291     2e-30  32%  370 aa  MURG_LACRD RecName:
    1::279     2e-30  33%  355 aa  MURG_NITEC RecName:
    1::312     2e-30  30%  357 aa  MURG_BORPE RecName:
    3::317     2e-30  32%  366 aa  MURG_BACLD RecName:
    3::336     3e-30  28%  371 aa  MURG_CARHZ RecName:
    5::283     4e-30  35%  363 aa  MURG_LAWIP RecName:
    6::287     4e-30  37%  363 aa  MURG_CELJU RecName:
    4::279     4e-30  33%  356 aa  MURG_AZOSB RecName:
    3::286     5e-30  35%  363 aa  MURG_LACCB RecName:
    3::286     5e-30  35%  363 aa  MURG_LACC3 RecName:
    4::281     5e-30  32%  358 aa  MURG_HERAR RecName:
    8::281     7e-30  34%  355 aa  MURG_SODGM RecName:
    3::320     7e-30  29%  363 aa  MURG_BACSU RecName:
    6::321     9e-30  30%  361 aa  MURG_PSYCK RecName:
    3::289     9e-30  30%  363 aa  MURG_ENTFA RecName:
    9::319     9e-30  34%  372 aa  MURG_BURXL RecName:
    2::281     1e-29  32%  354 aa  MURG_VIBCM RecName:
    2::281     1e-29  32%  354 aa  MURG_VIBCH RecName:
    4::275     1e-29  37%  358 aa  MURG_SYNS9 RecName:
   52::313     1e-29  34%  399 aa  MURG_DIAST RecName:
   52::313     1e-29  34%  399 aa  MURG_ACISJ RecName:
    3::316     1e-29  34%  363 aa  MURG_LISMF RecName:
    3::316     1e-29  34%  363 aa  MURG_LISMC RecName:
    3::286     1e-29  35%  358 aa  MURG_EXISA RecName:
   13::326     1e-29  33%  372 aa  MURG_DESRM RecName:
    3::311     1e-29  34%  398 aa  MURG_DEIRA RecName:
    8::287     1e-29  37%  367 aa  MURG_BURTA RecName:
    3::320     1e-29  28%  363 aa  MURG_BACA2 RecName:
   10::288     2e-29  33%  365 aa  MURG_SHEPW RecName:
    5::288     2e-29  35%  377 aa  MURG_OPITP RecName:
    3::288     2e-29  34%  361 aa  MURG_DEIGD RecName:
    5::310     2e-29  32%  352 aa  MURG_DECAR RecName:
    6::321     3e-29  31%  361 aa  MURG_PSYA2 RecName:
    7::284     3e-29  31%  357 aa  MURG_CHLFF RecName:
    2::281     3e-29  32%  354 aa  MURG_VIBC3 RecName:
    8::356     3e-29  31%  357 aa  MURG_NOSP7 RecName:
    3::316     3e-29  34%  363 aa  MURG_LISMO RecName:
    3::316     3e-29  34%  363 aa  MURG_LISMH RecName:
    3::288     3e-29  35%  364 aa  MURG2_BACAH RecName:
    3::288     3e-29  35%  364 aa  MURG1_BACCZ RecName:
    3::288     3e-29  35%  364 aa  MURG1_BACAN RecName:
    4::271     4e-29  36%  373 aa  MURG_BURP8 RecName:
    3::288     4e-29  34%  364 aa  MURG1_BACCR RecName:
    3::288     4e-29  35%  364 aa  MURG1_BACC1 RecName:
    8::280     6e-29  30%  353 aa  MURG_CHLMU RecName:
    4::275     7e-29  36%  358 aa  MURG_SYNPW RecName:
   15::312     7e-29  33%  358 aa  MURG_PELCD RecName:
    3::284     7e-29  33%  360 aa  MURG_ENTHR RecName:
    4::281     7e-29  30%  353 aa  MURG_BUCBP RecName:
    3::288     7e-29  30%  366 aa  MURG_ALKMQ RecName:
    8::286     1e-28  32%  360 aa  MURG_PROMH RecName:
    5::329     1e-28  34%  357 aa  MURG_ALHEH RecName:
    3::288     1e-28  34%  364 aa  MURG1_BACHK RecName:
    3::317     2e-28  30%  363 aa  MURG_LACPL RecName:
    3::289     2e-28  34%  364 aa  MURG_EXIS2 RecName:
    3::288     2e-28  31%  363 aa  MURG_BACHD RecName:
    3::288     2e-28  31%  363 aa  MURG_ANOFW RecName:
    4::338     2e-28  27%  364 aa  MURG_THEPX RecName:
    4::338     2e-28  27%  364 aa  MURG_THEP3 RecName:
    5::276     2e-28  32%  351 aa  MURG_HAEPS RecName:
    4::273     3e-28  34%  355 aa  MURG_PROM4 RecName:
    8::326     4e-28  30%  357 aa  MURG_MICAN RecName:
    3::287     4e-28  31%  363 aa  MURG_LEUMM RecName:
    3::316     5e-28  31%  363 aa  MURG_LISW6 RecName:
    3::288     6e-28  34%  363 aa  MURG_LISIN RecName:
    1::281     6e-28  32%  357 aa  MURG_BORA1 RecName:
    4::275     8e-28  35%  361 aa  MURG_PROM3 RecName:
    3::290     1e-27  32%  364 aa  MURG_CLOCE RecName:
   32::344     1e-27  29%  389 aa  MURG_SACD2 RecName:
    7::282     1e-27  32%  355 aa  MURG_MANSM RecName:
    3::288     1e-27  32%  364 aa  MURG_BACCN RecName:
    7::283     2e-27  31%  357 aa  MURG_HAES1 RecName:
    4::284     2e-27  33%  365 aa  MURG_DESVH RecName:
    7::279     2e-27  32%  352 aa  MURG_CHLTR RecName:
    7::279     2e-27  32%  352 aa  MURG_CHLTA RecName:
    8::293     2e-27  32%  366 aa  MURG_THIDA RecName:
    4::284     2e-27  33%  365 aa  MURG_DESVV RecName:
    7::279     2e-27  31%  352 aa  MURG_CHLTB RecName:
    7::279     2e-27  31%  352 aa  MURG_CHLT2 RecName:
    3::288     2e-27  29%  364 aa  MURG_BACP2 RecName:
    8::356     2e-27  33%  357 aa  MURG_ANASP RecName:
    4::275     4e-27  35%  361 aa  MURG_PROMM RecName:
    4::305     4e-27  32%  351 aa  MURG_CYAP8 RecName:
    1::280     5e-27  34%  354 aa  MURG_PHOPR RecName:
    1::288     5e-27  33%  361 aa  MURG_FLAJ1 RecName:
    8::289     5e-27  31%  363 aa  MURG_DICNV RecName:
    1::281     7e-27  33%  357 aa  MURG_GLOVI RecName:
   58::286     7e-27  32%  357 aa  MURG_BDEBA RecName:
    3::293     9e-27  32%  370 aa  MURG_LACJO RecName:
   16::304     9e-27  30%  380 aa  MURG_BACFR RecName:
   16::304     9e-27  30%  380 aa  MURG_BACFN RecName:
    7::280     1e-26  30%  355 aa  MURG_VIBPA RecName:
   19::290     1e-26  34%  369 aa  MURG_DESPS RecName:
    5::266     1e-26  34%  356 aa  MURG_AZOVD RecName:
    4::275     2e-26  33%  358 aa  MURG_SYNS3 RecName:
   15::320     2e-26  30%  361 aa  MURG_SOLUE RecName:
    3::290     2e-26  32%  373 aa  MURG_OENOB RecName:
    1::289     3e-26  33%  363 aa  MURG_LACSS RecName:
    3::293     3e-26  31%  370 aa  MURG_LACGA RecName:
    5::281     3e-26  33%  355 aa  MURG_TOLAT RecName:
    3::293     6e-26  30%  368 aa  MURG_LACH4 RecName:
    1::280     6e-26  28%  354 aa  MURG_BUCAP RecName:
    4::338     8e-26  27%  364 aa  MURG_THETN RecName:
    8::269     8e-26  31%  355 aa  MURG_ACIAC RecName:
    3::288     1e-25  34%  364 aa  MURG_CHLP8 RecName:
    4::275     1e-25  30%  360 aa  MURG_SYNR3 RecName:
   13::294     1e-25  38%  371 aa  MURG_MOOTA RecName:
    3::293     1e-25  30%  368 aa  MURG_LACAC RecName:
    9::287     1e-25  31%  364 aa  MURG_CHRSD RecName:
    8::285     1e-25  30%  358 aa  MURG_CHLCV RecName:
   19::294     1e-25  30%  376 aa  MURG_BACV8 RecName:
   13::299     2e-25  30%  379 aa  MURG_PORG3 RecName:
    3::288     2e-25  29%  369 aa  MURG_LEUCK RecName:
   98::294     2e-25  39%  371 aa  MURG_FRATN RecName:
   13::299     2e-25  30%  379 aa  MURG_PORGI RecName:
    3::317     2e-25  30%  364 aa  MURG_LACBA RecName:
   21::294     3e-25  33%  441 aa  MURG_XANOR RecName:
    5::270     3e-25  31%  340 aa  MURG_SULDN RecName:
   13::313     3e-25  28%  357 aa  MURG_LACLS RecName:
   13::313     3e-25  28%  357 aa  MURG_LACLM RecName:
    1::265     3e-25  36%  358 aa  MURG_HALHL RecName:
   21::294     5e-25  33%  441 aa  MURG_XANOM RecName:
   21::291     5e-25  33%  369 aa  MURG_CYTH3 RecName:
    4::279     5e-25  31%  355 aa  MURG_CLOPH RecName:
    3::288     5e-25  36%  364 aa  MURG_CHLTE RecName:
   15::291     8e-25  29%  366 aa  MURG_XYLFM RecName:
    8::291     1e-24  31%  370 aa  MURG_SALRD RecName:
    7::289     1e-24  30%  367 aa  MURG_FLAPJ RecName:
    8::285     1e-24  29%  358 aa  MURG_CHLAB RecName:
    3::288     1e-24  32%  365 aa  MURG_PELLD RecName:
   18::292     2e-24  31%  368 aa  MURG_PARD8 RecName:
    4::322     2e-24  32%  382 aa  MURG_DESVM RecName:
    3::288     2e-24  31%  370 aa  MURG_FINM2 RecName:
   13::293     2e-24  33%  369 aa  MURG_DESHD RecName:
   27::318     4e-24  33%  401 aa  MURG_MYCVP RecName:
    7::284     4e-24  32%  357 aa  MURG_FUSNN RecName:
   13::293     5e-24  30%  369 aa  MURG_DESHY RecName:
    8::284     5e-24  29%  357 aa  MURG_CHLPN RecName:
   28::330     9e-24  29%  374 aa  MURG_TRIEI RecName:
    4::275     9e-24  32%  358 aa  MURG_SYNSC RecName:
    4::278     9e-24  31%  362 aa  MURG_PROM2 RecName:
    5::290     9e-24  32%  376 aa  MURG_FRASC RecName:
    3::287     2e-23  27%  366 aa  MURG_ALKOO RecName:
    4::278     3e-23  32%  363 aa  MURG_PROMS RecName:
    1::289     3e-23  32%  366 aa  MURG_GRAFK RecName:
    3::288     3e-23  32%  364 aa  MURG_CHLL2 RecName:
    4::278     4e-23  31%  363 aa  MURG_PROM0 RecName:
   10::285     4e-23  35%  360 aa  MURG_COREF RecName:
    3::288     4e-23  33%  365 aa  MURG_CHLT3 RecName:
    8::279     5e-23  30%  364 aa  MURG_PROMP RecName:
    4::294     5e-23  32%  375 aa  MURG_PELTS RecName:
    4::278     6e-23  30%  363 aa  MURG_PROM9 RecName:
    5::308     6e-23  29%  353 aa  MURG_HELPJ RecName:
   22::295     8e-23  33%  431 aa  MURG_XANC5 RecName:
    4::279     8e-23  32%  352 aa  MURG_PROM1 RecName:
    3::293     8e-23  29%  370 aa  MURG_LACDB RecName:
    3::293     8e-23  29%  370 aa  MURG_LACDA RecName:
    4::288     8e-23  31%  368 aa  MURG_DESMR RecName:
    4::279     1e-22  32%  352 aa  MURG_PROMT RecName:
    8::279     1e-22  31%  364 aa  MURG_PROM5 RecName:
    4::292     1e-22  35%  372 aa  MURG_PROAC RecName:
    3::286     1e-22  29%  365 aa  MURG_NOCSJ RecName:
   34::321     1e-22  34%  408 aa  MURG_MYCA1 RecName:
    3::259     1e-22  32%  357 aa  MURG_ALCBS RecName:
    7::277     2e-22  31%  355 aa  MURG_SYNY3 RecName:
    8::356     2e-22  34%  357 aa  MURG_ANAVT RecName:
    3::293     3e-22  31%  367 aa  MURG_NATTJ RecName:
    5::308     3e-22  28%  353 aa  MURG_HELPY RecName:
    5::266     4e-22  31%  338 aa  MURG_RUTMC RecName:
    3::288     5e-22  36%  365 aa  MURG_PELPB RecName:
   34::321     5e-22  32%  408 aa  MURG_MYCPA RecName:
   55::290     5e-22  31%  376 aa  MURG_FRAAA RecName:
  124::291     7e-22  35%  367 aa  MURG_XYLFA RecName:
    3::289     7e-22  26%  365 aa  MURG_LACS1 RecName:
    6::277     7e-22  29%  360 aa  MURG_CHRVO RecName:
   13::291     9e-22  30%  367 aa  MURG_SYNWW RecName:
    5::308     9e-22  28%  353 aa  MURG_HELPH RecName:
    3::288     9e-22  31%  362 aa  MURG_CHLCH RecName:
    6::280     9e-22  28%  354 aa  MURG_BUCAT RecName:
    6::280     9e-22  28%  354 aa  MURG_BUCAI RecName:
    1::282     1e-21  27%  357 aa  MURG_CLONN RecName:
    6::281     1e-21  31%  358 aa  MURG_BAUCH RecName:
   12::288     1e-21  27%  364 aa  MURG_XYLFT RecName:
   15::291     1e-21  27%  367 aa  MURG_XYLF2 RecName:
    5::308     1e-21  28%  353 aa  MURG_HELP2 RecName:
    4::279     1e-21  33%  354 aa  MURG_EUBE2 RecName:
    6::280     1e-21  28%  354 aa  MURG_BUCA5 RecName:
    4::286     2e-21  35%  405 aa  MURG_SORC5 RecName:
    3::288     2e-21  35%  365 aa  MURG_PROA2 RecName:
    3::315     2e-21  37%  393 aa  MURG_BIFAA RecName:
   14::283     3e-21  31%  362 aa  MURG_SYNJA RecName:
    4::274     3e-21  31%  357 aa  MURG_PROMA RecName:
    4::274     3e-21  28%  348 aa  MURG_CYAA5 RecName:
    1::281     3e-21  27%  359 aa  MURG_CLOAB RecName:
    7::279     3e-21  33%  356 aa  MURG_THEEB RecName:
    3::288     3e-21  34%  368 aa  MURG_PROVI RecName:
    5::285     3e-21  31%  361 aa  MURG_ELUMP RecName:
    3::288     3e-21  33%  364 aa  MURG_CHLPD RecName:
   14::288     4e-21  30%  367 aa  MURG_SYNJB RecName:
    5::308     4e-21  28%  353 aa  MURG_HELPS RecName:
   98::294     4e-21  37%  371 aa  MURG_FRATT RecName:
   98::294     4e-21  37%  371 aa  MURG_FRAT1 RecName:
    4::275     6e-21  32%  358 aa  MURG_SYNPX RecName:
   98::294     6e-21  37%  371 aa  MURG_FRATW RecName:
   98::294     6e-21  37%  371 aa  MURG_FRATO RecName:
   98::294     6e-21  37%  371 aa  MURG_FRATM RecName:
   98::294     6e-21  37%  371 aa  MURG_FRATH RecName:
   98::294     6e-21  37%  371 aa  MURG_FRATF RecName:
    4::283     6e-21  30%  360 aa  MURG_DICTD RecName:
   13::295     6e-21  30%  370 aa  MURG_CORJK RecName:
   12::271     6e-21  31%  365 aa  MURG_ACIAD RecName:
   12::271     7e-21  30%  365 aa  MURG_ACIBY RecName:
   12::271     7e-21  30%  365 aa  MURG_ACIBC RecName:
   12::271     7e-21  30%  365 aa  MURG_ACIB5 RecName:
   12::271     7e-21  30%  365 aa  MURG_ACIB3 RecName:
    4::283     1e-20  30%  360 aa  MURG_DICT6 RecName:
    1::321     1e-20  26%  367 aa  MURG_METPP RecName:
   12::271     1e-20  30%  365 aa  MURG_ACIBS RecName:
  100::294     2e-20  35%  371 aa  MURG_FRAP2 RecName:
    4::279     2e-20  28%  353 aa  MURG_CLOK5 RecName:
    8::348     3e-20  26%  360 aa  MURG_CYAP7 RecName:
    3::278     3e-20  32%  356 aa  MURG_CORGB RecName:
   10::302     4e-20  34%  389 aa  MURG_RHOE4 RecName:
    4::268     4e-20  31%  373 aa  MURG_DESDG RecName:
    3::278     4e-20  32%  356 aa  MURG_CORGL RecName:
    3::291     4e-20  30%  364 aa  MURG_AMOA5 RecName:
    8::281     4e-20  28%  354 aa  MURG_ALISL RecName:
    8::268     5e-20  31%  340 aa  MURG_VESOH RecName:
    5::308     5e-20  27%  353 aa  MURG_HELPG RecName:
   79::295     5e-20  33%  372 aa  MURG_BACTN RecName:
   12::271     6e-20  30%  365 aa  MURG_ACIBT RecName:
    4::305     8e-20  30%  339 aa  MURG_THEP1 RecName:
    4::305     8e-20  30%  339 aa  MURG_THEMA RecName:
    4::274     1e-19  28%  350 aa  MURG_HELHP RecName:
    1::307     1e-19  28%  344 aa  MURG_AQUAE RecName:
    1::279     1e-19  30%  356 aa  MURG_PELUB RecName:
    3::308     1e-19  27%  353 aa  MURG_HELAH RecName:
   69::300     2e-19  28%  338 aa  MURG_SULNB RecName:
    3::283     4e-19  30%  379 aa  MURG_THEFY RecName:
   12::304     4e-19  30%  385 aa  MURG_MYCS2 RecName:
    1::279     4e-19  30%  359 aa  MURG_CORDI RecName:
   21::294     5e-19  31%  426 aa  MURG_XANAC RecName:
   20::358     5e-19  31%  439 aa  MURG_ROSS1 RecName:
    3::359     1e-18  28%  363 aa  MURG_STRAW RecName:
   22::312     1e-18  31%  399 aa  MURG_MYCUA RecName:
   13::282     1e-18  26%  357 aa  MURG_LACLA RecName:
   13::268     2e-18  28%  341 aa  MURG_CAMHC RecName:
    3::307     2e-18  28%  382 aa  MURG_DEIDV RecName:
   22::312     3e-18  31%  399 aa  MURG_MYCMM RecName:
    8::317     4e-18  25%  359 aa  MURG_VEREI RecName:
   31::318     4e-18  33%  407 aa  MURG_MYCLE RecName:
   31::318     4e-18  33%  407 aa  MURG_MYCLB RecName:
    7::289     8e-18  28%  373 aa  MURG_MYCSS RecName:
    7::289     8e-18  28%  373 aa  MURG_MYCSK RecName:
    3::362     1e-17  28%  362 aa  MURG_STRCU RecName:
    5::280     1e-17  27%  358 aa  MURG_CLOTE RecName:
  114::268     1e-17  35%  333 aa  MURG_NITSB RecName:
   13::270     3e-17  26%  336 aa  MURG_WOLSU RecName:
    3::289     3e-17  30%  369 aa  MURG_ACIC1 RecName:
    1::281     4e-17  26%  357 aa  MURG_CLOPS RecName:
   59::268     4e-17  31%  342 aa  MURG_CAMJD RecName:
    1::316     4e-17  36%  393 aa  MURG_BIFLO RecName:
    1::316     4e-17  36%  393 aa  MURG_BIFLD RecName:
  100::302     5e-17  34%  377 aa  MURG_SACEN RecName:
    4::284     5e-17  30%  358 aa  MURG_LEPBL RecName:
    4::284     5e-17  30%  358 aa  MURG_LEPBJ RecName:
    4::283     6e-17  30%  356 aa  MURG_TROWT RecName:
    4::283     6e-17  30%  356 aa  MURG_TROW8 RecName:
    5::281     6e-17  27%  356 aa  MURG_GEOTN RecName:
    1::281     8e-17  26%  357 aa  MURG_CLOPE RecName:
    1::281     8e-17  26%  357 aa  MURG_CLOP1 RecName:
    8::316     8e-17  35%  393 aa  MURG_BIFLI RecName:
    1::281     1e-16  24%  357 aa  MURG_CLOBB RecName:
   14::305     1e-16  27%  339 aa  MURG_THESQ RecName:
    4::305     1e-16  28%  339 aa  MURG_THENN RecName:
    1::281     2e-16  26%  358 aa  MURG_CLOBA RecName:
    4::280     2e-16  28%  356 aa  MURG_STAAB RecName:
    3::359     3e-16  25%  364 aa  MURG_STRCO RecName:
    4::280     3e-16  26%  356 aa  MURG_STAAR RecName:
    1::281     3e-16  32%  357 aa  MURG_GEOSW RecName:
    5::281     4e-16  29%  357 aa  MURG_GEOKA RecName:
   96::283     5e-16  32%  359 aa  MURG_WIGBR RecName:
    4::280     7e-16  27%  356 aa  MURG_STAAW RecName:
    4::280     7e-16  27%  356 aa  MURG_STAAS RecName:
    4::280     7e-16  27%  356 aa  MURG_STAAN RecName:
    4::280     7e-16  27%  356 aa  MURG_STAAM RecName:
    4::280     7e-16  27%  356 aa  MURG_STAAE RecName:
    4::280     7e-16  27%  356 aa  MURG_STAAC RecName:
    4::280     7e-16  27%  356 aa  MURG_STAA9 RecName:
    4::280     7e-16  27%  356 aa  MURG_STAA8 RecName:
    4::280     7e-16  27%  356 aa  MURG_STAA2 RecName:
    4::280     7e-16  27%  356 aa  MURG_STAA1 RecName:
    4::279     7e-16  24%  354 aa  MURG_CLOBM RecName:
   82::268     9e-16  32%  342 aa  MURG_CAMJR RecName:
   82::268     9e-16  32%  342 aa  MURG_CAMJJ RecName:
   82::268     9e-16  32%  342 aa  MURG_CAMJE RecName:
   82::268     9e-16  32%  342 aa  MURG_CAMJ8 RecName:
    4::280     1e-15  27%  356 aa  MURG_STAAT RecName:
    4::280     1e-15  27%  356 aa  MURG_STAA3 RecName:
    7::289     2e-15  26%  373 aa  MURG_MYCSJ RecName:
    1::281     2e-15  28%  359 aa  MURG_CLOB8 RecName:
    4::266     2e-15  26%  334 aa  MURG_THEAB RecName:
    4::279     4e-15  24%  354 aa  MURG_BACSK RecName:
    5::277     5e-15  28%  358 aa  MURG_STRU0 RecName:
    4::280     6e-15  24%  362 aa  MURG_STACT RecName:
    4::279     2e-14  25%  352 aa  MURG2_BACCZ RecName:
    4::279     3e-14  24%  352 aa  MURG2_BACCR RecName:
    4::279     3e-14  24%  352 aa  MURG2_BACC1 RecName:
    4::284     4e-14  29%  358 aa  MURG_LEPIN RecName:
    4::284     4e-14  29%  358 aa  MURG_LEPIC RecName:
    4::279     4e-14  24%  352 aa  MURG3_BACAH RecName:
    4::279     4e-14  24%  352 aa  MURG2_BACHK RecName:
    4::279     4e-14  25%  352 aa  MURG2_BACAN RecName:
    3::270     5e-14  26%  357 aa  MURG_OCEIH RecName:
    4::280     9e-14  24%  355 aa  MURG_STAHJ RecName:
    3::283     9e-14  30%  367 aa  MURG_CLAMS RecName:
    4::277     2e-13  28%  356 aa  MURG_STRGC RecName:
    5::277     3e-13  28%  354 aa  MURG3_BACCR RecName:
    5::279     3e-13  26%  360 aa  MURG_STRS7 RecName:
    5::279     4e-13  26%  360 aa  MURG_STREM RecName:
   22::295     6e-13  24%  427 aa  MURG_XANCP RecName:
   22::295     6e-13  24%  427 aa  MURG_XANCB RecName:
   22::295     6e-13  24%  427 aa  MURG_XANC8 RecName:
    5::279     6e-13  27%  360 aa  MURG_STRP6 RecName:
    5::279     1e-12  27%  360 aa  MURG_STRPG RecName:
    1::277     1e-12  28%  354 aa  MURG1_BACAH RecName:
    5::279     2e-12  27%  360 aa  MURG_STRPD RecName:
    5::279     2e-12  27%  360 aa  MURG_STRP3 RecName:
    1::280     2e-12  24%  361 aa  MURG_STRMU RecName:
    4::173     2e-12  25%  354 aa  MURG_CLOB6 RecName:
    6::272     3e-12  31%  339 aa  MURG_THELT RecName:
    4::287     3e-12  29%  374 aa  MURG_SYMTH RecName:
    5::279     3e-12  25%  360 aa  MURG_STRE4 RecName:
    5::279     4e-12  26%  360 aa  MURG_STRPZ RecName:
    5::279     4e-12  26%  360 aa  MURG_STRPM RecName:
    5::279     4e-12  26%  360 aa  MURG_STRP8 RecName:
    5::279     4e-12  26%  360 aa  MURG_STRP1 RecName:
    4::281     4e-12  25%  358 aa  MURG_STAS1 RecName:
    4::173     4e-12  25%  354 aa  MURG_CLOBL RecName:
    4::173     4e-12  25%  354 aa  MURG_CLOBK RecName:
    5::279     5e-12  26%  360 aa  MURG_STRPC RecName:
    5::279     5e-12  26%  360 aa  MURG_STRPB RecName:
    4::173     5e-12  25%  354 aa  MURG_CLOBJ RecName:
    4::173     5e-12  25%  354 aa  MURG_CLOBH RecName:
    4::173     5e-12  25%  354 aa  MURG_CLOB1 RecName:
   85::302     8e-12  29%  384 aa  MURG_TREPS RecName:
   85::302     8e-12  29%  384 aa  MURG_TREPA RecName:
   14::216     8e-12  28%  372 aa  MURG_ARTAT RecName:
    5::279     1e-11  26%  360 aa  MURG_STRPF RecName:
   71::257     1e-11  28%  336 aa  MURG_RUBXD RecName:
    4::280     2e-11  25%  357 aa  MURG_STAES RecName:
    4::280     2e-11  25%  357 aa  MURG_STAEQ RecName:
   29::278     4e-11  28%  354 aa  MURG_STRSY RecName:
   29::278     4e-11  28%  354 aa  MURG_STRS2 RecName:
   29::277     4e-11  25%  352 aa  MURG_STRPI RecName:
   29::277     5e-11  26%  352 aa  MURG_STRZP RecName:
   29::277     5e-11  26%  352 aa  MURG_STRP4 RecName:
   29::277     7e-11  24%  352 aa  MURG_STRZT RecName:
   29::277     7e-11  24%  352 aa  MURG_STRP7 RecName:
   75::277     1e-10  27%  352 aa  MURG_STRPN RecName:
   76::278     1e-10  29%  358 aa  MURG_STRA5 RecName:
   76::278     1e-10  29%  358 aa  MURG_STRA3 RecName:
   76::278     1e-10  29%  358 aa  MURG_STRA1 RecName:
    4::266     2e-10  25%  334 aa  MURG_THEM4 RecName:
   29::277     2e-10  24%  352 aa  MURG_STRR6 RecName:
   29::277     2e-10  24%  352 aa  MURG_STRP2 RecName:
   29::277     2e-10  24%  352 aa  MURG_STRZJ RecName:
   78::279     2e-10  27%  356 aa  MURG_STRTD RecName:
   78::279     2e-10  27%  356 aa  MURG_STRT2 RecName:
   78::279     2e-10  27%  356 aa  MURG_STRT1 RecName:
   29::277     2e-10  27%  356 aa  MURG_STRSV RecName:
   29::277     2e-10  26%  352 aa  MURG_STRPS RecName:
   29::277     3e-10  24%  352 aa  MURG_STRPJ RecName:
   38::328     3e-10  26%  410 aa  MURG_MYCBT RecName:
   38::328     3e-10  26%  410 aa  MURG_MYCBP RecName:
   38::328     3e-10  26%  410 aa  MURG_MYCBO RecName:
   17::304     6e-10  24%  378 aa  MURG_NOCFA RecName:
  159::328     1e-09  32%  410 aa  MURG_MYCTU RecName:
  159::328     1e-09  32%  410 aa  MURG_MYCTA RecName:
    5::281     2e-09  24%  363 aa  MURG_LEGPC RecName:
    1::267     2e-09  23%  335 aa  MURG_CAMFF RecName:
   14::302     3e-09  28%  391 aa  MURG_TREDE RecName:
    8::291     4e-09  27%  366 aa  MURG_ARTS2 RecName:
   10::302     3e-08  26%  382 aa  MURG_RHOSR RecName:
   14::250     1e-07  25%  363 aa  MURG_SYNP6 RecName:
    8::244     1e-07  25%  357 aa  MURG_SYNE7 RecName:
   98::281     2e-07  27%  362 aa  MURG_BORHD RecName:
    5::281     5e-07  23%  363 aa  MURG_LEGPL RecName:
    5::281     5e-07  23%  363 aa  MURG_LEGPH RecName:
    5::281     5e-07  23%  363 aa  MURG_LEGPA RecName:
   98::281     1e-06  27%  362 aa  MURG_BORT9 RecName:
   80::282     2e-06  24%  363 aa  MURG_BORAP RecName:
   17::175     2e-05  23%  363 aa  MURG_BORGA RecName:
    3::271     3e-05  28%  367 aa  MURG_CLAM3 RecName:
  274::302     1e-04  59%  382 aa  MURG_RHOOB RecName:
   64::141     3e-04  28%  212 aa  ALG13_DEBHA RecName: Full=UDP-N-acetylglucosamine transferase
   98::193     6e-04  32%  477 aa  LNT_GEOSL RecName: Full=Apolipoprotein N-acyltransferase;       
  105::200     8e-04  33%  521 aa  LNT_GEOMG RecName: Full=Apolipoprotein N-acyltransferase;       
    1::378

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNKGIVLLAAGGTGGHVFPAEALAHTLKARGYQVHLVTDSRAERYAGKFPADEIHVVPSATIGSKNPISV
MURG_AGRT5      MNKGIVLLAAGGTGGHVFPAEALAHTLKARGYQVHLVTDSRAERYAGKFPADEIHVVPSATIGSKNPISV
MURG_RHIEC      MSKGIVLLAAGGTGGHVFPAEALAFKLKERGYSVHLVTDSRAERYAGKFPAEEIHVVPSATIGSKNPVAV
MURG_RHIL3      MSKGIVLLAAGGTGGHVFPAEALAFKLKERGYSVHLVTDSRAERYAGKFPAEEIHVVPSATIGSKNPVAV
MURG_RHIE6      MSKGIVLLAAGGTGGHVFPAEALAFKLKERGYSVHLVTDSRAERFAGKFPAEEIHVVPSATIGSKNPVAV
MURG_RHISN      MDKGIIFLAAGGTGGHLFPAEALAHELKASGYAVHLVTDSRAERYAGKFPAEEVHVVPSATIGSKNPIKL
MURG_RHILW      MSKGIVLLAAGGTGGHVFPAEALAFKLKERGYSVHLVTDSRAERYAGKFPAEEIHVVPSATIGSKNPVAV
MURG_AGRRK      ---------------HVFPAEALAYKLKERGYSVHLVTDSRAERYAGKFPADEIHVVPSATIGSKNPIKV
MURG_SINMW      ---------------HLFPAEALAHELKASGYSVHLVTDSRAERFAGRFPADEIHVVASATIGSKNPVKL
MURG_AGRVS      -----------------FPAEALAHELRARGYSVHLVTDSRAERYAGKFPADAIHVVPSATIGSKNPVAI
MURG_RHIME      ---------------HLFPAEALAHELKATGYSVHLVTDSRAERFTGKFPADEIHVVPSATIGSKNPVKL
MURG_BRUSU      -NQGVIVLAAGGTGGHLFPAEALAHELRARGWDVHLATDARAQRFVGAFAQDHVHVIRSATIAGRNPVAL
MURG_RHILO      MARGVILLAAGGTGGHLFPAEALAHELNGRGWTVHLATDDRAERFAGHFPAAAVHPIQSATMGSKNPIAV
MURG_BRUSI      -NQGVIVLAAGGTGGHLFPAEALAHELRARGWDVHLATDARAQRFVGAFAQDHVHVIRSATIAGRNPVAL
MURG_BRUO2      -NQGVIVLAAGGTGGHLFPAEALAHELRARGWDVHLATDARAQRFVGAFAQDHVHVIRSATIAGRNPVAL
MURG_BRUC2      -NQGVIVLAAGGTGGHLFPAEALAHELRARGWDVHLATDARAQRFVGAFAQDHVHVIRSATIAGRNPVAL
MURG_BRUAB      -NQGVIVLAAGGTGGHLFPAEALAHELRARGWDVHLATDARAQRFVGAFAQDHVHVIRSATIAGRNPVAL
MURG_BRUA2      -NQGVIVLAAGGTGGHLFPAEALAHELRARGWDVHLATDARAQRFVGAFAQDHVHVIRSATIAGRNPVAL
MURG_BRUA1      -NQGVIVLAAGGTGGHLFPAEALAHELRARGWDVHLATDARAQRFVGAFAQDHVHVIRSATIAGRNPVAL
MURG_BRUME      -NQGVIVLAAGGTGGHLFPAEALAHELRARGWDVHLATDARAQRFVGAFAQDHVHVIRSATIAGRNPVAL
MURG_BRUMB      -NQGVIVLAAGGTGGHLFPAEALAHELRARGWDVHLATDARAQRFVGAFAQDHVHVIRSATIAGRNPVAL
MURG_MESSB      -----ILLSAGGTGGHLFPAEALAHELRARGWSVHLATDKRATRFAGTFPADEIHAIDSATFGSRNPLAL
MURG_OCHA4      MVKGVIVLAAGGTGGHLFPAEALAHELKARGWDVHLATDARAQRFAGAFAEDHVHVIRSATIAGRNPIAL
MURG_BART1      -DKKVIVLAAGGTGGHLFPAEALAVELRQRGYDVHLITDERARSFVRRFDEEHTHIVSSATFTRCHPFAL
MURG_BARHE      -DKKVIVLAAGGTGGHLFPAEAVAVELRQRGYDVHLVTDERAQRFVRCFDEEHIHIISSATFTRRHPFSL
MURG_BARBK      -NKKVVVLVAGGTGGHLFPAEALAVELRQRGYDVHLATDERAKRFVRHFDEKHIHIISSATLVRHHPFAL
MURG_BARQU      -HKKVIVLVAGGTGGHLFPAEAVAVELRQRGYDVHLVTDRRAKCFVSCVDEEHTHIVSSATFTRRHPFAL
MURG_NITHX      ----LILLAAGGTGGHLFPAEALGVELMKRDLRVRLVTDSRALRYSGLFSKDMTDVVPSETVRGRSPLAL
MURG_BRASO      ----LILLAAGGTGGHLFPAEALGVELIKRGYRVRLVTDARALKYSGLFTKDMIDVVPSETVRSRSPVXX
MURG_METPB      ----LVLVCAGGTGGHLFPAQSLAYALKARGIRVALATDARVDSIAGDFPAEEIVTIASATPSGRSMLRR
MURG_RHOPA      ----LILLAAGGTGGHLFPAEALGVVLIRRGYRVRLVTDHRATRYSGLFTAEMTDVVPSETVRGRTPWAL
MURG_METRJ      -----ILLCAGGTGGHLFPAESLAHALRARGIRVALATDARVDSIASEFPASEVVTIASATPSGRSPLKR
MURG_METC4      ----LVLVCAGGTGGHLFPAQSLAYALKDRGIRVALATDARVDSIAGDFPAEEIVTIASATPSGRSVLRR
MURG_METEP      ----LVLVCAGGTGGHLFPAQSLAYALKDRGIRVALATDARVDSIAGDFPAEEIVTIASATPSGRSVLRR
MURG_RHOP2      ----LILLAAGGTGGHLFPAEALGVVLMKRGLRVRLVTDSRAMRYSGLFSADMIDVVPSETVRGRTPWAL
MURG_ERYLH      ------VLAAGGTGGHLLPAFALAAELDRRGHHVALITDERGAKIPGKPDFLPAHVIPAGRFG-KNPLRW
MURG_RHOPS      ----LILLAAGGTGGHLFPAEALGVVLMKRGLRVRLVTDSRAMRYSGLFSADMIDVVPSETVRGRTPWAL
MURG_BRASB      ----LILLAAGGTGGHLFPAEALGVELIKRGYRVRLVTDARALRYSGLFTKDMIDVVPSETVRSRSPVXX
MURG_PARDP      ----LCLIAAGGTGGHMFPAQSLAETLLAQGWRVKLSTDERGARYAGAFPAEVARVVSSATTARGGALAR
MURG_BRAJA      ----LILLAAGGTGGHLFPAEALGVELIRRGFRVRLVTDERALRYSGLFSKDMIDVVSSETARGRNPFQV
MURG_NITWN      ----LILLAAGGTGGHLFPAEALGVELMKRGLRVRLVTDSRALRYSGLFSKDLTDVVPSETVRGRSPWAL
MURG_METS4      ----LVLLAAGGTGGHLFPAEALALRLRDRGIRVVLASDGRVEALSGGFPASEIVSIPSATPSGRSPLAR
MURG_RHOP5      ----LILLAAGGTGGHLFPAEALGVVLMQRGLRVRLVTDSRALRYSGLFSREMTDVVPSETVRGRSPVAL
MURG_RHOPB      ----LIMLAAGGTGGHLFPAEALGVALMKRGLRVRLVTDMRALRYSGLFSRDMVDVVPSETLRGRSPVAL
MURG_RHORT      -----IALAAGGTGGHVFPAEALAGELIRRGHKLTLITDKRGHVYGGTLGLLDTKXXXXXXXXXXXXXXX
MURG_RHOCS      MSMAPIVLAAGGTGGHLFPAEALARELLERGHRVVLVTDVRGTAFGDALREVPVHRIRSATLGG-GLLGK
MURG_MAGSA      --KPLIALAAGGTGGHVFPAEALASVLLDRGYRLALITDKRGAAYGGTLGKLETFRISAGGIAGRGKLSA
MURG_ZYMMO      ------ILAAGGTGGHMIPAHALAVELMRRGHHVALVTDERGTRFPELFKDVQIHQLPAGRLGVKGLFQA
MURG_ROSDO      -----MLIAAGGTGGHMFPAQALAEAMLNRGWRVKLTTDARGARYTGGFPSTQIEEISSATFARGGIAAK
MURG_JANSC      MSKPHLIIAAGGTGGHMFPAQALSEAMLRKGWRVTLSTDARGARYVGGFSAVEIREVSSATFTRGGALAK
MURG_RHOS4      MGRPLLLIAAGGTGGHMFPAQALAEAMVRRGWRVKLSTDARGARYAGGFPVVEIEEVSSATFARGGPLAK
MURG_RHOS1      MGRPLLLIAAGGTGGHMFPAQALAEAMVRRGWRVKLSTDARGARYAGGFPVVEIEEVSSATFARGGPLAK
MURG_MARMM      ------LIAAGGTGGHMFPXXXXXXXXXXRGWQVRLVTDARGLRHATDFPAVAVDEIHAASPSTKNPLKL
MURG_RHOS5      MGQPLLLIAAGGTGGHMFPAQALAEAMVRRGWRVKLSTDARGARYAGGFPVVEIDQVSSGTFARGGALAR
MURG_PHEZH      ---------------HLFPAQALAEALIARGWRIVLASDERVAGLAQDFPAERRIGLSAATYRPGDPVGM
MURG_NOVAD      ------VLAAGGTGGHLIPAFALAVELDRRGHHVALVTDERGAKIPGKPDFLPAHVLPAGRLG-KNPVAL
MURG_GRABC      -----IIIAAGGTGGHFFPAEALAAELKRRGRQIVLMTDARSGGLTSTVFADDRFVLPXXXXXXXXXXXX
MURG_SPHAL      ------LLAAGGTGGHMLPAYALADELIARGHRVALVSDDRGLKIPGAPAELETHVLPAGR-ASGGPLGW
MURG_SILST      MTQKLLLMAAGGTGGHMFPAQALAEAMLRKGWRVKLSTDPRGARYTGGFPMTEITEVSSATFARGGLLAK
MURG_METNO      ----LVLLAAGGTGGHLFPAEALALRLRERGIRVVLATDSRVETLSGEFPASEIVSIPSATPSGRSPLAR
MURG_SILPO      MTRKYLMIAAGGTGGHMFPAQALAEAMLRKGWRVRLSTDARGARYTGGFPTTEISQVSSATFARGGILAK
MURG_GLUOX      MNRPIVI-AAGGTGGHFFPAEAVATVLAERGHDLVLMTDARGRRETGLFKDRPQYVLDGAGVAGKGLSGK
MURG_CAUCR      ----LAVVAAGGTGGHMFPXXXXXXXXXXRGWRVVLATDDRGALYADKFPAEERLALSAATAKSNDPLGM
MURG_CAUCN      ----LAVVAAGGTGGHMFPXXXXXXXXXXRGWRVVLATDDRGALYADKFPAEERLALSAATAKSNDPLGM
MURG_RICBR      -----IVLVAGGTGGHFFPAVALGEELIKRKYEVHFITDLRCEKYINHDAGLIFHV-----IDLKRPKNI
MURG_RICB8      -----IVLVAGGTGGHFFPAVALGEELIKRKYEVHFITDLRCEKYINHDAGLIFHV-----IDLKRPKNI
MURG_HYPNA      ----LVIIAAGGTGGHMFPARAFADEMRARGWNTALISDSRGLRYAADFPADWKEEIEAASPNFRKPWTV
MURG_ACICJ      -----IVIAAGGTGGHMVPAESVADELMRRGQRIVLMTDARAGQKSAVFAGCERHVXXXXXXXXXXXXXX
MURG_RICRS      -----IILVAGGTGGHFFPAVALGEELIKRGYEVHFITDLRCKQYIKQDMKVIFHILDLKRSGN-----I
MURG_RICRO      -----IILVAGGTGGHFFPAVALGEELIKRGYEVHFITDLRCKQYIKQDMKVIFHILDLKRSGN-----I
MURG_ORITB      -----IFLVGGGTGGHLFPAIALGEELQERGYNVYLITDTRCEKYLLNFNYSKIHIMNMVSI-SNTGIKK
MURG_RICPU      -----IILVAGGTGGHFFPAVALGEELIKRGYEVHFITDLRCKQYIKQDMKVIFHILDLKRSGN-----I
MURG_RICAE      -----IILVAGGTGGHFFPAVALGEELIKRGYEVHFITDLRCKQYIKQDMKVIFHILDLKRSGN-----I
MURG_RICCK      -----IILVAGGTGGHFFPAVALGEELIKRGYEVHFIIDLRCKKYISQDMKVIFHILDLKRSGN-----I
MURG_ORITI      -----IFLVGGGTGGHLFPAIALGEELQERGYNVYLITDTRCEKYLNSNYSFKIHIMNMVSI-SNTGIKK
MURG_RICAH      -----IILAAGGTGGHFFPAVALGEELVKRGYEVHFITDLRCQKYINQNLGLIFHI-----LDLKRSSNI
MURG_RICM5      -----IILVAGGTGGHFFPAVALGEELIKRGYEVHFITDLRCKQYIKQDMKVIFHILDLKRSGN-----I
MURG_WOLWR      -----IILATGGTGGHIFPAIALAKALKTQGYNCILFTDKKTNKNTD---------IESYTLPLRRPSS-
MURG_WOLPM      -----IILATGGTGGHIFPAIALAKALKTQGYNCILFTDKKTNKNTD---------IESYTLPLRRPSS-
MURG_RICFE      -----IILVAGGTGGHFFPAVALGEELIKRGYEVHFITDLRCQKYINQNMGLIFHI-----LDLKRSDNI
MURG_RICCN      -----IILVAGGTGGHFFPAVALGEELIKRGYEVHFITDLRCKQYIKQDMKVIFHILDLKRSGN-----I
MURG_RICPR      -----IILVAGGTGGHFFPAVALGEELIKRGYIVHFITDLRCKKYINKDMKIIFHI-----LNLKRFSNI
MURG_ANAMM      -----VVLAAGGTGGHIVPAALLCQVLADRGYRCVLYTDQYFLQYTARFPGIKGYVLLPLCKRSGGAVRL
MURG_WOLTR      -----IVLATGGTGGHIFPAITLARAIKRQGYDSILFADKKT----GKNTDVKDYTLPLNKPGGNKFRFF
MURG_WOLPP      -----IILATGGTGGHVFPAITLAKALKVQGHNCILFTDQKTINI-------ESYILPLC----KPSGNK
MURG_MAGSM      -----LLIAGGGTGGHLFPALAVAERWRER-YGLHSV------HFIGGQRGLENRLVPNAQLKGKGLPHK
MURG_RHOFD      MTHGTALIMAGGTGGHIFPGLALAHALRERGWRVHWLGGAGTASQ----PSMESQLVPPSGVRGKGLGTL
MURG_GEOMG      -----LLIAGGGTGGHLFPGIAVAEEFLSRGNEVLFVGTWRGARVLPKL-GYRLECITAAGIRGKGSVAR
MURG_GEOSL      -----LLIAGGGTGGHLFPGIAVAEEFLARDKQNEVL-------FVGTWKGIEARVLPAAGIRGKGSLAR
MURG_PSEAE      --KGNVLIMAGGTGGHVFPALACAREFQARGYAVHLGTPRGIENDLVPKAGLPLHLIQVSGLRGKGLKSL
MURG_PSEAB      --KGNVLIMAGGTGGHVFPALACAREFQARGYAVHLGTPRGIENDLVPKAGLPLHLIQVSGLRGKGLKSL
MURG_PSEA8      --KGNVLIMAGGTGGHVFPALACAREFQARGYAVHLGTPRGIENDLVPKAGLPLHLIQVSGLRGKGLKSL
MURG_PSEA7      --KGNVLIMAGGTGGHVFPALACAREFQARGYAVHLGTPRGIENDLVPKAGLPLHLIQVSGLRGKGLKSL
MURG_GEOUR      -----LLIAGGGTGGHLFPGIAVAEEFLARNHSNEVLTERGIEARLLPRLGYRLECITASGIKGQSPLAK
MURG_GEOLS      -----LIVAGGGTGGHLFPGIAVAEEFLSRANQVLFVGSERGEARAIPRLGYQLELISAAGIRGKGSLAK
MURG_RICTY      -----IILVAGGTGGHFFPAVALGEELIKRGYIVHFITDLRCKKYINK----DMKII-FYLLDLKRFSNX
MURG_NITMU      -----ILIMAGGTGGHVFPGLAVAEYLKAAGWRVWLGTEGGMETTLARQQGHALETIRFSGLRGKNVRTW
MURG_PSEMY      --RGNVLIMAGGTGGHVFPALACAREFQTRGYAVHWLGTSRGENELVPQAGLPLHLINVXXXXXXXXXXX
MURG_POLNA      ------LVMAGGTGGHIFPGLAVAEALRERGWRVHWL----GGKGSAARPSMESQLVPPSGVRGKGPVTX
MURG_DESAD      -----IVLTTGGTGGHVFPALAVAHEIKNRFPQCEIIGGKGPEREMVERAGISFKGLPAKGVLGGGIKKV
MURG_PSEU5      -----VLIMAGGTGGHVFPALACAREFQTRGYAVHLGTPRGIENELVPAAGLPLHLIQVSGLRGKGLASL
MURG_THICR      -----ILIMAGGTGGHVFPGLALAEALADKQVKVWLGTCNGMEKQAAKIPFYTIAISGLRGNGLLGWLKA
MURG_ALTMD      ------LIMAGGTGGHVFPGLAVANALRAEGWDIHLGTAERMEAQVVPKHDIPIHFIPVKGLRGKGISAR
MURG_NITEU      ------MIMAGGTGGHVFPGLAVARSMQANGWRVWLGTRNGMEAALVPQHGFSIELINFSGLRGKKLSSY
MURG_GEOSM      -----LIIAGGGTGGHLFPGIAIADEFLARSPENEVLTERGIEARLLPKLGYKLALISASGMKGMGTIKK
MURG_PELPD      -----LIIAGGGTGGHLFPGIAVAEEFLSRANQVLFVIEARAVPAAG-FP---LELISXXXXXXXXXXXX
MURG_JANMA      --KRLVIMAAG-TGGHIFPGLAIAETMKARGWQVSLGTSHGMERELVPKAGVEMDIIEFSGLRGKGLQHT
MURG_AERS4      -----LLVMAGGTGGHVFPGLAVADRLKAQGWTIHLGTADRMEAEAHGYPISFIDIQGVRGNGIKRPYRI
MURG_SHEB2      -----ILVMAGGTGGHVFPALAVAKYLAQQGWQVRLGTADRMEARLVPQYGFDIDFIDIKGVRGNGLIRK
MURG_RALEH      -----LLVMAGGTGGHVFPGLAVAHALREQGWKV-VWLGNRTGMEATLVPKHDIPMIQFGGLRGKGPLNL
MURG_IDILO      MNK--VLIAAAGTGGHIFPALAVAEQMRDNGWQVDWLQEGRLESRAANFPLHSISMTGVRGHGLKRKLFM
MURG_GEOBB      -----LIIAGGGTGGHLFPGIAVADEFLARSPENEVLTERGIEARLLPKLGYKLALISASGMKGMGTIKK
MURG_AZOSE      -----LLVMAGGTGGHIFPGVAVAEQLRGRGWRIVWMPDGMEARIVPQHGYETAWVHFGAXXXXXXXXXX
MURG_SHEB5      -----ILVMAGGTGGHVFPALAVAKYLAQQGWQVRLGTADRMEARLVPQYGFDIDFIDIKGVRGNGLIRK
MURG_PSEPF      -----VLIMAGGTGGHVFPALACAREFQARGYTVHLGTPRGIENDLVPAAGLELHRINATXXXXXXPFML
MURG_RALEJ      -----LLVMAGGTGGHVFPGLAVAHALREQGWKV-VWLGNRTGMEATLVPKHDIPMIQFGGLRGKGPLNL
MURG_PSYIN      -NKKTLVVMAGGTGGHVFPGLAVADALKEQGWAVSLGTADRMEAQLVPKHGYEIDFIDIAGIRGNGPIRI
MURG_SHEB9      -----ILVMAGGTGGHVFPALAVAKYLAQQGWQVRLGTADRMEARLVPQYGFDIDFIDIKGVRGNGLIRK
MURG_SHEB8      -----ILVMAGGTGGHVFPALAVAKYLAQQGWQVRLGTADRMEARLVPQYGFDIDFIDIKGVRGNGLIRK
MURG_AERHH      -----LLVMAGGTGGHVFPGLAVADRLKAQGWTIHLGTADRMEAEAHGYPISFIDIQGVRGNGIKRPYRI
MURG_PSEPW      -----VLIMAGGTGGHVFPALACAREFQARGYTVHLGTPRGIENELVPQAGLSLHLIQVXXXXXXXXXXX
MURG_SHEWM      -----ILIMAGGTGGHVFPALAVAKYLSKQGWKVRWL--GTAERMEARLVPQHGFDIDFIDIKGVRGNGV
MURG_PSEF5      -----VLIMAGGTGGHVFPALACAREFQARGYTVHLGTPRGIENDLVPAAGLPLHLINVXXXXXXXXXXX
MURG_PSEP1      -----VLIMAGGTGGHVFPALACAREFQKRGYSVHLGTPRGIENELVPQAGLPLHLIQVXXXXXXXXXXX
MURG_SHESW      -----ILVMAGGTGGHVFPALAVAKYLAQQGWQVRLGTADRMEARLVPQYGFDIDFIDIKGVRGNGLVRK
MURG_SHEPC      -----ILVMAGGTGGHVFPALAVAKYLAQQGWQVRLGTADRMEARLVPQYGFDIDFIDIKGVRGNGLVRK
MURG_SHEON      -----ILVMAGGTGGHVFPALAVAKYLAQQGWQVRLGTADRMEARLVPQYGFDIDFIDIKGVRGNGLVRK
MURG_SHESR      -----ILVMAGGTGGHVFPALAVAKYLAQQGWQVRLGTADRMEARLVPQYGFDIDFIDIKGVRGNGLVRK
MURG_SHESA      -----ILVMAGGTGGHVFPALAVAKYLAQQGWQVRLGTADRMEARLVPQYGFDIDFIDIKGVRGNGLVRK
MURG_SHESM      -----ILVMAGGTGGHVFPALAVAKYLAQQGWQVRLGTADRMEARLVPQYGFDIDFIDIKGVRGNGLVRK
MURG_SHELP      -----ILIMAGGTGGHVFPALAVAKALAKQGWQVRLGTADRMEARLVPQHGFDIDFIDIKGVRGNGLIRK
MURG_SHEAM      -----LLVMAGGTGGHVFPALAVARRLASEGWQIRLGTADRMEARLVPQHGFDIDFIDIQGVRGNGLLRK
MURG_RALSO      -----LLVMAGGTGGHIFPALSVARLLAARGWQV--VWLGNASGMEGQLVPKHGFPLESVRFGGVRPLNL
MURG_PSEPK      -----VLIMAGGTGGHVFPALACAREFQARGYSVHLGTPRGIENELVPQAGLPLHLIQVXXXXXXXXXXX
MURG_COXBU      -----ILIIAGGTGGHIFPALAVARELREQGLEEKLVPDS--------FP---LHLIQIKAFRGKRGLQQ
MURG_COXBR      -----ILIIAGGTGGHIFPALAVARELREQGLEEKLVPDS--------FP---LHLIQIKAFRGKRGLQQ
MURG_COXBN      -----ILIIAGGTGGHIFPALAVARELREQGLEEKLVPDS--------FP---LHLIQIKAFRGKRGLQQ
MURG_COXB2      -----ILIIAGGTGGHIFPALAVARELREQGLEEKLVPDS--------FP---LHLIQIKAFRGKRGLQQ
MURG_COXB1      -----ILIIAGGTGGHIFPALAVARELREQGLEEKLVPDS--------FP---LHLIQIKAFRGKRGLQQ
MURG_METCA      -----IVILAGGTGGHVFPALAVAGKLRRAGAEVFWMLEARVVPAAG-YPIDWLSV---SGIRGKGLASK
MURG_MARAV      ------LMMAGGTGGHVFPALATARALQQRGHEVHWLGASGGERLIGDIPLSLIHIXXXXXXXXXXPFRL
MURG_BURVG      -----LMVMAGGTGGHVFPGLAVAHRMEAAGWRV-VWLGNPAGMEATLVPK---HGIPMEYVXXXXPFNL
MURG_BLOPB      -----IMIVAGGSGGHVFPGLSVAHYLINHGYQVWLGTADRIEKLVPQYGIDIKFIRINGWNGEKLHIKC
MURG_SERP5      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEADLVPKHGIEIDFIRISGLRGKGLKAQ
MURG_ECOHS      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEADLVPKHGIEIDFIRISGLRGKGIKAL
MURG_BURCM      -----LMVMAGGTGGHVFPGLAVAHRMEAAGWRV-VWLGNPAGMEATLVPK---HGIPMEYVXXXXPFNL
MURG_BURA4      -----LMVMAGGTGGHVFPGLAVAHRMEAAGWRV-VWLGNPAGMEATLVPK---HGIPMEYVXXXXPFNL
MURG_SYNAS      -----VIIAGGGTGGHLFPGVAIAEELLRRDRENRVLTKRGIEKKVLKDLGFRLKLLNVEGIKGRGVMRS
MURG_PSEFS      -----VLIMAGGTGGHVFPALACAREFQNRGYTVHLGTPRGIENELVPNAGLPLHLINVTXXXXXXXXXX
MURG_SHESH      -----ILIMAGGTGGHVFPALAVAKYLCQQGWQVRLGTAERMEARLVPQHGFDIDFIDIKGVRGNGLLRK
MURG_SHIDS      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEADLVPKHGIEIDFIRISGLRGKGIKAL
MURG_BURP0      -----LMVMAGGTGGHVFPGLAVAHRMQAQGWRV-VWLGSPAGMEATLVPRHGIPMVRFGGLRGKGLATK
MURG_POLSJ      ----VALVMAGGTGGHIFPGLAVAEALRERGWRVHWL----GGRGNAGHPSMESQLVPPSGVRGKGPXXX
MURG_GEOSF      -----LIVAGGGTGGHLFPGIAVAEEFLARNSANEVLTERGIEARLLPKLGYRLECISASGIKGQSPLTK
MURG_SHISS      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEADLVPKHGIEIDFIRISGLRGKGIKAL
MURG_SHIFL      -----LMVMAGGTGGHVFPGLAVAHYLMAQGWQVRLGTADRMEADLVPKHGIEIDFIRISGLRGKGIKAL
MURG_SHIF8      -----LMVMAGGTGGHVFPGLAVAHYLMAQGWQVRLGTADRMEADLVPKHGIEIDFIRISGLRGKGIKAL
MURG_SHIBS      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEADLVPKHGIEIDFIRISGLRGKGIKAL
MURG_PSEE4      -----VLIMAGGTGGHVFPALACAREFQARGYSVHLGTPRGIENELVPQAGLPLHLIQVTXXXXXXXXXX
MURG_ECOUT      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEADLVPKHGIEIDFIRISGLRGKGIKAL
MURG_ECOSM      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEADLVPKHGIEIDFIRISGLRGKGIKAL
MURG_ECOSE      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEADLVPKHGIEIDFIRISGLRGKGIKAL
MURG_ECOLU      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEADLVPKHGIEIDFIRISGLRGKGIKAL
MURG_ECOLI      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEADLVPKHGIEIDFIRISGLRGKGIKAL
MURG_ECOLC      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEADLVPKHGIEIDFIRISGLRGKGIKAL
MURG_ECOL6      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEADLVPKHGIEIDFIRISGLRGKGIKAL
MURG_ECOL5      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEADLVPKHGIEIDFIRISGLRGKGIKAL
MURG_ECOK1      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEADLVPKHGIEIDFIRISGLRGKGIKAL
MURG_ECODH      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEADLVPKHGIEIDFIRISGLRGKGIKAL
MURG_ECOBW      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEADLVPKHGIEIDFIRISGLRGKGIKAL
MURG_ECO8A      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEADLVPKHGIEIDFIRISGLRGKGIKAL
MURG_ECO81      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEADLVPKHGIEIDFIRISGLRGKGIKAL
MURG_ECO7I      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEADLVPKHGIEIDFIRISGLRGKGIKAL
MURG_ECO5E      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEADLVPKHGIEIDFIRISGLRGKGIKAL
MURG_ECO57      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEADLVPKHGIEIDFIRISGLRGKGIKAL
MURG_ECO45      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEADLVPKHGIEIDFIRISGLRGKGIKAL
MURG_ECO27      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEADLVPKHGIEIDFIRISGLRGKGIKAL
MURG_ECO24      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEADLVPKHGIEIDFIRISGLRGKGIKAL
MURG_COLP3      -----LLVMAGGTGGHIFPGIAVADELKAQGWKIHLGTADRMEAQIVPMHGYDISFINISGLRGKNLLTT
MURG_BURPS      -----LMVMAGGTGGHVFPGLAVAHRMQAQGWRVV---------WLGNPAGMEATLVPRHGI----PMEY
MURG_BURP6      -----LMVMAGGTGGHVFPGLAVAHRMQAQGWRVV---------WLGNPAGMEATLVPRHGI----PMEY
MURG_BURMS      -----LMVMAGGTGGHVFPGLAVAHRMQAQGWRVV---------WLGNPAGMEATLVPRHGI----PMEY
MURG_BURMA      -----LMVMAGGTGGHVFPGLAVAHRMQAQGWRVV---------WLGNPAGMEATLVPRHGI----PMEY
MURG_BURM9      -----LMVMAGGTGGHVFPGLAVAHRMQAQGWRVV---------WLGNPAGMEATLVPRHGI----PMEY
MURG_BURM7      -----LMVMAGGTGGHVFPGLAVAHRMQAQGWRVV---------WLGNPAGMEATLVPRHGI----PMEY
MURG_LACF3      -----LMVSGGGTGGHIYPALALIERLKQ-------VEPDTEVLYVGAKRGLETKIVPQAGYGFRRSLSL
MURG_ECO55      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEADLVPKHGIEIDFIRISGLRGKGIKAL
MURG_BURP1      -----LMVMAGGTGGHVFPGLAVAHRMQAQGWRV-VWLGNPAGMEATLVPRHGIPMVHFGGLRGKGLATK
MURG_SHIB3      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEADLVPKHGIEIDFIRISGLRGKGIKAL
MURG_BORPA      MSAPTILIMAGGTGGHIMPGLAVAEVLRERGWRVLWL--GNPDKMEGRLPPRGIELVPLRFQGGRGXXXX
MURG_BORBR      MSAPTILIMAGGTGGHIMPGLAVAEVLRERGWRVLWL--GNPDKMEGRLPPRGIELVPLRFQGGRGXXXX
MURG_SALAR      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEADLVPKHGINIEFIRISGLRGKGVKAL
MURG_METFK      MSKTLLIMAAG-TGGHVMPGLAIAKTMQSRGWNVH---------WLGTTHGMENRLVPPSGLGWKHTLRL
MURG_HAHCH      ------LVMAGGTGGHVYPALASALALREQGANVVWLRGGMEERIIGRTDIP-MRLITIGGLRGKGPVNL
MURG_YERE8      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEASLVPKNGIEIDFIEISGLRGKGLMAQ
MURG_YERPN      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEASLVPQHGIEIDFIKISGLRGKGLMAQ
MURG_YERPG      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEASLVPQHGIEIDFIKISGLRGKGLMAQ
MURG_YERPE      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEASLVPQHGIEIDFIKISGLRGKGLMAQ
MURG_YERPA      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEASLVPQHGIEIDFIKISGLRGKGLMAQ
MURG_ERWCT      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEADLVPKHGIEIDFIRISGLRGKGIRAQ
MURG_ANADE      -----MMVAGGGTGGHVFPGIALAEEVVTRHPANDVV-------FVGTARGLEASVVPAAGF----PIEL
MURG_SHEVI      -----ILIMAGGTGGHVFPALAVAKYLSQKSWKVRLGTAERMEARLVPQHGFDIDFIDIKGVRGNGLLRK
MURG_ANASK      -----MMVAGGGTGGHVFPGIALAEEVVTRHPANDVV-------FVGTARGLEASVVPAAGF----PIEL
MURG_ANAD2      -----MMVAGGGTGGHVFPGIALAEEVVTRHPANDVV-------FVGTARGLEASVVPAAGF----PIEL
MURG_SALNS      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEADLVPKHGIDIDFIRISGLRGKGVKAL
MURG_SALG2      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEADLVPKHGIDIDFIRISGLRGKGVKAL
MURG_SALDC      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEADLVPKHGIDIDFIRISGLRGKGVKAL
MURG_SALCH      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEADLVPKHGIDIDFIRISGLRGKGVKAL
MURG_PECCP      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEADLVPKHGIEIDFIRISGLRGKGIWAQ
MURG_PARUW      ------MITAGGTGGHIFPAQGLAQELIKKTYSSSILFVASTNKYFDRFPFQEVSASP---LFSKNPFKL
MURG_NEIMF      ------MLMAGGTGGHIFPALAVADSLRARGHHVIWLKDSMEERIVPQYGIETLAIKGVRGNGIKRKLML
MURG_PHOLL      -----LMVMAGGTGGHVFPGLAVAHHLKDQGWDVWLGTADRMEADLVPKHGIDIEFIQISGLRGKGIKAL
MURG_NEIMB      ------MLMAGGTGGHIFPALAVADSLRARGHHVIWLKDSMEERIVPQYGIETLAIKGVRGNGIKRKLML
MURG_SALEP      -----LMVMAGGTGGHVFPGLAVAHHLMSQGWQVRLGTADRMEADLVPKHGIDIDFIRISGLRGKGVKAL
MURG_NEIG2      ------MLMAGGTGGHIFPALAVADSLRVRGHHVIWLKDSMEERIVPQYGIETLAIKGIRGNGIKRKLML
MURG_NEIG1      ------MLMAGGTGGHIFPALAVADSLRVRGHHVIWLKDSMEERIVPQYGIETLAIKGIRGNGIKRKLML
MURG_ERWT9      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEADLVPKHGIDIEFIRISGLRGKGIKAL
MURG_CITK8      -----LMVMAGGTGGHVFPGLAVAHHLMDQGWQVRLGTADRMEADLVPKHGIEIDFIRISGLRGKGVKAL
MURG_YERPP      -----LMVMAAGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEASLVPQHGIEIDFIKISGLRGKGLMAQ
MURG_SALTY      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEADLVPKHGIDIDFIRISGLRGKGVKAL
MURG_SALSV      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEADLVPKHGIDIDFIRISGLRGKGVKAL
MURG_SALPK      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEADLVPKHGIDIDFIRISGLRGKGVKAL
MURG_SALPB      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEADLVPKHGIDIDFIRISGLRGKGVKAL
MURG_SALPA      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEADLVPKHGIDIDFIRISGLRGKGVKAL
MURG_SALHS      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEADLVPKHGIDIDFIRISGLRGKGVKAL
MURG_SALA4      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEADLVPKHGIDIDFIRISGLRGKGVKAL
MURG_PSE14      -----VLIMAGGTGGHVFPALACAREFQARGYKVHLGTPRGIENELVPQAGLTLHLINVTXXXXXXXXXX
MURG_NEIM0      ------MLMAGGTGGHIFPALAVADSLRARGHHVIWLKDSMEERIV---PQYGIRLETLAIKGVRGN-GI
MURG_HALOH      -----LVFTGGGTGGHIYPALALAESFRKKGDEIYIGSNDGLERRIVPEEGFDFQGIEVAPFPRNLSVHL
MURG_ESCF3      -----LMVMAGGTGGHVFPGLAVAHHLIAQGWEVRLGTADRMEADLVPKHGIEIDFIRISGLRGKGIKAL
MURG_BURCJ      -----LMVMAGGTGGHVFPGLAVAHRMEAAGWRV-VWLGNPAGMEATLVPK---HGIPMEYVXXXXPVNL
MURG_BURCH      -----LMVMAGGTGGHVFPGLAVAHRMEAAGWRV-VWLGNPAGMEATLVPK---HGIPMEYVXXXXPVNL
MURG_BURCA      -----LMVMAGGTGGHVFPGLAVAHRMEAAGWRV-VWLGNPAGMEATLVPK---HGIPMEYVXXXXPVNL
MURG_ANADF      -----MLIAGGGTGGHVFPGIALAEEVVGRGNDVVFVGTERGLEAAAGFPIELIDVXXXXXXXXXXXXXX
MURG_PSEPG      -----VLIMAGGTGGHVFPALACAREFQARGYSVHLGTPRGIENELVPQAGLPLHLIQVXXXXXXXXXXX
MURG_NEIMA      ------MLMAGGTGGHIFPALAVADSLRARGHHVIWLKDSMEERIVPQYDI----LLETLAIKGVRGNGI
MURG_BURCC      -----LMVMAGGTGGHVFPGLAVAHRMEAAGWRV-VWLGNPAGMEATLVPK---HGIPMEYVXXXXPVNL
MURG_SALTI      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTSDRMEADLVPKHGIDIDFIRISGLRGKGVKAL
MURG_KLEP3      -----LMVMAGGTGGHVFPGLAVAHHLMDQGWQVRLGTADRMEADLVPKNGIEIDFIRISGLRGKGIKAQ
MURG_PSEHT      ------VVVAGGTGGHIFPGIAVADYLKQQGWQVSWITPDRMEATVVPKHNIDINFINVKGVRGNGIKRL
MURG_ACIF5      -----VLIAAGGTGGHVFPALAVADALRAQGVEVTFATATGMEARLVPERGYTLHTLDMQGLRGKGIRRW
MURG_ACIF2      -----VLIAAGGTGGHVFPALAVADALRAQGVEVTFATATGMEARLVPERGYTLHTLDMQGLRGKGIRRW
MURG_PSESM      -----VLIMAGGTGGHVFPALACAREFQARGYKVHLGTPRGIENELIPQAGLPLHLINVTXXXXXXXXXX
MURG_ENTS8      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEADLVPKHGIEIDFIRISGLRGKGVKAL
MURG_VIBSL      -----LLVMAGGTGGHVFPGLAVAKKLQQQGWEIRLGTADRMEADLVPKHGIEIDFIKVKGLRGQGVSKL
MURG_SHEHH      -----ILIMAGGTGGHVFPALAVAKYLSQQGWKVRLGTAERMEARLVPQHGFDIDFIDIKGVRGNGLMRK
MURG_BLOFL      MNQSVIMIIAGGTGGHIFPGLSVARYLMNHGYKVVWIKDRIESELVPVYNIDIKYICIQGLRGKKIYQKL
MURG_YERPY      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEASLVPQHGIEIDFIKISGLRGKGLMAQ
MURG_YERPS      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEASLVPQHGIEIDFIKISGLRGKGLMAQ
MURG_YERPB      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEASLVPQHGIEIDFIKISGLRGKGLMAQ
MURG_YERP3      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTADRMEASLVPQHGIEIDFIKISGLRGKGLMAQ
MURG_SHEDO      -----ILIMAGGTGGHVFPALAVAKNLAEKGWQVRLGTADRMEARLVPQHGFDIDFIDIQGVRGNGLLRT
MURG_PSEU2      -----VLIMAGGTGGHVFPALACAREFQARGYKVHLGTPRGIENELVPQAGLTLHLINVTXXXXXXXXXX
MURG_MYXXD      -----VLIAGGGTGGHLFPGIALAEEVVTRHHRNEVV-------FVGTERGIESRVVPK----EGYPLEL
MURG_KLEP7      -----LMVMAGGTGGHVFPGLAVAHHLMDQGWQVRLGTADRMEADLVPKNGIEIDFIRISGLRGKGIKAQ
MURG_BURM1      -----LMVMAGGTGGHVFPGLAVAHRMEAAGWRV-VWLGNPAGMEATLVPK---HGIPMEYVXXXXPFNL
MURG_VIBVY      -----LMVMAGGTGGHVFPGLAVAKKLQQQGWEIRLGTADRMEAELVPKHGIDIDFIKVKGLRGQGIKRL
MURG_VIBHB      -----LMVMAGGTGGHVFPGLAVAKQLQEQGWEIRLGTADRMEADLVPKHGIEIDFIKVKGLRGQGVKRL
MURG_VIBVU      -----LMVMAGGTGGHVFPGLAVAKKLQQQGWEIRLGTADRMEAELVPKHGIDIDFIKVKGLRGQGIKRL
MURG_POLSQ      MTKPSILVMAGGTGGHIFPGLAVAEYLRICGWNVSWLGNQSGMEYSCNFPFEAVEFGGLRGKGIKAPINL
MURG_ACIBL      ------ILAGGGTGGHVIPALAIAQELKVHGAEVIFIGTQRGI---------ETRLVPAAKVGALNRVSF
MURG_PSEA6      -----LLVMAGGTGGHVFPGLAVAQALKEQNWHIHLGTAQRMEADLVPKAGFEISFIDIAGVRGNGLVRL
MURG_CLOD6      -----VLLSGGGTGGHVYPAIAIANKIRDEHPDAEII-------FVGTEKGIESEIVPTVTVGFKRKIDF
MURG_SULSY      -----VFISGGGTGGHFYPALSVAENLKEKGFSITYIGTTNGIENKKDFPADEKILYPMRAVRGKSIVGK
MURG_SHEFN      -----ILIMAGGTGGHVFPALAVAKYLAEKGWQIRLGTADRMEARLVPQHGFDIEFIDIKGVRGNGLMRK
MURG_NITOC      -----VLIMAGGTGGHIFPALAVADRLRAWGVEVV---------WMGTRHGLEAELVPKASIGGKGLTHW
MURG_CALS8      MNSGSIVFSGGGTGGHIYPAVAVADYLKKRYNNLNIVFIGTNEGLESKIPQHGYKIEYIQAKGLKRSLTV
MURG_BURS3      -----LMVMAGGTGGHVFPGLAVAHRMEAAGWRV-VWLGNPAGMEATLVPK---HGIPMEYVXXXXPFNL
MURG_HAEDU      -----LLIMAGGTGGHVFPAIAVAQELQKQGWQIWLGTKDRMEAELVPQYNIPIEFIQISGLKGKGVLAL
MURG_DESAP      -----VIIAGGGTGGHIYPALAIAEGIKRRHPDADLLTSRGLETEIVPRTGLPFHAIPAA--GLKRGLSP
MURG_ACTP2      -----LLVMAGGTGGHVFPAIAVARELQKQGWEIRLGTKDRMEADLVPKHGIPIEFIQISXXXXXXXXXX
MURG_HAEIN      -----LLVMAGGTGGHVFPAIAVAQTLQKQEWDIWLGTKDRMEAQLVPKYGIPIRFIQISGLRGKGIKAL
MURG_HAEIE      MKKKKLLVMAGGTGGHVFPAIAVAQTLQKQEWDIWLGTKDRMEAQLVPKYDIPIRFIQISGLRGKGIKAL
MURG_HAEIG      -----LLVMAGGTGGHVFPAIAVAQTLQKQEWDIWLGTKDRMEAQLVPKYGIPIRFIQISGLRGKGIKAL
MURG_HAEI8      -----LLVMAGGTGGHVFPAIAVAQTLQKQEWDIWLGTKDRMEAQLVPKYGIPIRFIQISGLRGKGIKAL
MURG_PEDPA      -----LMVSGGGTGGHIYPALALIKQVKQSEPDSQIL-------YVGTSKGLESKIVPDSGIGFKRSLSL
MURG_BURPP      -----LMVMAGGTGGHVFPGLAVAHLMQAWGWKVV---------WLGNPAGMEATLVPKHGI----PMEY
MURG_BORPD      MNAPTVLIMAGGTGGHIMPGLAVADVLRERGWRVLWL--GNPDKMEGRLPPRGIDLVPMHFQGVRGPFLL
MURG_ACTPJ      -----LLVMAGGTGGHVFPAIAVARELQKQGWEIRLGTKDRMEADLVPKHGIPIEFIQISXXXXXXXXXX
MURG_ACTP7      -----LLVMAGGTGGHVFPAIAVARELQKQGWEIRLGTKDRMEADLVPKHGIPIEFIQISXXXXXXXXXX
MURG_VIBFM      -----LLVMAGGTGGHVFPGLAVAKQLQSEGWEIRLGTADRMEADLVPKHGIEIDFIKVKGLRGQGLKKL
MURG_VIBF1      -----LLVMAGGTGGHVFPGLAVAKQLQSEGWEIRLGTADRMEADLVPKHGIEIDFIKVKGLRGQGLKKL
MURG_THEYD      -----VIIAGGGTGGHLFPGIALAESLIGKYPEAQIITPKGLEAKVIPKTGYELSFISIQGFVGXXXXXX
MURG_RALME      MTARTLLVMAGGTGGHVFPGLAVARALRDEGWRV-VWLGNRTGMEATLVPKHDIPMXXXXXXXXXXXXXX
MURG_CLOTH      -----VIISGGGTAGHINPGLAIAKYIKKREPDTEILTERGLE--ARLVPRENFEIKMIKVRGFKRKLSM
MURG_SHEPA      -----ILIMAGGTGGHVFPALAVAKYLSQQGWKVRLGTAERMEARLVPQHGFDIDFIDIKGVRGNGLMRK
MURG_PASMU      -----LLVMAGGTGGHVFPAIAVAQYLQQQGWDIWLGTADRMEAQLVPKHHIPIQFIQISGLRGKGIKAL
MURG_LACRJ      -----LLVSGGGTGGHIYPALALIERLKQ-------VEPDTEVLYVGTTRGLENKIVPDAGIGFKRSLSL
MURG_LACRD      -----LLVSGGGTGGHIYPALALIERLKQ-------VEPDTEVLYVGTTRGLENKIVPDAGIGFKRSLSL
MURG_NITEC      ------MIMAGGTGGHVFPGLAVARAMQAEGWRVWLGTRNGMEATLVPQHGFTIELINFSGLRGKKPVSY
MURG_BORPE      MSAPTILIMAGGTGGHIMPGLAVAEVLRERGWRVLWL--GNPDKMEGRLPPRGIELVPLRFQGGRGXXXX
MURG_BACLD      -----IVVSGGGTGGHIYPALAFIKEVKRHHEDVEFLEKNIVEREGIPFKAIEI-------TGFKRKLSF
MURG_CARHZ      -----LVFAGGGTGGHLYPALAIAQSWKESHPNDEILTPRGIENTVVPKYGFPLYLLPVEGIPRKVSWET
MURG_LAWIP      -----IAITTGGTGGHVYPALAVAE-------QFH---DKADLFFIGSQYGPEAEMVKTFNIPFYGPVGV
MURG_CELJU      -----ILVMAGGTGGHVFPALAVAEELRARGALVE---------WLGTAKGIENTLVPKANI-PLNLISV
MURG_AZOSB      -----LLVMAGGTGGHIFPGIAVAEALRAKGWRIV---------WMGNPDGMEARIVPSGAXXXXXXXXX
MURG_LACCB      -----LVISGGGTGGHIYPALALIEALKAEGKLDDVL-------YVGTKRGLESRIVPATGLGFKRSLSL
MURG_LACC3      -----LVISGGGTGGHIYPALALIEALKAEGKLDDVL-------YVGTKRGLESRIVPATGLGFKRSLSL
MURG_HERAR      -----LLIMAAGTGGHIFPGLAIADTMQARGWEVTLGTEHGMERDLVPKSGIAMDTISFAGLRGKGLRHT
MURG_SODGM      -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRLGTANRMEADLVPQHGIDIDFIRISGLRGKGLKAQ
MURG_BACSU      -----IAISGGGTGGHIYPALAFIKEVQRRHPNVEFLYIGTENGLEKKIVERENIPFRSIEIGFKRKLSF
MURG_PSYCK      -----ILMMAAGTGGHVFPALAVSEELTKRGAMIHLGTPNGMENGLVAPTGYPFHAIEMQXXXXXXXXXX
MURG_ENTFA      -----ILVTGGGTGGHIYPALSFVEHVKKEAPATEFL-------YVGTENGLESQIVPKAKIGFKRSLSP
MURG_BURXL      -----LMVMAGGTGGHVFPGLAVAHLMQAWGWKVV---------WLGNPAGMEATLVPKHGI----PMEY
MURG_VIBCM      MNKNKKLMVAGGTGGHVFPGLAVAKQLQQQGWQIRLGTADRMEAELVPKHGIEIDFIQVKGLRGQGLMRL
MURG_VIBCH      MNKNKKLMVAGGTGGHVFPGLAVAKQLQQQGWQIRLGTADRMEAELVPKHGIEIDFIQVKGLRGQGLMRL
MURG_SYNS9      -----LLIAASGTGGHLFPALAVADALDGHCQVSWLGVPDRLETEL--VPARFKLITVNAGGLQGRGITK
MURG_DIAST      ------LVMAGGTGGHIFPGLALAEALRERGWQVHLGTPGSMEERLVPPRGFAFEPIDFSGVRGKGLKTX
MURG_ACISJ      ------LVMAGGTGGHIFPGLALAEALRERGWQVHLGTPGSMEERLVPPRGFAFEPIDFSGVRGKGLKTX
MURG_LISMF      -----VAISGGGTGGHVYPALALIRELKKEAEFLYIGTEKGLE--AGIVKREGIPFEAIEITGFKRSLSL
MURG_LISMC      -----VAISGGGTGGHVYPALALIRELKKEAEFLYIGTEKGLE--AGIVKREGIPFEAIEITGFKRSLSL
MURG_EXISA      -----IMISGGGTGGHIYPALALIETLKKRHPDLQV-------QYIGTENGLEADLVPRAGVGLKRSLSL
MURG_DESRM      ---------------HIYPALAIARGLQSRFSKVQIL-------YVGTNRGLEADIVPKANFGLQRKISL
MURG_DEIRA      ----LVVMATGGTGGHIYPAVATAKELRGRGYEVALMEEGIAEREGLTFYGVDAGKLARSGQGRPDP---
MURG_BURTA      -----LMVMAGGTGGHVFPGLAVAHRMQAQGWRVV---------WLGNPAGMEATLVPKHGI----PMEY
MURG_BACA2      -----IAVSGGGTGGHIYPALAFIKEVQRRHPDVEFLTENGLEKKIVERENIPFRAIEITGFKRKLSFEN
MURG_SHEPW      -----ILIMAGGTGGHVFPALAVAKYLSQQGWKVRLGTADRMEARLVPQHGFDIDFLDIKGVRGNGLLRK
MURG_OPITP      ------LISCGGTGGHLSPGIALAEGLQARGHSVRLLISHKKARLIAKYPRLDFTRVPGTGF-SLHPVRL
MURG_DEIGD      ----LIVMATGGTGGHIYPAVAVSRELLARGHEAVLLGQGMEERVAAELPFQGVNAGKLARSGQGRPDP-
MURG_DECAR      -----ILVMAGGTGGHIFPALAVAHKLRDAGWRVVWLPEGMEARLVPQHGFEMVWIKFSAXXXXXXXXXX
MURG_PSYA2      -----ILMMAAGTGGHVFPALAVSEELSKRGAIIHLGTPNGMENGLVAPTGYPFHAIEMQXXXXXXXXXX
MURG_CHLFF      -----IALAVGGSGGHIVPALATRETFCKEGIDV-LLLGKGLDNYPNLCEQDPYREIPSGSLSISRPIAA
MURG_VIBC3      MNKNKKLMVAGGTGGHVFPGLAVAKQLQQQGWQIRLGTADRMEAELVPKHGIEIDFIQVKGLRGQGLMRL
MURG_NOSP7      -----LLIAASGTGGHLFPAIALAEKLP--DYQIELGVPNRLETQLKEYPLNTIAV---EGFQQGFGLSS
MURG_LISMO      -----VAISGGGTGGHVYPALALIRELKKSHPELYIGTEKGLE--AGIVKREGIPFEAIEITGFKRSLSL
MURG_LISMH      -----VAISGGGTGGHVYPALALIRELKKEAEFLYIGTEKGLE--AGIVKREGIPFEAIEITGFKRSLSL
MURG2_BACAH     -----VLVSGGGTGGHIYPALALIREIKKLNPEARFL-------YIGTENGLESTIVPKAGIGFKRKISL
MURG1_BACCZ     -----VLVSGGGTGGHIYPALALIREIKKLNPEARFL-------YIGTENGLESTIVPKAGIGFKRKISL
MURG1_BACAN     -----VLVSGGGTGGHIYPALALIREIKKLNPEARFL-------YIGTENGLESTIVPKAGIGFKRKISL
MURG_BURP8      MQQRTLMVMAGGTGGHVFPGLAVAHLMQAWGWRVVWLGNPNGMEATHGIPMEYVQFGGLRGKGMKTPVNL
MURG1_BACCR     -----VLVSGGGTGGHIYPALALIREIKKLNPEARFL-------YIGTENGLESTIVPKAGIGFKRKISL
MURG1_BACC1     -----VLVSGGGTGGHIYPALALIREIKKLNPEARFL-------YIGTENGLESTIVPKAGIGFKRKISL
MURG_CHLMU      -----VVLAVGGTGGHIIPALAARETFIKEKVEVLLLGKGLTRFLEGE-PDVLYYDIPSGSPFSLRPNQM
MURG_SYNPW      -----LLIAASGTGGHLFPALSVADALPA-GWSAHLETTLVPERY----PLTTVNAGGLQGRGLKKVVQL
MURG_PELCD      -----------------FPAVALAQRL--------LEQDSEAQQFVGTARGIEARVLPEGLLGKLRMIPL
MURG_ENTHR      -----ILVTGGGTGGHIYPALAFVNYVKTKEPNTEFM-------YVGAQRGLENKIVPETGMGFQRKLSL
MURG_BUCBP      -----IIIMAGGTCGHIFPGLEIAKSLINKGWKVFLGTSKNIESKIVPKYGITIKYINISGVRGKNLFEL
MURG_ALKMQ      -----IMISGGGTGGHIYPAIAIANQITEKHPQAKIQFVGTAKGLESELAGYEIKHITVSYLRRKISFHN
MURG_PROMH      -----LMVMAGGTGGHVFPGLAVAHYLQSQGWDIRLGTADRMEAQLVPKHGIEIEYIRISGLRGKGVKAL
MURG_ALHEH      -----VLIMAGGTGGHVFPALAVAERLREQGVPVV---------WLGTREGLEARVVPAADIPLESPFVL
MURG1_BACHK     -----VLVSGGGTGGHIYPALALIREIKKLNPEARFL-------YIGTENGLESTIVPKTGIGFKRKISL
MURG_LACPL      -----LMISGGGTGGHIYPALALIDALKAHDPEAQV-------QFVGTHRGLESRIVPERGIGFKRSLSL
MURG_EXIS2      -----IVVSGGGTGGHIYPALAMIREIERRTEVLYIGTENGLERRAG-IPFESIEIS-----GIRRSLSF
MURG_BACHD      -----IVVSGGGTGGHIYPALAFINEMKKRDERLDVL-------YIGTERGLESEIVPREGIGFQRKLSM
MURG_ANOFW      -----IVVSGGGTGGHIYPALAFIHEVKKQHPNVDVL-------YIGTKKGLESTIVPRENIGLKRSLSF
MURG_THEPX      ------LFAGGGTGGHIYPAIAIAKEILKNEKNAQILFVGTKKGLENELVPREGFELKTITVGFKRKLSL
MURG_THEP3      ------LFAGGGTGGHIYPAIAIAKEILKNEKNAQILFVGTKKGLENELVPREGFELKTITVGFKRKLSL
MURG_HAEPS      -----LLVMAGGTGGHVFPAIAVVRELQQQGWEIRLGTKDRMEADLVPKHGIPIEFIQISGLKGKGIKAL
MURG_PROM4      -----LLIAASGTGGHLFPALAVAEALPESWKVSWLGVSDRLESIPKKYQLSTIGVEGVQSRGIKRIVQI
MURG_MICAN      -----LLIAASGTGGHLFPALALAERLPDYEIEWLGVPDRLEQSLVPKYP---LHTIPIEGFQTRLGLKT
MURG_LEUMM      -----IILSGGGTGGHIYPALALAEVIRKHEPDTEFL-------YVGSERGVESNIVPATGMGFKRSFSL
MURG_LISW6      -----VAISGGGTGGHVYPALAFIRELKKLHPELYIGTEKGLEADIVKIPFESIEIT-----GFKRSLSL
MURG_LISIN      -----VAISGGGTGGHVYPALAFIRELKKEAEFLYIGTEKGLE--AGIVKREGIPFESIEITGFKRSLSL
MURG_BORA1      MSAPTILIMAGGTGGHIMPGLAVAEILRQRGWQVRWL--GNPDKMEGKLPARGIEMAPLRFQGGRGVXXX
MURG_PROM3      -----LLIAASGTGGHLFPALAVAESLPASGVPDRLETQLVPERY-------ELTTVXXXXXXXXXXXXX
MURG_CLOCE      -----VLIAGGGTGGHINPGLAIAKYIKQKEAEADITFVGTKKGLETKLVPREGYPLETITVGFKRKLSL
MURG_SACD2      -----VVIMAGGTGGHVYPGLAVAEAMHQRGFNIELVAKA-SEQMGFDIAFSEIEI---SGVRGKGRMAL
MURG_MANSM      -----LLVMAGGTGGHVFPAIAVAQYLQKQGWDIWLGTKDRMEAQLVPKHGIPIEFIQISGLRGKGIKAL
MURG_BACCN      -----ILVSGGGTGGHIYPALALIREIKKLHPEARFL-------YIGTENGLESTIVPKAGIGFKRKISF
MURG_HAES1      -----LLVMAGGTGGHVFPAIAVAQYLQKQDWDIWLGTRDRMEAKLVPKHGIPIEFIQISGLRGKGLITL
MURG_DESVH      -----VILTTGGTGGHIFPALAVAEEIRARYPECSVL-------FMGGLYGPEADLAARAGLDXXXXXXX
MURG_CHLTR      -----IVLAVGGTGGHIIPALAARETFIHEDIEVLLLGKGLAH-----FLGDDSEVIPSGSPFSLRVNRM
MURG_CHLTA      -----IVLAVGGTGGHIIPALAARETFIHEDIEVLLLGKGLAH-----FLGDDSEVIPSGSPFSLRVNRM
MURG_THIDA      -----LMVMAGGTGGHVYPALAVAETLRERGWSVFWL-GTRAGLEARVVPAAGIDMVWVSMXXXXXXXXX
MURG_DESVV      -----VILTTGGTGGHIFPALAVAEEIRARYPECSVL-------FMGGLYGPEADLAARAGLDXXXXXXX
MURG_CHLTB      -----IVLAVGGTGGHIIPALAARETFIHEDIEVLLLGKGLAH-----FLGDDSEIIPSGSPFSLRVNRM
MURG_CHLT2      -----IVLAVGGTGGHIIPALAARETFIHEDIEVLLLGKGLAH-----FLGDDSEIIPSGSPFSLRVNRM
MURG_BACP2      -----IVISGGGTGGHIYPALAFIKEVKRLHPDVEFLTENGLEKKIVERENIPFKAIEISGFKRKLSFDN
MURG_ANASP      -----LLIAASGTGGHLFPAIALAEKLP--DYEIELGVPNRLETQLKQYPLNTIAVEGQQGLG----ISS
MURG_PROMM      -----LLIAASGTGGHLFPALAVAEALPGSGVPDRLETQLVPERY-------ELTTVXXXXXXXXXXXXX
MURG_CYAP8      -----LLIAASGTGGHLFPALALAEHLP--DYQIEWVPDRLEQTLVGRYP---LHSIAVEGFQTRSVLKN
MURG_PHOPR      MNKNKRLLVAGGTGGHVFPGLAVAKKLQQEGWEIRLGTADRMEADLVPKHGIEIDFIKVKGLRGQGIIRM
MURG_FLAJ1      MTKYKFILSGGGTGGHIYPAIAIANELKLQFPDAELFVGAKDKMEMQKVPQAGYEIKGLWIAGLQRKLTL
MURG_DICNV      -----LLFMAGGTGGHVYPXXXXXXXXXEQGSIIHWLGNQSG--FEGKKVPEAFHDIAVYGLRGNGVIGW
MURG_GLOVI      MPKPRLLIAASGTGGHIFPALAVAGELSEFEIAWLGVPDRLENKLVGRYP---LHTVALQGLNRKPGPQW
MURG_BDEBA      -----------------------------------------------------LHLIESGQLNVKSPIQK
MURG_LACJO      -----VIFSGGGTGGHIYPIMALIERLKER----KLVTNDEI-LFVGTDRGLESKIVPAAGVDRKHPLKN
MURG_BACFR      -----VIISGGGTGGHIFPAVSIANAIKELRPDAQILAEGRMEMQRVPDAGYQIIGLPVAGFDRKHLWKN
MURG_BACFN      -----VIISGGGTGGHIFPAVSIANAIKELRPDAQILAEGRMEMQRVPDAGYQIIGLPVAGFDRKHLWKN
MURG_VIBPA      -----LMVMAGGTGGHVFPGLAVAKQLQEQGWEIRLGTADRMEADLVPKHGIEIDFIKVKGLRGQGVKRL
MURG_DESPS      ---------------HLFPAIAAAQQFEYPGAEVLFVGTKRKERYGFKGVA-----INSYGLKGKNMREL
MURG_AZOVD      -----VLIMAGGTGGHVFPALACAREFQARGYAVHLGTPRGIENDLVPSAGLPLHRIQIGGLRGKGLATL
MURG_SYNS3      -----LLVAASGTGGHLFPALSVADALLEPWSVRWVGVPDRLETVPGRYPLTTVKAGGLQGRGLRKLIQL
MURG_SOLUE      ------LMAGGGTGGHVIPALAVARELRSRGHKVFFVGTQHGME--ARLVPPEGFEFKTIEIGGLNQVSW
MURG_OENOB      -----IIVSGGGTGGHIYPALALVESLLKHE------PDSKV-LYIGSFRGLEGSIVPKTGLDFKQSLTN
MURG_LACSS      ------MISGGGTGGHIYPALALIERLKQRGLL-------DAVLYVGTERGLESKIVPDQGIDFKTEIQG
MURG_LACGA      -----VIFSGGGTGGHIYPIMALIERLKER----KLVTNDEI-LFVGTDRGLESKIVPAAGVDRKHPLKN
MURG_TOLAT      -----MVIMAGGTGGHVFPGLAVAHRLQADGWNIHLGTPDRME--ADLVPAHGFPIEFINIRGLRNH-GL
MURG_LACH4      -----VIFTGGGTGGHIYPIMAIIERLKERG-----ISTNDKILFVGTKKGLESKIVPAAGVNRKHPLKN
MURG_BUCAP      MNSKRIIILAGGSGGHVFPGLTIAKHLIKKGWDINWITKNKIESEIIPKCNIKIHFIKIQGLRNSSLKNL
MURG_THETN      ------LFAGGGTGGHIYPAVAIAKEILKNEQDAQILTEKGLEKEL--VPREGFELVTIEVQGFKRKLST
MURG_ACIAC      ------LVMAGGTGGHIFPGLAVAEELRARGWKVHLGTPGSMESRIVPPQGFAFEPIDFSGVRGKGXXXX
MURG_CHLP8      -----VLFAGGGTGGHLYPGVAMASELKVPGVEISFATPAGIEATEVPRLGYPLHLLPVRGLSLRDLAAN
MURG_SYNR3      -----LLIAASGTGGHLFPALAVADRMPETWSVRWLGVPDRLERQLSRYPLFTVRAXXXXXXXXXXXXXX
MURG_MOOTA      ---------------HVYPALAIARGLKEARPGVELL-------YIGTARGLEADVVPRATLATITVQGL
MURG_LACAC      -----VIFTGGGTGGHIYPIMAIIERLKERG-----ISKNDEILFVGTQKGLESKIVPAAGVNRKHPLKN
MURG_CHRSD      -----VLIMAGGTGGHVVPXXXXXXXXXXXGVSVEWLGSPRGIENRLVPAADIVHRIQVAGLRGNGMAGW
MURG_CHLCV      -----IALAVGGSGGHIVPALATREAF-CKEXXXXXXXXXXXXNHPNLCDLD-VHYIPSGLPTVASPVTA
MURG_BACV8      -----------------FPAVSIANAIKEQHPEAEILAEGRMEMQRVPAAGYPIKGLPVAGFDRKNLLKN
MURG_PORG3      ------IISGGGTGGHIFPAISIADALRRRYPECEILAEGRMEMERVPRSGYEIVGLPIKGLDRKHLLSN
MURG_LEUCK      -----VILSGGGTGGHIYPALALAEVIKQHEPDAEFL-------YVGSERGVEANIVPKAVQGFSRSLSL
MURG_FRATN      ----------------------------------------------------------------------
MURG_PORGI      ------IISGGGTGGHIFPAISIADALRRRYPECEILAEGRMEMERVPRSGYEIVGLPIKGLDRKHLLSN
MURG_LACBA      -----LMVSGGGTGGHIYPALALIKALKKR-------EPNSAVMYVGSERGLESTIVPAKGIGFKRSLSL
MURG_XANOR      -----VMILAGGTGGHIFPGLAVAKVLRARGVPVTLGADGAMETRL--VPQHDIPIDTLAITGGKGMVKL
MURG_SULDN      -------ITGGGTGGHLMIAEALVEACANDGHEAIFITSGQDRKYFSKF--SHVYFLQTTGVVNQRGLGK
MURG_LACLS      ---------------HIYPALAFLKYLKQEEPDTEVL-------YIGTKKGLESKIVPRAGIGLRRSLSP
MURG_LACLM      ---------------HIYPALAFLKYLKQEEPDTEVL-------YIGTKKGLESKIVPRAGIGLRRSLSP
MURG_HALHL      MSVRTVAIAAGGTGGHVYPGLAVADALRERGHRVV---------WLGTRAGLEGRVVPAAGLDAKGLATI
MURG_XANOM      -----VMILAGGTGGHIFPGLAVAKVLSARGVPVTLGADGAMETRL--VPQHDIPIDTLAITGGKGMVKL
MURG_CYTH3      -----------------YPAVAIANAIKARFPDSEILVGAQGRMEMQKVPAAGYNIEGLWISGIQRKLSL
MURG_CLOPH      -----IVLTGGGTAGHVTPNIALIAGLKEQGYEIHYIGSYEGERELIEKLGIPYHGISSGKLRRYLDIKN
MURG_CHLTE      -----VLFAGGGTGGHLYPGVAMAAELKKRGISISFAGTS-AGIEATEVPRLGYRLVLFPVRGLKRGLSI
MURG_XYLFM      -----VMILAGGTGGHIFXXXXXXXXXXXXXXXXXLGATGKMETHLVPKHGIEIQTIAVAGVRGRGMLAL
MURG_SALRD      -----ILMVGGGTGGHVYPAIAIADAVRALRPDAQIVTQDRLEARAVPEAGYALHPITAQGLQRRAVASN
MURG_FLAPJ      ------ILSGGGTGGHIYPAIAIANELKSRFPNCKILVGAKDKMEMQKVPQAGYDIKGLSIAGLQRKITL
MURG_CHLAB      -----IALAVGGSGGHIVPALATREAFCREGVDV-LLLGKGLENHPSLGEQQILYKIPSGLPTFVRPITA
MURG_PELLD      -----ILFAGGGTGGHLYPAVAMAAMLKEMVPGVELSFAGTASGIAGEVPGYRLHLIPVRGLKRGRSLSA
MURG_PARD8      -----------------FPAISIANTFKKRFPDAEILFVGAEDRMEDKVPAAGYKIVPVSGFDRAHLMNN
MURG_DESVM      -----VILTTGGTGGHIFPALAVAEEIKARGPEADLAARAGLE-YVG------LPXXXXXXXXXXXXXXX
MURG_FINM2      -----IIVSGGGTGGHIYPAISLIEELKKRDKDNKIL-------YVGTEKGLESSIVPKLGIDFKTNANS
MURG_DESHD      ---------------HIYPALAIA-----KGILVH---QPDAELYIGTREGMEARLVPEAGLERKLSLET
MURG_MYCVP      -DRGIVVLAGGGTAGHIEPAMAVADALTALDPDVRITTERGLETRLVPQRGYHLELITLVPLPRKLSADL
MURG_FUSNN      -----VMLTTGGTGGHIYPALAVADRLKIKGIEAVFV--GSMERMEKDLVPESGHKFIGVDISVPRGLKN
MURG_DESHY      ---------------HIYPALAIAKGILAQRPDAEIL-------YIGTREGMEARLVPEAGIERKLSLET
MURG_CHLPN      -----VALAVGGSGGHIVPALSVKEAFSREGIDV-LLLGKGLKNHPSLQQGISYREIPSGLPTVLNPIKI
MURG_TRIEI      -----LLIAASGTGGHLFPAIAIANQLKDYHIEWLGVPDRETKLIPSQYP---LHTISVEGFQQKLGIET
MURG_SYNSC      -----LLIAASGTGGHLFPALAVAEAVEDLGVPDRLETQLVPERFG--------LVCVNAXXXXXXXXXX
MURG_PROM2      --KNNLLVAASGTGGHIFPALAVSKEVEDK-WNIH---------WLGVKQRLDSNLIPKKTLSIKTPRKN
MURG_FRASC      -----VVLAGGGTAGHVEPALAVADALRATDSRVXXXXXXXXXXXXXXXPAHELATVPKVPMPRRPTPAV
MURG_ALKOO      -----VILSGGGTGGHIYPAISIANKIKEQHPKAEILTENGMESEIVPKAGYPIKYVTVSYLKRKISLHN
MURG_PROMS      --KNNLLVAASGTGGHIFPALAVSKEVEDEGIQQRLDANLIPQKYNLK------------TLNLKTPIFL
MURG_GRAFK      MKEGLVILSGGGTGGHIYPAIAIADEIKRRYPNAEIL-------FVGAQDRMEMEKVPQAGYEIKGLISG
MURG_CHLL2      -----VLFAGGGTGGHLYPAVAMAVELLVPGASVSFAGTKNGIE-ASEIPGYRLHLLPVRGLKRGGSLRA
MURG_PROM0      --KNNLLVAASGTGGHIFPALAVTKEVEDK-WNIH---------WLGVHKRLDANFIPKKTLNIKTPRKN
MURG_COREF      -----VVVAGGGTAGHIEPALAVAEALRARGLETSLVPDR----------GFDLRLIEPVPVPRTPNLDL
MURG_CHLT3      -----LIFAGGGTGGHVFPAIAIAQEITQQNAEIQFVTERGIEATAVPKQGFPMHLIPVA--GVKRGFSP
MURG_PROMP      -----LLIAASGTGGHIFPALAVSKKVE-KDWDIHWLGVTK--RLDSEFVPSKYNLLTLNLETPKKNIFR
MURG_PELTS      ------LVSGGGTGGHIYPALAIARGLKNRGAEILYMGTSNGME-ADIVPAEGFPFTGISASGLERKLSP
MURG_PROM9      --KNNLLVAASGTGGHIFPALAVSKEVEDE-WNIHWL--GVRQRLDANFIPKKYNL---RTLNIKTPIFL
MURG_HELPJ      -------LTGGGTGGHLSIAKALAIELEKQGIEAIYLTYGQDKEWFENSPLSERYFFNTQGVVNKSFFKK
MURG_XANC5      -----VMILAGGTGGHIFPGLAVAKVLRARGVPV---------TWLGADDAMETRLVPQHDIPI-DTLAI
MURG_PROM1      -----LLIAASGTGGHIYPALSFADSLSNSWEIVWLGVPNRLEV---ELVPEKYNLIKLKVGGLQNIFRK
MURG_LACDB      -----VIFSGGGTGGHIYPIMALIERLKEEG-----ICQDDEILFVGTKKGLESKIVPAAGVNRKHLLNN
MURG_LACDA      -----VIFSGGGTGGHIYPIMALIERLKEEG-----ICQDDEILFVGTKKGLESKIVPAAGVNRKHLLNN
MURG_DESMR      -----LIVTTGGTGGHIFPALAVAEAAMSPGLDVLFIGGAGPEGELAAKAGLPFVALPAKGVFGRGIKAL
MURG_PROMT      -----LLIAASGTGGHIYPALSFADSLSNSWEIVWLGVPHRLEV---ELVPEKYNLIKLKVGGLQNSFRK
MURG_PROM5      -----LLIAASGTGGHIFPALAVSKEVEKYWNMHWLGVEKRLD---SKFVPRKYNLLTLNLETPQKSIFI
MURG_PROAC      -----VVLAGGGTAGHTSPLIATAMALQERGATVSCIGTPRG--LEGRVIPEQLDMIPPVPLPRTVNADL
MURG_NOCSJ      -----VLLAGGGTAGHTSPLLATADALRRLEPDVEITCLGTPRGLENKVVPEALELIPPVPLPRRPGADL
MURG_MYCA1      -----VVLAGGGTAGHVEPAMAVADALKALDPNVRITSLGTARGLETRLVPEDLELITPVPLPRKPTGDL
MURG_ALCBS      ---GTVLIMAGGTGGHVFPALAVADQLRTRGFDIWLGAENGMEGNLVRQYGYEIAELSVSRLRGGGIKRK
MURG_SYNY3      -----LLIAASGTGGHLFXXXXXXYEIIWLGVPDRLETTLVPRQYP-------LQTIPVEGFQGRPSLKT
MURG_ANAVT      -----LLIAASGTGGHLFPAIALAEKLP--DYEIELGVPNRLETQLKQYPLNTIAVEGQQGLG----LSS
MURG_NATTJ      -----VLVTGGGTGGHIYPALAVINELKERNQIVDIL-------YVGTSKGMEQEIIPNRGIGLQRKINL
MURG_HELPY      -------LTGGGTGGHLSIAKALAIELEKQGIEAIYLTYGQDKEWFENSPLSERYFFNTQGVVNKSFFKK
MURG_RUTMC      -----ILIMAGGTGGHIFPALAIANELKNHSTHIQLGSNVGIENEIVPKHNIKLHTVNSVGLRGKSVVSL
MURG_PELPB      -----VLFAGGGTGGHLYPAIAMAGELRKLGYRLHLIPVRGLKR--GRALADIV-----ANIGV------
MURG_MYCPA      -----VVLAGGGTAGHVEPAMAVADALKALDPHVRITALGTARGLETRLVPEDLELITPVPLPRKPTGDL
MURG_FRAAA      ----------------------------------------------------ELATVPKVPMPRRPTPAL
MURG_XYLFA      ----------------------------------------------------------------------
MURG_LACS1      -----LLISGGGTGGHIYPALALIEAIKQKEPDSEIL-------YVGTHKGLESRIVPSAGVGFKRSLSL
MURG_CHRVO      -----VMVMAAGTGGHIVPGLAVAKELQSRGWKVVWLGTRRGMENKLVPPTGPLERLNFHGVRXXXXXXX
MURG_SYNWW      ---------------HIYPALAIASGLKERLGEAEIL-------YVGTKKGLEANIVPRAGIDRSSMLKA
MURG_HELPH      -------LTGGGTGGHLSIAKALAIELEKQGIEAIYLTYGQDKEWFENSPLSERYFFNTQGVVNKSFFKK
MURG_CHLCH      -----VLFAGGGTGGHLYPAIAMAAELQRLSPNVSVATKSGIEATEVPRLGYKLHLVSVRGLSPKLLIEN
MURG_BUCAT      -----IIIMAGGSGGHVFPGLTIARYLIEKGWLVNWIKNSIESRIIPKYGI-KIHYISIKGLRNTSLKNL
MURG_BUCAI      -----IIIMAGGSGGHVFPGLTIARYLIEKGWLVNWIKNSIESRIIPKYGI-KIHYISIKGLRNTSLKNL
MURG_CLONN      MSKYKIIMTGGGSAGHVTPNLALVPKLKELGYEIQYITENGIERKIIESENIKYHIISSGKLRRYFDIKN
MURG_BAUCH      -----LIIVAGGTGGHIFPGLAIANNMITQGWDVRLGTKNRIE--ADLVPKHGISIYGYGLHGKKQKILA
MURG_XYLFT      -----VMILAGGTGGHIFPGLAVAGVLRARGVPVWLGAAGKMETHLVPKHGIEIQTIAVSGVRGHGMLAL
MURG_XYLF2      -----VMILAGGTGGHIFPGLAVAGVLRARGVPVWLGAAGKMETHLVPKHGIEIQTIAVSGVRGHGMLAL
MURG_HELP2      -------LTGGGTGGHLSIAKALAIELEKQGVEAIYLTYGQDKEWFENSPLSERYFFNTQGVVNKSFFKK
MURG_EUBE2      -----IVLTGGGTAGHVTPNIALLPSLKEAGYEVF---------YIGSYTGIEKTLIEDLGIPSSGKLRR
MURG_BUCA5      -----IIIMAGGSGGHVFPGLTIARYLIEKGWLVNWITKNSIESRIIPTYGIKIHYISIKGLRNTSLKNL
MURG_SORC5      -----VLIAGGGTGGHVFPMXXXXYVGTARGIEVRVMGE-RGDNL------ELLHVLPLRGGGLSG---F
MURG_PROA2      -----ILFAGGGTGGHLYPAVAMAERLEQLGYRLHLL-DVRGFRRGFSFS----DMLNNAGV----LLDF
MURG_BIFAA      -NQKHIVLAGGGTAGHVNPLLAVAHVIRELEPEADIAVVGTAERQAG-FELETIEKVPFPRRPNKAALQF
MURG_SYNJA      -----LLVAASGTGGHIFPALAVVEQLPT--WQIEWL--GVPQRLEAKLVPDRYPLHRVAMSGWQSPWQK
MURG_PROMA      -----LLIAASGTGGHIFPALSVAEELPESWDISWLGVPERLENQLVPTKYD-MTVIPVGGLQSKG-LRK
MURG_CYAA5      -----LLIAASGTGGHVFPALGVAEKLS--DYEIQLGTPNRLEQVGDRYP---FHTISVEGFQTRXXXXX
MURG_CLOAB      MKKLKIVMTGGGSAGHVTPNLALVPKLKELGYEIEYITKDGIERSIIEKENIKYNCISSGKLRRYIDIKN
MURG_THEEB      -----LLIAASGTGGHLFPALAVAQELPE--YEIHLGVRDRLENQLIP-PHYPLHTVNFSGLQGKTPWAK
MURG_PROVI      -----ILFAGGGTGGHLYPAVAMAE-------EVQRMVPGASVLFAGTSRGIEAREVPR--LGYRLHLLE
MURG_ELUMP      ------IIASGGTGGHFYPGFSLGKELRKRSYEVLFVV--RKEDAAIKFNYKEINFTGFPR--SANPIRH
MURG_CHLPD      -----VLFAGGGTGGHLYPAVAMAGELQKRVPHVKLFAGTEAGIEAREIPRLGYRLHLLSVRGLKRGRSL
MURG_SYNJB      -----LLVAASGTGGHIFPALAVAEQLP--DWQIEWL--GVPDRMEGKLVRERYRVVMSGWQGSPXXXXX
MURG_HELPS      -------LTGGGTGGHLSIAKALAIELEKQGIEAIYLTYGQDKEWFENSPLSERYFFNTQGVVNKSFFKK
MURG_FRATT      ----------------------------------------------------------------------
MURG_FRAT1      ----------------------------------------------------------------------
MURG_SYNPX      -----LLIAASGTGGHLFPALAVAEALP-EDWQV---------RWLGVPDRLETQLVPARTVNAGGXXXX
MURG_FRATW      ----------------------------------------------------------------------
MURG_FRATO      ----------------------------------------------------------------------
MURG_FRATM      ----------------------------------------------------------------------
MURG_FRATH      ----------------------------------------------------------------------
MURG_FRATF      ----------------------------------------------------------------------
MURG_DICTD      -----ILFVAGGTGGHVIPALNMADYISERAPHWKISFIGRKNSFAGKYDFYGLDIIKSSDIKKLS----
MURG_CORJK      -----VVVAGGGTAGHIEPAMAVAEAVRAQRPDARITTTRGLETTLVPARGFDLQLIPPVPVPRKLNKDL
MURG_ACIAD      -----VMMMAAGTGGHVFPALAVAKQLQQHGCQVSLATPAGMENRLLKDQNIPIYQIDIQGVRGNGAVRK
MURG_ACIBY      -----VMMMAAGTGGHVFPALAVAKQLQQQGCQVSLATPTGMENRLLKDQNIPIYQIDIQGVRGNGVIRK
MURG_ACIBC      -----VMMMAAGTGGHVFPALAVAKQLQQQGCQVSLATPTGMENRLLKDQNIPIYQIDIQGVRGNGVIRK
MURG_ACIB5      -----VMMMAAGTGGHVFPALAVAKQLQQQGCQVSLATPTGMENRLLKDQNIPIYQIDIQGVRGNGVIRK
MURG_ACIB3      -----VMMMAAGTGGHVFPALAVAKQLQQQGCQVSLATPTGMENRLLKDQNIPIYQIDIQGVRGNGVIRK
MURG_DICT6      -----ILFVAGGTGGHVIPALNMADYIKAPHWKISFVKDSFEEGLIGKYDFYGLNISRSSDVKKLS----
MURG_METPP      MTQRHLVVMAAGTGGHIIPGLAVAQEMQHRGWTVSLGTEQGMENRLVPPAAEEMDTIAFSXXXXXXXXXX
MURG_ACIBS      -----VMMMAAGTGGHVFPALAVAKQLQQQGCQVSLATPIGMENRLLKDQNIPIYQIDIQGVRGNGVIRK
MURG_FRAP2      ----------------------------------------------------------------------
MURG_CLOK5      -----IILTGGGSAGHVTPNLALIPKLKELGYEIQYITESGXXXXXXXXXXXXYHVISSGKLRRYFDIKN
MURG_CYAP7      -----LLIAASGTGGHLFPALAVAEQLL--DYKIELGVPNRLEQTL--VPQDPLHTIAVEGFQTGFSLKS
MURG_CORGB      -----VVVAGGGTAGHIEPALAVAEALRARGLETTLVPDR----------GFELHLIEPVPVPRKPNMDL
MURG_RHOE4      -----VVVAGGGTAGHIEPXXXXXXXXXARGLETTLVP---ARGYT-------LELIPPVPLPRKPTMDL
MURG_DESDG      -----VLLTTGGTGGHIFPALAVAEEIRRQYPAADIL-------FVGGSYGPEARIVPAHGIGLKAPLAL
MURG_CORGL      -----VVVAGGGTAGHIEPALAVAEALRARGLETTLVPDR----------GFELHLIEPVPVPRKPNMDL
MURG_AMOA5      -----VIISGGGTGGHVYPGIAIADVLKQKNAENQILVGAGGKMEMSQVPAAGYPIVPIRGINRKLPIWV
MURG_ALISL      -----LLVMAGGTGGHVFPGLAVAKQLQSEGWEIRLGTEDRMEADLVPKHGIEIDFIXXXXXXXXXXXXX
MURG_VESOH      -----ILIMAGGTGGHIFPALAIANELKKHSSNIQLGSNLGMENNIIPKHNIKLHTVSSVGLRGKNVISL
MURG_HELPG      -------LTGGGTGGHLSIAKALAIELEKQGIEIYLGSTYGQDRFENSPLFSERYFFNTQGVVNKSFFKK
MURG_BACTN      -------------------------------------------------------------------IKL
MURG_ACIBT      -----VMMMAAGTGGHVFPALAVAKQLQQQGCQVSLATPTGMENRLLKDQNIPIYQIDIQGVRGNGVIRK
MURG_THEP1      -----VAAAGGGTGGHLYPLLAILETLAKRVKVLFFAVKGKIDERVVRKDHPEFETVSIDVRGLLRPLHH
MURG_THEMA      -----VAAAGGGTGGHLYPLLAILETLAKRVKVLFFAVKGKIDERVVRKDHPEFETVSIDVRGLLRPLHH
MURG_HELHP      -------ITGGGTGGHLAIAKALAQEAQKNNXXXXXXXXXXXXDFEGSSLFTHCYFLDSTGVVNKKGLGK
MURG_AQUAE      ----MIAVSGGGTGGHFFPALAFTNYVLKKE-KVKFIGSKRGIEYELKLIKTEKLFLDVEPLRERNFYQK
MURG_PELUB      MNKKI-LISTGGSGGHVIPATIIYKHLEDN-FDVSMTSDFRGVKFLNK---DEYNLIFNVRPISKNPLDF
MURG_HELAH      -----VALTGGGTGGHLSIAKALAIELEKQGVEAIYLTYGQDKEWFEDSPLSECYFFNTQGVVNKSFFKK
MURG_SULNB      ----------------------------------------------------------------------
MURG_THEFY      -----VVLAGGGTAGHVEPALALADALRRINPDTQVLTKRGLEQRLVPMRGYELAEIPAVPLPRKLTPQL
MURG_MYCS2      -DRGIVVLAGGGTAGHVEPAMAVADALRALDPDVRITTQRGLETRLVPQRGYDLELITPVPLPRKPSKDL
MURG_CORDI      MNTPRVVVAGGGTAGHIEPALAVAESLRHRGAEVALGTTKGLETSIVPERGFELRLINPVPVPRKINADL
MURG_XANAC      -----VMILAGGTGGHIFPGLAVAKVLRARGVPV---------TWLGADGAMETRLVPQHDIPI-DTLAI
MURG_ROSS1      -------LVGGGTGGHVYPXXXXXXXXXXXXXQFVVATDGGRNRYVGSVGGMEFHALPAAAVRGRNPLTM
MURG_STRAW      -----VVLAGGGTAGHIEPXXXXXXXXRRQDPTVGITTERGLETRLVPERGYDLALIPAVPLPRKPTPEL
MURG_MYCUA      -----VVLAGGGTAGHVEPAMAVADALSVLEPNVRITALGTSRGLETRLPARGYHLITPVPLPRKPSGDL
MURG_LACLA      ---------------HIYPALAFLKYLEK-------VEPDTEVLYIGTKKGLEAKIVPQAGIGLRRSLSP
MURG_CAMHC      ---------------HLTIAKILAYELKKRGLKTIFIGSTNGQDFENSVLFDEKYFLKSSGVVNKKGISR
MURG_DEIDV      ----LVVMATGGTGGHIYPAVATARELNARGHETLLLGQGMEERVAAEFEGVDAGKLARSGQGRPDP---
MURG_MYCMM      -----VVLAGGGTAGHVEPAMAVADALSVLEPNVRITALGTARGLETRLPARGYHLITPVPLPRKPSGDL
MURG_VEREI      ------LIMAGGTGGHIFPGLAVAEALRARGWRVHLGAPASMEARIAAQHGFALESVTFSGVRGKGXXXX
MURG_MYCLE      -----VVLAGGGTAGHVEPAMAVADALRALDPQVRITALGTSRGLETRLVPERLELITPVPLPRKLTGDL
MURG_MYCLB      -----VVLAGGGTAGHVEPAMAVADALRALDPQVRITALGTSRGLETRLVPERLELITPVPLPRKLTGDL
MURG_MYCSS      -----VLLAGGGTAGHXXXXXXXXXXXXXXXXGVRITTERGLETRLVPERGYALELITPVPLPRKLSGDL
MURG_MYCSK      -----VLLAGGGTAGHXXXXXXXXXXXXXXXXGVRITTERGLETRLVPERGYALELITPVPLPRKLSGDL
MURG_STRCU      -----VVLAGGGTAGHIEPXXXXXXXXRRQDPTVGITTERGLETRLVPERGYELALIPAVPLPRKPTPEL
MURG_CLOTE      -----IILTGGGTAGHVTPNISLIPKLKELGYEVQYITKDGIEKSLIKKEGIKYHEISSGKLRRYFDLKN
MURG_NITSB      ----------------------------------------------------------------------
MURG_WOLSU      ---------------HLAIAKALMESLASKNQSLFFIGSQRGQDRSW-FEHEERFFLETQGVVNQRGIAK
MURG_ACIC1      -----VVLAGGGTAGHIEPALTLAEALRRRGVGITLLGSPRGETRLVPARGFDLALIPAVPLPRRLTPDL
MURG_CLOPS      MKKYKIIMTGGGSAGHVTPNLALVPKLKELGFEIKYIGSKNGEKEIITKENIPYYSISSGKLRRYFDIKN
MURG_CAMJD      ----------------------------------------------------------SKGVVNQNKFGK
MURG_BIFLO      MNQGTIVLAGGGTAGHVNPLLAVAGAIRVIGTAVGLEKDLVPE--AG-YELDTIEKVPFP----RRPNLY
MURG_BIFLD      MNQGTIVLAGGGTAGHVNPLLAVAGAIRVIGTAVGLEKDLVPE--AG-YELDTIEKVPFP----RRPNLY
MURG_SACEN      ----------------------------------------------------------------------
MURG_LEPBL      -----IVIAAGGTGGHISPGVALAEVLEKIGYELYLYSLIRNQNNP------DLEQAPCPVLWHNLPSNI
MURG_LEPBJ      -----IVIAAGGTGGHISPGVALAEVLEKIGYELYLYSLIRNQNNP------DLEQAPCPVLWHNLPSNI
MURG_TROWT      -----ILLAGGGTAGHVNPLLALADVLKVSGHATFLGTSEGIESRLVPNSGIDFFTIPKLPFPRRTSRHI
MURG_TROW8      -----ILLAGGGTAGHVNPLLALADVLKVSGHATFLGTSEGIESRLVPNSGIDFFTIPKLPFPRRTSRHI
MURG_GEOTN      -----IVLTGGGTAGHVMVNVALIPKLKEQGWDIVYIGSHXXXXXXXXXXXDGVPYYSVSTKNFKDPFNV
MURG_CLOPE      MKKYKIIMTGGGSAGHVTPNLALVPKLKELGFEIKYIGSKNGEKEIITKENIPYYSISSGKLRRYFDIKN
MURG_CLOP1      MKKYKIIMTGGGSAGHVTPNLALVPKLKELGFEIKYIGSKNGEKEIITKENIPYYSISSGKLRRYFDIKN
MURG_BIFLI      -----IVLAGGGTAGHVNPLLAVAGAIRVIGTAVGLEKDLVPE--AG-YELDTIEKVP---FPRRPDLYM
MURG_CLOBB      MYKYKVIMTGGGTAGHVTPNLALVPSLKENGFEVKYIGSKDGXXXXXXXXXXXPYFISSGKLRRYFDFKN
MURG_THESQ      ---------------HLYPLLAILETLAKRVKVLFFAVKGKIDERVVRKDHPEFETVSIDVRGLLRPLHH
MURG_THENN      -----VAAAGGGTGGHLYPLLAILETLSVETKVLFFAVKGKIDEKVVKQEHPEYEVVTLDVRGLFRPLYH
MURG_CLOBA      MYKYKVIMTGGGTAGHVTPNLALVPALKENGFEVKYIGSKDGXXXXXXXXXXXPYFISSGKLRRYFDLKN
MURG_STAAB      -----IAFTGGGTVGHVSVNLSLIPTALSQGYELYIGSKNGIEREMIESQLPEIKYYPISSGKLRRYISL
MURG_STRCO      -----VVLAGGGTAGHIEPXXXXXXXXRRQDPTVGITTERGLETRLVPERGYELALIPAVPLPRKPTPEL
MURG_STAAR      -----IAFTGGGTVGHVSVNLSLIPTALSQGYEVLYIGSKNGEMIESQLPEIKYYPISSGKLRRYISLEN
MURG_GEOSW      MNKKIIL-TGGGTAGHVMVNLALIPKLKEQGWDI---------AYIGSHQGIERELISKVEGVPYFPIST
MURG_GEOKA      -----IILTGGGTAGHVMVNVALIPKLKELGWDIVYIGSHQXXXXXXXXXXDGVPYYSVSTKNFKDPFNV
MURG_WIGBR      ----------------------------------------------------------------------
MURG_STAAW      -----IAFTGGGTVGHVSVNLSLIPTALSQGYELYIGSKNGIEREMIESQLPEIKYYPISSGKLRRYISL
MURG_STAAS      -----IAFTGGGTVGHVSVNLSLIPTALSQGYELYIGSKNGIEREMIESQLPEIKYYPISSGKLRRYISL
MURG_STAAN      -----IAFTGGGTVGHVSVNLSLIPTALSQGYELYIGSKNGIEREMIESQLPEIKYYPISSGKLRRYISL
MURG_STAAM      -----IAFTGGGTVGHVSVNLSLIPTALSQGYELYIGSKNGIEREMIESQLPEIKYYPISSGKLRRYISL
MURG_STAAE      -----IAFTGGGTVGHVSVNLSLIPTALSQGYELYIGSKNGIEREMIESQLPEIKYYPISSGKLRRYISL
MURG_STAAC      -----IAFTGGGTVGHVSVNLSLIPTALSQGYELYIGSKNGIEREMIESQLPEIKYYPISSGKLRRYISL
MURG_STAA9      -----IAFTGGGTVGHVSVNLSLIPTALSQGYELYIGSKNGIEREMIESQLPEIKYYPISSGKLRRYISL
MURG_STAA8      -----IAFTGGGTVGHVSVNLSLIPTALSQGYELYIGSKNGIEREMIESQLPEIKYYPISSGKLRRYISL
MURG_STAA2      -----IAFTGGGTVGHVSVNLSLIPTALSQGYELYIGSKNGIEREMIESQLPEIKYYPISSGKLRRYISL
MURG_STAA1      -----IAFTGGGTVGHVSVNLSLIPTALSQGYELYIGSKNGIEREMIESQLPEIKYYPISSGKLRRYISL
MURG_CLOBM      -----IIMTGGGTAGHVTPNLALVPELKKLGYEIKYIGSXXXXXXXXXXXXXXXYFISSGKLRRYFDLKN
MURG_CAMJR      ----------------------------------------------------------------------
MURG_CAMJJ      ----------------------------------------------------------------------
MURG_CAMJE      ----------------------------------------------------------------------
MURG_CAMJ8      ----------------------------------------------------------------------
MURG_STAAT      -----IAFTGGGTVGHVSVNLSLIPTALSQGYELYIGSKNGIEREMIESQLPEIKYYPISSGKLRRYISL
MURG_STAA3      -----IAFTGGGTVGHVSVNLSLIPTALSQGYELYIGSKNGIEREMIESQLPEIKYYPISSGKLRRYISL
MURG_MYCSJ      -----VLLAGGGTAGHXXXXXXXXXXXXXXXXGVRITTERGLETRLVPERGYALELITPVPLPRKLSGDL
MURG_CLOB8      MAKYKIIMTGGGTAGHVTPNLALVPKLKQKDFEI---------KYIGSFDGIEKEIITKNNIGKLRRYFD
MURG_THEAB      -----IAVAGGVTGGHLYPALAVLKELEKLDVLYFTVSGKLEERVLKDYNYKKVSLKIQGLKRPVYSIEN
MURG_BACSK      -----IIFTGGGSAGHVTPNLAIINELNDKDWSIAYIGSYEGERQLVEKAGIRYFGISSGKLRRYMDWKN
MURG_STRU0      -----ILFTGGGTVGHVTLNLILIPKFLKDGWEVHYIGDKKGIEYQSGYPVT-FHAIKTGKLRRYFSWQN
MURG_STACT      -----IAFTGGGTVGHVSVNLSLIPIAQERGYEAFYVGSKNGEMIESQLPGIQYFPISSGKLRRYISVEN
MURG2_BACCZ     -----IVFTGGGSAGHVTPNLAIIPYLKEDNWDISYIGSHQGIEKTIIEKEDILYYIASGKLRRYFDLKN
MURG2_BACCR     -----IVFTGGGSAGHVTPNLAIIPYLQEDNWDISYISHQXXXXXXXXXXXXPYYSISSGKLRRYFDLKN
MURG2_BACC1     -----IVFTGGGSAGHVTPNLAIIPHLQEQNWDISYISHQXXXXXXXXXXXXPYYSIASGKLRRYFDLKN
MURG_LEPIN      -----IVIVAGGTGGHISPGVALAEVLEKIGYELYSLVRNKNNPDLEQAPCPVLHNLP--------PLSS
MURG_LEPIC      -----IVIVAGGTGGHISPGVALAEVLEKIGYELYSLVRNKNNPDLEQAPCPVLHNLP--------PLSS
MURG3_BACAH     -----IVFTGGGSAGHVTPNLAIIPYLKEDNWDISYIGSHQGEKTIIEKEDIPYYSIASGKLRRYFDLKN
MURG2_BACHK     -----IVFTGGGSAGHVTPNLAIIPYLKEDNWDISYIGSHQGEKTIIEKEDIPYYSIASGKLRRYFDLKN
MURG2_BACAN     -----IVFTGGGSAGHVTPNLAIIPYLKEDNWDISYIGSHQGEKTIIEKEDIPYYSIASGKLRRYFDLKN
MURG_OCEIH      -NNKRILFTGGGTAGHVIVNLALIPYYQERGWEIDYIGSYNGIERDLISPLDGVHSVSTGKLRRYMSKEN
MURG_STAHJ      -----IAFTGGGTVGHVSVNLSLIPTATDKGHDAFYITGIEREMIESQLPNIEYYPISSGKLRRYLSVDN
MURG_CLAMS      ----VYLLAGGGTAGHVNPLLAVADELRARGSTI-LVLGTREGLESRLVPARELLTIARLPFPRRPNGAA
MURG_STRGC      -----ILFTGGGTVGHVTLNLLLIPKFIKEGWQVHYIGDKNGIEYQEKSGLDTFHSVATGKLRRQNLLDG
MURG3_BACCR     -----ILFTGGGTAGHVMINIVLIPKFIEKGWRVE---------YIGSKNGIEKSLVQNVKYNSVST-GK
MURG_STRS7      -----IIFTGGGTAGHVTLNLILIPKFIKDGWEVHYIGDDNGIEHQEKSGLDAFHTIATGKLRRYFSWQN
MURG_STREM      -----IIFTGGGTAGHVTLNLILIPKFIKDGWEVHYIGDDNGIEHQEKSGLDTFHAIATGKLRRYFSWQN
MURG_XANCP      -----VMILAGGTGGHIFPGLAVAKVLRARGVPVWLGADGAMETRLVPQHAIQIDTLAISGLRGKGIVKL
MURG_XANCB      -----VMILAGGTGGHIFPGLAVAKVLRARGVPVWLGADGAMETRLVPQHAIQIDTLAISGLRGKGIVKL
MURG_XANC8      -----VMILAGGTGGHIFPGLAVAKVLRARGVPVWLGADGAMETRLVPQHAIQIDTLAISGLRGKGIVKL
MURG_STRP6      -----ILFTGGGTVGHVTLNLILIPKFIKDGWEVHYIGDKNGIEHTEKSGLDTFHAIATGKLRRYFSWQN
MURG_STRPG      -----ILFTGGGTVGHVTLNLILIPKFIKDGWEVHYIGDKNGIEHTEKSGLDTFHAIATGKLRRYFSWQN
MURG1_BACAH     MNKKI-LFTGGGTAGHVMINMVLIPKFMGKGWGVE---------YIGSQNGIEKLLVQNVKYNSIST-GK
MURG_STRPD      -----ILFTGGGTVGHVTLNLILIPKFIKDGWEVHYIGDKNGIEHTEKSGLDTFHAIATGKLRRYFSWQN
MURG_STRP3      -----ILFTGGGTVGHVTLNLILIPKFIKDGWEVHYIGDKNGIEHIEKSGLDTFHAIATGKLRRYFSWQN
MURG_STRMU      MAKKKIIFTGGGTVGHVTLNLLLIPRFLKDGWEVHYIGDKHGIEHEQIEQSDFFHSIATGKLRRYFSLKN
MURG_CLOB6      -----IIMTGGGTAGHVTPNLALVPELKKLGYEIKYIGSXXXXXXXXXXXXXXXYFISSGKLRRYFDLKN
MURG_THELT      --------AGGGTGGHLYPAEKLAEMKKLN--VTYFCLEKGIESKILPLEHPEYKLIKIDLKGLERPIWK
MURG_SYMTH      ------LITGGGTGGHIYPALSIARALTEQDPEAELL-------YVGTRTGREAAIVPQAGIA----FAV
MURG_STRE4      -----IIFTGGGTAGHVTLNLILIPKFIKDGWEVHYIGDDKGIEHQEKSGLDTFHAIATGKLRRYFSWQN
MURG_STRPZ      -----ILFTGGGTVGHVTLNLILIPKFIKDGWEVHYIGDKNGIEHTEKSGLDTFHAIATGKLRRYFSWQN
MURG_STRPM      -----ILFTGGGTVGHVTLNLILIPKFIKDGWEVHYIGDKNGIEHTEKSGLDTFHAIATGKLRRYFSWQN
MURG_STRP8      -----ILFTGGGTVGHVTLNLILIPKFIKDGWEVHYIGDKNGIEHTEKSGLDTFHAIATGKLRRYFSWQN
MURG_STRP1      -----ILFTGGGTVGHVTLNLILIPKFIKDGWEVHYIGDKNGIEHTEKSGLDTFHAIATGKLRRYFSWQN
MURG_STAS1      -----IAFTGGGTVGHVSVNLSLIPTAIEEGYDTFYIGSKNGEMIESQLPSIKYHSISSGKLRRYISWDN
MURG_CLOBL      -----IIMTGGGTAGHVTPNLALVPELKKSGYEIKYIGSXXXXXXXXXXXXXXXYFISSGKLRRYFDLKN
MURG_CLOBK      -----IIMTGGGTAGHVTPNLALVPELKKSGYEIKYIGSXXXXXXXXXXXXXXXYFISSGKLRRYFDLKN
MURG_STRPC      -----ILFTGGGTVGHVTLNLILIPKFIKDGWEVHYIGDKNGIEHTEKSGLDTFHAIATGKLRRYFSWQN
MURG_STRPB      -----ILFTGGGTVGHVTLNLILIPKFIKDGWEVHYIGDKNGIEHTEKSGLDTFHAIATGKLRRYFSWQN
MURG_CLOBJ      -----IIMTGGGTAGHVTPNLALVPELKKLGYEIKYIGSXXXXXXXXXXXXXXXYFISSGKLRRYFDLKN
MURG_CLOBH      -----IIMTGGGTAGHVTPNLALVPELKKLGYEIKYIGSXXXXXXXXXXXXXXXYFISSGKLRRYFDLKN
MURG_CLOB1      -----IIMTGGGTAGHVTPNLALVPELKKLGYEIKYIGSXXXXXXXXXXXXXXXYFISSGKLRRYFDLKN
MURG_TREPS      ----------------------------------------------------------------------
MURG_TREPA      ----------------------------------------------------------------------
MURG_ARTAT      -----VVLAGGGTAGHVSPLLAIADAIREKRPEAAILTPSGMETRLVPAAGYELATIDRVPFPRRPSADL
MURG_STRPF      -----ILFTGGGTVGHVTLNLILIPKFIKDGWEVHYIGDKNGIEHTEKSGLDTFHAIATGKLRRYFSWQN
MURG_RUBXD      ----------------------------------------------------------------------
MURG_STAES      -----IAYTGGGTVGHVSVNLSLIPTSIEKGHEAFYIGSKHGEMIESQLPDIQYYPISSGKLRRYLSFEN
MURG_STAEQ      -----IAYTGGGTVGHVSVNLSLIPTSIEKGHEAFYIGSKHGEMIESQLPDIQYYPISSGKLRRYLSFEN
MURG_STRSY      ------------------------------GWEVHYIGDGNGIEHEQVVKSGDVHFHSIATGKLRRYFSF
MURG_STRS2      ------------------------------GWEVHYIGDGNGIEHEQVVKSGDVHFHSIATGKLRRYFSF
MURG_STRPI      ------------------------------GWEVHYIGDKRGIEHQEILKSGTFHSIATGKLRRYFSWQN
MURG_STRZP      ------------------------------GWEVHYIGDKRGIEHQEILKSGLDVTFHSIATGKQNMLDV
MURG_STRP4      ------------------------------GWEVHYIGDKRGIEHQEILKSGLDVTFHSIATGKQNMLDV
MURG_STRZT      ------------------------------GWEVHYIGDKRGIEHQEILKSGTFHSIATGKLRRYFSWQN
MURG_STRP7      ------------------------------GWEVHYIGDKRGIEHQEILKSGTFHSIATGKLRRYFSWQN
MURG_STRPN      ----------------------------------------------------------------------
MURG_STRA5      ----------------------------------------------------------------------
MURG_STRA3      ----------------------------------------------------------------------
MURG_STRA1      ----------------------------------------------------------------------
MURG_THEM4      -----IAVAGGVTGGHLYPALATLNELKITPIDVFTVKGKLEEKVLKDYNFKTVSLDVKGLIRPLYSFGN
MURG_STRR6      ------------------------------GWEVHYIGDKRGIEHQEILKSGTFHSIATGKLRRYFSWQN
MURG_STRP2      ------------------------------GWEVHYIGDKRGIEHQEILKSGTFHSIATGKLRRYFSWQN
MURG_STRZJ      ------------------------------GWEVHYIGDKRGIEHQEILKSGTFHSIATGKLRRYFSWQN
MURG_STRTD      ----------------------------------------------------------------------
MURG_STRT2      ----------------------------------------------------------------------
MURG_STRT1      ----------------------------------------------------------------------
MURG_STRSV      ------------------------------GWQVHYVGDKHGIEYQEKSGLDTFHSVATGKLRRYFSWQN
MURG_STRPS      ------------------------------GWEVHYIGDKRGIEHQEILKSGTFHSIATGKLRRYFSWQN
MURG_STRPJ      ------------------------------GWEVHYIGDKRGIEHQEILKSGTFHSIATGKLRRYFSWQN
MURG_MYCBT      -----VVLAGGGTAGHVEXXXXXXXXXXXXXXRVRITTPRGLETRLVPQRGYHLELITAVPMPRKPGGDL
MURG_MYCBP      -----VVLAGGGTAGHVEXXXXXXXXXXXXXXRVRITTPRGLETRLVPQRGYHLELITAVPMPRKPGGDL
MURG_MYCBO      -----VVLAGGGTAGHVEXXXXXXXXXXXXXXRVRITTPRGLETRLVPQRGYHLELITAVPMPRKPGGDL
MURG_NOCFA      -----VIVAGGGTAGHIEXXXXXXXXXXXXXXXIRVTTERGLETRLVPERGYPLELIPPVPLPRKPTVDL
MURG_MYCTU      ----------------------------------------------------------------------
MURG_MYCTA      ----------------------------------------------------------------------
MURG_LEGPC      -----IVFTGGGTAGHVTPNIALIKEFRKEGWNVEYIGSVSGIEKEMIEPMDPFHGVSSGKLRRYFSLKN
MURG_CAMFF      ----MIAITGGGTGGHXXXXXXXXXXXXNRGENVIFIGSNSGQDRMWFEHSDIFYFFPSRGVVNKKGIHK
MURG_TREDE      ---------------HIFPAEALSSSLEAKGVDRKIVESS--ELYSASPSVLEFIGIPAGKLRRYFSFQN
MURG_ARTS2      -----VVLAGGGTAGHISPLLAIAAALRDVRPDVRLLTPSGMETRLVPAAGLELATISRVXXXXXXXXXX
MURG_RHOSR      -----VIVAGGGTAGHIEPALAVADAIKARGLETTLVPERG-------YP---LELIPPVPLPRKPTLDL
MURG_SYNP6      -----LLFAASGTGGHXXXXXXXXXXXXXXKIDWLGVPDRLETQLVGRYPLHTIRVGGFQGSWLLRPLTA
MURG_SYNE7      -----LLFAASGTGGHXXXXXXXXXXXXXXKIDWLGVPDRLETQLVGRYPLHTIRVGGFQGSWLLRPLTA
MURG_BORHD      ----------------------------------------------------------------------
MURG_LEGPL      -----IVFTGGGTAGHVTPNIALIKEFRKEGWNVEYIGSVSGIEKEMIEPLDPFHGVSSGKLRRYFSLKN
MURG_LEGPH      -----IVFTGGGTAGHVTPNIALIKEFRKEGWNVEYIGSVSGIEKEMIEPLDPFHGVSSGKLRRYFSLKN
MURG_LEGPA      -----IVFTGGGTAGHVTPNIALIKEFRKEGWNVEYIGSVSGIEKEMIEPLDPFHGVSSGKLRRYFSLKN
MURG_BORT9      ----------------------------------------------------------------------
MURG_BORAP      ----------------------------------------------------------------------
MURG_BORGA      ---------------HVFPGISIIQKLKELDNEIEFFWIGKKNSIEEKLIKEQNNIVPCGKLRRYFSFQN
MURG_CLAM3      ----VYLLAGGGTAGHVNPLLAVADELRARGSTI-LVLGTREGLESRLVPARELLTIARLPFPRRPDXXX
MURG_RHOOB      ----------------------------------------------------------------------
ALG13_DEBHA     ----------------------------------------------------------------------
LNT_GEOSL       --------------------------------------------YLALYPAATAYVVRR---GEDRGISA
LNT_GEOMG       --------------------------------------------YLALYPAVVAYLVRR---GEERGISL


                         .         .         *         .         .         .         .:140
query           VRSLWKLWVGLRTARRLVTKLKPVAVVGFGGYPTVPPLLASTGLGVPSIIHEQNAVMGRANKALAARVKA
MURG_AGRT5      VRSLWKLWVGLRTARRLVTKLKPVAVVGFGGYPTVPPLLASTGLGVPSIIHEQNAVMGRANKALAARVKA
MURG_RHIEC      ARSLWTLWSGMRAAKRLIQRLKPVIVVGFGGYPTVPPLLAATRLGVASMLHEQNAVMGRANKALAPRVKA
MURG_RHIL3      ARSLWTLWSGMRAAKKLIQRLQPVIVVGFGGYPTVPPLLAATRLGVPSMIHEQNAVMGRANKALATRVQA
MURG_RHIE6      ARSLWTLWSGMRAAKKLIQRLKPVIVVGFGGYPTVPPLLAATRLGIASMLHEQNAVMGRANKALAPRVKA
MURG_RHISN      AQSVWKLWTGLRAARRLIARYKPRAVVGFGGYPTVPPLLAATGMGVPSLIHEQNAVMGRANKMLASRVQA
MURG_RHILW      ARSLWTLWSGMRAAKKLIQRLKPVIVVGFGGYPTVPPLLAATRLGVPTMIHEQNAVMGRANKALATRVQG
MURG_AGRRK      ARSLWTLWTGIRAARKLIRTIKPLCVVGFGGYPTVPPLLAATRMGVPAMIHEQNAVMGRANKALAARVQA
MURG_SINMW      ARSAWKLWTGLRAARRLISRLKPMAVVGFGGYPTVPPLLAATGMGVPTIIHEQNAVMGRANKMLASRVAA
MURG_AGRVS      AKALLTLWRGYRAARSLIAGLKPLVVIGFGGYPTIPPLLAARALGVATVIHEQNAVMGRANRFLAPRVKA
MURG_RHIME      ARSVWKLWTGXXXXXXXXXXXXXXXVVGFGGYPTVPPLLAATGMGIPSIIHEQNAVMGRANKMLASRVKA
MURG_BRUSU      LKTFWSLWQGNLDSRKLFRRLKPKLVVGFGGYPTLPPLYAASNMGIPTLIHEQNAVMGRANKGLAGRVKA
MURG_RHILO      LGAFWKIWRGVRQASTIIGRIKPDAVVGFGGYPTLPPLYAATRRKVPTLIHEQNAVMGRANRALAGRVDA
MURG_BRUSI      LKTFWSLWQGNLDSRKLFRRLKPKLVVGFGGYPTLPPLYAASNMGIPTLIHEQNAVMGRANKGLAGRVKA
MURG_BRUO2      LKTFWSLWQGNLDSRKLFRRLKPKLVVGFGGYPTLPPLYAASNMGIPTLIHEQNAVMGRANKGLAGRVKA
MURG_BRUC2      LKTFWSLWQGNLDSRKLFRRLKPKLVVGFGGYPTLPPLYAASNMGIPTLIHEQNAVMGRANKGLAGRVKA
MURG_BRUAB      LKTFWSLWQGNLDSRKLFRRLKPKLVVGFGGYPTLPPLYAASNMGIPTLIHEQNAVMGRANKGLAGRVKA
MURG_BRUA2      LKTFWSLWQGNLDSRKLFRRLKPKLVVGFGGYPTLPPLYAASNMGIPTLIHEQNAVMGRANKGLAGRVKA
MURG_BRUA1      LKTFWSLWQGNLDSRKLFRRLKPKLVVGFGGYPTLPPLYAASNMGIPTLIHEQNAVMGRANKGLAGRVKA
MURG_BRUME      LKTFWSLWQGNLDSRKLFRRLKPKLVVGFGGYPTLPPLYAASNMGIPTLIHEQNAVMGRANKGLAGRVKA
MURG_BRUMB      LKTFWSLWQGNLDSRKLFRRLKPKLVVGFGGYPTLPPLYAASNMGIPTLIHEQNAVMGRANKGLAGRVKA
MURG_MESSB      LKSGLSIWRGFKQSTALINRLKPAAVVGFGGYPTLPPLYAATRRQVPTLVHEQNAVMGRANKALAPRVTA
MURG_OCHA4      LKTFWSLWQGNLDSRKLFRRLKPKLVAGFGGYPTLPPLYAASNMNIPTMVHEQNAVMGRANKGLAGRVKA
MURG_BART1      IKTILSLLKGMGQSLRLFYKLRPVLVGGFGGYPSFPPLFIAVLMRRVTFIHEQNAVMGRANRVLAIFVRA
MURG_BARHE      IKTFWMLLKGMGQSLALFYKLCPVLVGGFGGYPTFPPLIVAAFMRRVTFIHEQNAVMGRANRVLAVFVSA
MURG_BARBK      IKTFWLLLRGMVQSWILFRKLRPVLVGGFGGYPTVPPVWVAALTGRVTFIHEQNAVMGRANRVLATRVNA
MURG_BARQU      IKTCWILLKGMGQSLALFYKLRPVLVGGFGGYPTFPPLLVAALMRCVTFIHEQNAIMGRANRVLAVFVHA
MURG_NITHX      ARTGLMLATGTVVALNLMRRLKPAAVIGFGGYPTLPPLIAARLKGIPTVIHDANAVMGRANRLLSRRVNA
MURG_BRASO      XXXXXXXXXXXXXXFNLMRRLKPAAVIGFGGYPTVPPLLAARLAGVPSLIHDANAVLGRANRFLSAHVKA
MURG_METPB      AGAVLTLGRGFGQAARAVRRLNPAAVVGFGGYPTVPPMLAAQLLRVPTILHEQNAVMGRANGFLAKGAQV
MURG_RHOPA      AKTALKLGSGALLAFNLIGRLKPAAVVGFGGYPTLPPLLAATWRRVPTLIHEQNAVMGRANRFLAPRVDA
MURG_METRJ      AGAVLTLGRGFGVAAKEIRRINPAAIVGFGGYPTVPPVLAGQILRVPTILHEQNAVMGRANAFLARGART
MURG_METC4      AGAVVTLGRGFGQAARAVRRLNPAAVVGFGGYPTVPPMLAAQLLRVPTILHEQNAVMGRANGFLAKGARV
MURG_METEP      AGAVVTLGRGFGQAARAVRRLNPAAVVGFGGYPTVPPMLAAQLLRVPTILHEQNAVMGRANGFLAKGARV
MURG_RHOP2      ARTGLMLGAGTAKALALMLRLKPAAVVGFGGYPTLPPLFAARALRIPTLIHDSNAVMGRANRLLSKGVTA
MURG_ERYLH      VGGLRAVWKGREMAKRLFESFQPSAVVGFGGYPALPAMLAASREDIPSIIHEQNAVLGRVNRLQAGRVSA
MURG_RHOPS      ARTGVMLGAGTALAIGLMMRLRPAAVIGFGGYPTLPPLFAARALRIPTLIHDANAVMGRANRLLSRRVSA
MURG_BRASB      XXXXXXXXXXXXXXFNLMRRLKPAAVIGFGGYPTVPPLLAARLAGVPSLIHDANAVLGRANRFLSAHVKA
MURG_PARDP      LAVPFRIGAGVLAAIRAMRADRPAVVVGFGGYPTIPAMSAALVLRIPRMIHEQNGIMGRVNMAFARRVDR
MURG_BRAJA      XXXXXXXXXXXXXXXXXIKRLKPVAVVGFGGYPTLPPLVAAKFAGVPGIIHDANAVLGRANRFLSSRVRA
MURG_NITWN      ARTGLMLAAGTAVALNLMRVLKPAAVVGFGGYPTLPPLIAARLRGIPTVIHDSNAVMGRANSFLSKRVNA
MURG_METS4      GAAFLTLGRGFAAAIRAVRRLNPAVVVGFGGYPTVPPLLAAQMLRVPTLLHEQNAVMGRANGFLARGASV
MURG_RHOP5      ARTGAMLGAGTLKALTLMWRLKPAAVIGFGGYPTLPPLIAARLMKIPTLVHDSNAVMGRANRFLSAHVTA
MURG_RHOPB      ARTALKLGTGTLMALSLMLRLKPAAVIGFGGYPTLPPLLAARMFGIPTLVHDSNAVMGRANRFLSHKVTA
MURG_RHORT      XXXMIELAMGSLQAYGLLRRLRPDVVVGFGGYASVPTMLAAIRLKLPTVVHEQNAVPGRANRLLAARVSR
MURG_RHOCS      ARTALELGIGTLQARRLLSRLEPAIVVGFGGYPSFPAVYAAAGLRIPVAIHEQNAVMGXXXXXXXXXXXX
MURG_MAGSA      LRSALELGLGLIQARSILGRIRPAAVIGFGGYASVPGMGAAALAGIPTAIHEQNAVLGRANRLLAGHVRR
MURG_ZYMMO      MRNIW---AGRERALTLYENFTPAAVVGFGGYXXXXXXXXXFKAKIPTVIHEQNAVMGRTNRFLAGRVDA
MURG_ROSDO      IVAPFKIGAGVLRALLSFRRDRPAVVVGFGGYPTIPALAAAFLMKLPRMIHEQNGVLGRVNTAFASRVDA
MURG_JANSC      LAVPFRIFGGVLTATARMLREKPDVVVGFGGYPTIPAMAAARLTGRPRMLHEQNGVLGRVNRVFAKHVAH
MURG_RHOS4      ALVPLRIAGGVASAVAGFLRDRPSVVVGFGGYPSIPALSAAVALRLPRMIHEQNGVLGRVNRLFAPRVQA
MURG_RHOS1      ALVPLRIAGGVASAVAGFLRDRPSVVVGFGGYPSIPALSAAVALRLPRMIHEQNGVLGRVNRLFAPRVQA
MURG_MARMM      ARAALELTQGFAQARSIVGKWKPDVIAGFGGYPAFPALAVARSMGIAFAIHEQNAVLGRVNRVFAAKAGF
MURG_RHOS5      ALVPARIAAGVASAVVGFLRDRPAVVVGFGGYPSIPALSAAVALRLPRMIHEQNGVLGRVNRLFAPRVDA
MURG_PHEZH      MRAGFAVLRGAMHARAAFREIGPDVVVGFGGYPSAPALVAAILDRRPTVIHEQNAVMGRTNRILAPHVRT
MURG_NOVAD      FKGLRAIWQGRAMALRLFESFEPSCVIGFGGYXXXXXXXXXXXXRIPTVIHEQNAVLGRVNRLLAKRVDA
MURG_GRABC      XXXXXXLGHGVVKAGALLRRLEAGCIVGFGGYPCIPPVLGARARNVPVILHEQNAVLGRANRLLARKIHC
MURG_SPHAL      LKGALAIRKGRRMAIELIDDFDPAVVVGFGGYPSLPSLLAAGATKRPRVIHEQNAVLGRVNRLMAPRVDA
MURG_SILST      AMVAPRIAAGVASMAMQMRRDRPDVVIGFGGYPSIPXXXXXXXXXXPRMIHEQNGVLGKVNQKFATRVAE
MURG_METNO      GAALVTLGRGFAAALRVVRRLNPAVAVGFGGYPTVPPLLAAQMLRVPTLLHEQNAVMGRANAFLARGATV
MURG_SILPO      XXXXXXXXXXXXXXXWEMRRDRPDVVVGFGGYPSIPALGAATLLRLPRMIHEQNGVLGRVNQLFARRVAC
MURG_GLUOX      VHGVLALLRGMMEARRILASLDAAAVVGFGGYPSIPPLTASRLL--PSVIHEGNAVLGQANAFLSRFSPL
MURG_CAUCR      IKAGFVVLQGVMEARAAFKRLDPAVVVXXXXXXXXXXXXXXXSQGRPTVIHEQNAVLGRVNRFLAPRVNE
MURG_CAUCN      IKAGFVVLQGVMEARAAFKRLDPAVVVXXXXXXXXXXXXXXXSQGRPTVIHEQNAVLGRVNRFLAPRVNE
MURG_RICBR      XXXXXXXXXAIFKAIKLLFSLSPSAVVGFGGYPVVASMFAAIFLRVPIVIHEQNSYLGKVNRFFANFAKK
MURG_RICB8      XXXXXXXXXAIFKAIKLLFSLSPSAVVGFGGYPVVASMFAAIFLRVPIVIHEQNSYLGKVNRFFANFAKK
MURG_HYPNA      PGAALKINAGIARARRLMKQHRPALVXXXXXXXXXXXXXXXXXXXVPIIIHEQNAVLGRVNRQFAKHAQL
MURG_ACICJ      XXXVAQLARGTVAARHILAKLDAAAVVGFGGYPSVPPVLAAATLRRPAIVHDQNAVLGGANRFLARFADH
MURG_RICRS      FLFLPRLSIAVLKAIKLLYNMKPSVTVGFGGYPVIAPMFAAIFLRVPIIIHEQNSYLGKVNKFFASFAKK
MURG_RICRO      FLFLPRLSIAVLKAIKLLYNMKPSVTVGFGGYPVIAPMFAAIFLRVPIIIHEQNSYLGKVNKFFASFAKK
MURG_ORITB      LYAYIRILAACITGFKLVYSNSPSLIVAFGGYTIAPIIINGILFRIPFILHEQNSVLGLANRLFLRYAKA
MURG_RICPU      FLFLPRLSIAVLKAIKLLYNMKPSVTVGFGGYPVIAPMFAAIFLRVPIIIHEQNSYLGKVNKFFASFAKK
MURG_RICAE      FLFLPRLSIAVLKAIKLLYNMKPSVTVGFGGYPVIAPMFAAIFLRVPIIIHEQNSYLGKVNKFFASFAKK
MURG_RICCK      FLFLPRLSIAVLKAIRLLYNIKPSVIVGFGGYPVISSMFAAVFLRVPIIIHEQNSYLGKVNKFFTSFAKK
MURG_ORITI      LYAYIRILAACITGFKLVYSNSPGLIVTFGGYTIAPIIINGILFKIPFILHEQNSVLGLANRLFLRYAKA
MURG_RICAH      FLFLPNLSXXXXXXXXXXYNIRSSAIIGFGSYPVISSMFAAVFLRVPIIIHEQNSYLGKVNKFFASFAKR
MURG_RICM5      FLFLPRLSIAVLKAIKLLYNMKSAVTVGFGGYPVIAPMFAAIFLRVPIIIHEQNSYLGKVNKFFASFAKK
MURG_WOLWR      --NKFKFFLFLIYSSMLVRKLKPKSVIGFGSYASFPTLLAARVLSIPIILHEQNTVLGRVNRFFFKSAKL
MURG_WOLPM      --NKFKFFLFLIYSSMLVRKLKPKSVIGFGSYASFPTLLAARVLSIPIILHEQNTVLGRVNRFFFKSAKL
MURG_RICFE      FLFLPNLSXXXXXXXXXXYNIRSSVIIGFGGYPVIAPMFAAIFLRVPIIIYEQNSYLGKVNKFFASFAKK
MURG_RICCN      FLFLPRLSIAVLKAIKLLYNMKPSVTVGFGGYPVIAPMFAAIFLRVPIIIHEQNSYLGKVNKFFXXXXXX
MURG_RICPR      FLFLPILSITFLKSIRLIYNIKCCVIIGFGGYPVIAPMFAAIFLRIPIIIHEQNSYLGKVNKFFARFAKK
MURG_ANAMM      LKFCALLAYSCVLSYIKLRSLKPDLVIGFGAYASFPVLLSAWLMSVDAVLHEQNSVMGRVNRVFAGYARV
MURG_WOLTR      LLLIYSCVLALYQIR----KLKPKLVIGFGGYASFPTLLAAKVLSIPIILHEQNAVLGRVNKFFFNSAEL
MURG_WOLPP      LKFLFLLMYSCVLALYQTRKLKPKLIIGFGSYASFPTLLAAKILSIPIVLHEQNTVLGRVNRFFFKSAKL
MURG_MAGSM      LRTLGGLLPAVWQARGMVQRFDPHVVLGVGGYASAPAMVAARSLGIPMALHEQNARAGLTNRLLSHLAQQ
MURG_RHOFD      VRLPWRLLRACWQSVALLRRVQPDVVLGLGGYITLPAGLMSVLLGKALILHEQNSVAGMANKVLARFATR
MURG_GEOMG      AKGLAKFLYGYAQSRKILKEFKPDLVLGVGGYASAPALLAARGMHIPRFIHEQNAIPGFTNKMLATVAER
MURG_GEOSL      AKGLAKFLYGYAQSRKILKEFRPDLVLGVGGYASAPTLMAARGMQIPRFIHEQNAIPGFTNRMLAKVADK
MURG_PSEAE      VKAPLELLKSLFQALRVIRQLRPVCVXXXXXXXXXXXXXAARLNGVPLVIHEQNAVAGTANRSLAPIARR
MURG_PSEAB      VKAPLELLKSLFQALRVIRQLRPVCVXXXXXXXXXXXXXAARLNGVPLVIHEQNAVAGTANRSLAPIARR
MURG_PSEA8      VKAPLELLKSLFQALRVIRQLRPVCVXXXXXXXXXXXXXAARLNGVPLVIHEQNAVAGTANRSLAPIARR
MURG_PSEA7      VKAPLELLKSLFQALRVIRQLRPVCVXXXXXXXXXXXXXAARLNGVPLVIHEQNAVAGTANRSLAPIARR
MURG_GEOUR      IRSAAQLLYGYAQSRRILKEFRPDLVLGVGGYASAPVVLAARGMQIRRFIHEQNAIPGLTNKLLARFAEK
MURG_GEOLS      LKGAAMMIYGYAQSRKILHRFQPDLVLGVGGYASLPMVMAARGMEIPRYIHEQNALPGMSNKVLSRVANK
MURG_RICTY      XXXXXXXXXXXXKSIKLIYHIKSCVIIGFGGYPVIAPMFAAIFLRIPIIIHEQNSYLGKVNKFFARFAKK
MURG_NITMU      XXXXXXXXXXFWQSARVIRKVRPDVVLGMGGYPAFPGGMMASLLARPLLIHEQNSIPGLANRILSRLADR
MURG_PSEMY      XXAPFQLLRSLLQARRIVRELQPVCVLGMGGYVTGPGGLAARLAGVPLVIHEQNAVAGTANRLLSRIATR
MURG_POLNA      XXXXXXXXKAFWQSVQVIRRVKPDVVVGLGGYIAFPAGMMSVLLGKPLVLHEQNSVAGMVNKVLASVADR
MURG_DESAD      FSSLW-IVSAMIMALKEIASFKPDAVIGFGGYAGFCPVLAAWLLGVPTAIHEQNSVPGVTNRILGKVVKR
MURG_PSEU5      IKAPLQLVRSLFQARRIIRELRPVCVXXXXXXXXXXXXXAAKLAGVPLVIHEQNAVAGTANRSLVPLASR
MURG_THICR      PFNVFKAW---RQARYIIQQEAPDLVLGMGGFVCGPGGLAALSLNKPLVLHEQNATPGLTNKLLAPFAKK
MURG_ALTMD      IQGAVALVKSLFSARRIIKRLQPDIVVGFGGYASGPGGVAAKSLGIPVIVHEQNAAAGMTNKLLSKLASR
MURG_NITEU      LLLPWRLAQACWQSFRILRRQQPQVVLGMGGYPALPGGIMAVLLGKPLLIHEQNRIAGLTNKILAKIADR
MURG_GEOSM      IMSAGRLLYGYSQSRKILKEFRPDLVLGVGGYASAPIVLAARGMGVRRFIHEQNAFPGLTNKVLGRIVDG
MURG_PELPD      XXXXXMMFNGYRQSCRLLDRFRPDAVLGVGGYASLPMLLAARTRQVPSFIHEQNAVPGMTNRLLSRFADR
MURG_JANMA      ITGAFKLVASFATCFSILKRRNPGIVLGMGGYVTVPGGWMAKLRGXXXXXXXXXXXXXXSNKTLMPVAER
MURG_AERS4      VKSVLQ-------ARRVLKTIRPDVVLGMGGFASGPGGVAAWLSGIPLLLHEQNAAAGLTNKLLARLAKR
MURG_SHEB2      LAAPFKVVRSILQAKAVIAEFKPDVVLGMGGFASGPGGVAARLAGIPLVLHEQNAIPGMTNKLLSRIATQ
MURG_RALEH      LRAFWQSIAALR-------RVRPSVVLGMGGYITFPAGMMASLLGRPLVLHEQNSIAGLANKVLAKVADR
MURG_IDILO      PFTLAK---AVLQCRRLLKTLQPQVVATFGGYVCAPMGLAAKLLGIPLVVHEQNAIPGMTTRLLAPRANK
MURG_GEOBB      IMSAGRLLYGYSQSRKILKEFRPDLVLGVGGYASAPIVLAARGMGIRRFIHEQNAFPGLTNKVLGRFVDG
MURG_AZOSE      XXXXXXFWQALGELRRI----RPDVVLGMGGYVTFPGGMMAALLGRPLVVHEQNSVAGLANRVLAGVADR
MURG_SHEB5      LAAPFKVVRSILQAKAVIAEFKPDVVLGMGGFASGPGGVAARLAGIPLVLHEQNAIPGMTNKLLSRIATQ
MURG_PSEPF      LKSVWQ-------ARAIIRRLRPVCXXXXXXXXXXXXXLAAKLAGVPVIVHEQNAVAGTANRLLVPFAAR
MURG_RALEJ      LRAFWQSLGALR-------RVRPSVVLGMGGYITFPAGMMASLLGRPLVLHEQNSIAGLANKVLAKVADR
MURG_PSYIN      IKSIWQ-------ARSVLKKRRVDLVLGMGGFASGPGGIAAWSMGIPVILHEQNAVAGLTNRILSLFSKR
MURG_SHEB9      LAAPFKVVRSILQAKAVIAEFKPDVVLGMGGFASGPGGVAARLAGIPLVLHEQNAIPGMTNKLLSRIATQ
MURG_SHEB8      LAAPFKVVRSILQAKAVIAEFKPDVVLGMGGFASGPGGVAARLAGIPLVLHEQNAIPGMTNKLLSRIATQ
MURG_AERHH      VKSVLQ-------ARRVLKTIRPDVVLGMGGFASGPGGVAAWLSGIPLLLHEQNAAAGLTNKLLARLAKR
MURG_PSEPW      XXAPFTLVKAVLQARRIIGQLKPVCXXXXXXXXXXXXXXAARLCGVPLVIHEQNARAGTANRLLVPLSAR
MURG_SHEWM      VRKLFKVLRSITQARVVIKEFQPDVVLGMGGFASGPGGVAARLSGIPLVLHEQNAIPGMTNKILSRIASQ
MURG_PSEF5      XXAPFVLIKAVLQARRVIRQLKPVCXXXXXXXXXXXXXXAAKLSGVPVIVHEQNAVAGTANRLLVPLAAR
MURG_PSEP1      XXAPFTLVKAVLQARRIIRQLKPVCXXXXXXXXXXXXXXAARLCGVPLVIHEQNARAGTANRLLVPLSAR
MURG_SHESW      LAAPFKVIRSILQAKAVIAEFKPDVVLGMGGFASGPGGVAARLAGIPLVLHEQNAIPGMTNKLLSRIATQ
MURG_SHEPC      LAAPFKVIRSILQAKAVIAEFKPDVVLGMGGFASGPGGVAARLAGIPLVLHEQNAIPGMTNKLLSRIATQ
MURG_SHEON      LAAPFKVVRSILQAKAVIAEFKPDVVLGMGGFASGPGGVAAKLAGVPLVLHEQNAIPGMTNKLLSRIASQ
MURG_SHESR      LAAPFKVVRSILQAKAVIAEFKPDVVLGMGGFASGPGGVAAKLAGVPLVLHEQNAIPGMTNKLLSRIANQ
MURG_SHESA      LAAPFKVVRSILQAKAVIAEFKPDVVLGMGGFASGPGGVAAKLAGVPLVLHEQNAIPGMTNKLLSRIANQ
MURG_SHESM      LAAPFKVVRSILQAKAVIAEFKPDVVLGMGGFASGPGGVAAKLAGVPLVLHEQNAIPGMTNKLLSRIANQ
MURG_SHELP      LAAPFKILRSIMQAREVIKEFKPHVVLGMGGFASGPGGVAAKLSGIPLVLHEQNAIPGMTNKLLS----R
MURG_SHEAM      LAAPFKVLRSVMQARKVIREFKPDVVLGMGGFASGPGGVAAKLCGIPLVLHEQNAIPGMTNKLLS----R
MURG_RALSO      LRAFWQ-------SLGVVRRVRPNVVLGMGGYITFPGGMMSVLLGAPLVLHEQNSIAGLANRVLARRVLC
MURG_PSEPK      XXAPFTLVKAVLQARRIIRQLKPVCXXXXXXXXXXXXXXAARLCGVPLVIHEQNARAGTANRLLVPLSAR
MURG_COXBU      LLMPLRLVRAVFQAYRIIRQFKPDVILGMGGYVAGPGGLAAWITRTPLIIHEQNSIPGLTNRVLAKMAKF
MURG_COXBR      LLMPLRLVRAVFQAYRIIRQFKPDVILGMGGYVAGPGGLAAWITRTPLIIHEQNSIPGLTNRVLAKMAKF
MURG_COXBN      LLMPLRLVRAVFQAYRIIRQFKPDVILGMGGYVAGPGGLAAWITRTPLIIHEQNSIPGLTNRVLAKMAKF
MURG_COXB2      LLMPLRLVRAVFQAYRIIRQFKPDVILGMGGYVAGPGGLAAWITRTPLIIHEQNSIPGLTNRVLAKMAKF
MURG_COXB1      LLMPLRLVRAVFQAYRIIRQFKPDVILGMGGYVAGPGGLAAWITRTPLIIHEQNSIPGLTNRVLAKMAKF
MURG_METCA      AKAPAMLGLACLQALRILRRRKPDAVLGMGGFVAGPGGLMARVLGIPLIIHEQNRIPGTTNRWLSRIANR
MURG_MARAV      MRALGEAYTHLR-------RIRPDCXXXXXXXXXXXXXIAAWLMRKPLVIHEQNAIAGMTNRWLTRFSET
MURG_BURVG      LRACWQSLGALR-------RVRPDVVLGMGGYITFPAGVMTALSGRPLVLHEQNSIAGLANKVLAKFAKR
MURG_BLOPB      IMPLF-ICLAIYQARKIIKYWKPDIVLGMGGYVSGPGGLAAWTCGVPLIIHEQNRIIGLTNRYLSIFSKK
MURG_SERP5      LSAPLRIWHAVRQAKAIMRNYQPDVVLGMGGYVSGPGGLAAWLCGIPVVLHEQNGIAGLTNRWLARIAKT
MURG_ECOHS      IAAPLRIFNAWRQARAIMKAYKPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNKWLA----K
MURG_BURCM      LRACWQSLGALR-------RVRPDVVLGMGGYITFPAGVMAALSGRPLVLHEQNSIAGLANKVLAKFAKR
MURG_BURA4      LRACWQSLGALR-------RVRPDVVLGMGGYITFPAGVMAALSGRPLVLHEQNSIAGLANKVLAKFAKR
MURG_SYNAS      SLALLKLPGSLMQSMKIIRDFRPDVVIGVGGYASGPAVMAAHLMGIKTAIAEQNSIPGLTNRILGRFVDR
MURG_PSEFS      XXAPFVLLKAVWQARKVIRDVQPVCXXXXXXXXXXXXXXAAKLAGVPVIVHEQNAVAGTANRLLVPLAAR
MURG_SHESH      LAAPFKVIRSIMQAQAVIKEFKPDVVLGMGGFASGPGGVAARLSGLPLVLHEQNAIPGMTNKILARIASQ
MURG_SHIDS      IAAPLRIFNAWRQARAIMKAYKPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNKWLA----K
MURG_BURP0      FALPFNLLRACAQSLRALRRVKPDVVLGMGGYITFPAGLVTVLTGRPLVLHEQNSIAGLTNKVLAKLAKR
MURG_POLSJ      XXXXXXXXKAFWQSIQXXXXXXXXXXXGLGGYIAFPAGMMSVLLGKPLVLHEQNSVAGMVNKVLAGVADR
MURG_GEOSF      VKSAALLLYGYSQSRKILKEFRPDVVLGVGGYASAPVVLSARGLQIRRFIHEQNAIPGLTNKVLARIADK
MURG_SHISS      IAAPLRIFNAWRQARAIMKAYKPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNKWLA----K
MURG_SHIFL      IAAPLRIFNAWRQARAIMKAYKPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNKWLA----K
MURG_SHIF8      IAAPLRIFNAWRQARAIMKAYKPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNKWLA----K
MURG_SHIBS      IAAPLRIFNAWRQARAIMKAYKPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNKWLA----K
MURG_PSEE4      XXAPFTLVKAVLQARRIVRELKPVCXXXXXXXXXXXXXXAARLCGVPLVIHEQNARAGTANRLLVPLAAR
MURG_ECOUT      IAAPLRIFNAWRQARAIMKAYKPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNKWLA----K
MURG_ECOSM      IAAPLRIFNAWRQARAIMKAYKPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNKWLA----K
MURG_ECOSE      IAAPLRIFNAWRQARAIMKAYKPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNKWLA----K
MURG_ECOLU      IAAPLRIFNAWRQARAIMKAYKPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNKWLA----K
MURG_ECOLI      IAAPLRIFNAWRQARAIMKAYKPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNKWLA----K
MURG_ECOLC      IAAPLRIFNAWRQARAIMKAYKPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNKWLA----K
MURG_ECOL6      IAAPLRIFNAWRQARAIMKAYKPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNKWLA----K
MURG_ECOL5      IAAPLRIFNAWRQARAIMKAYKPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNKWLA----K
MURG_ECOK1      IAAPLRIFNAWRQARAIMKAYKPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNKWLA----K
MURG_ECODH      IAAPLRIFNAWRQARAIMKAYKPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNKWLA----K
MURG_ECOBW      IAAPLRIFNAWRQARAIMKAYKPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNKWLA----K
MURG_ECO8A      IAAPLRIFNAWRQARAIMKAYKPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNKWLA----K
MURG_ECO81      IAAPLRIFNAWRQARAIMKAYKPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNKWLA----K
MURG_ECO7I      IAAPLRIFNAWRQARAIMKAYKPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNKWLA----K
MURG_ECO5E      IAAPLRIFNAWRQARAIMKAYKPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNKWLA----K
MURG_ECO57      IAAPLRIFNAWRQARAIMKAYKPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNKWLA----K
MURG_ECO45      IAAPLRIFNAWRQARAIMKAYKPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNKWLA----K
MURG_ECO27      IAAPLRIFNAWRQARAIMKAYKPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNKWLA----K
MURG_ECO24      IAAPLRIFNAWRQARAIMKAYKPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNKWLA----K
MURG_COLP3      LVMPFKLLRSLFQARRVIKTVKPDVVIGMGGYASAPGGLAAWLSKIPLIVHEQNAAAGLSNRLLARIANK
MURG_BURPS      VRFGGLRGKGLATSLRALRRVKPDVVLGMGGYITFPAGLVTVLTGRPLVLHEQNSIAGLTNKVLAKLAKR
MURG_BURP6      VRFGGLRGKGLATSLRALRRVKPDVVLGMGGYITFPAGLVTVLTGRPLVLHEQNSIAGLTNKVLAKLAKR
MURG_BURMS      VRFGGLRGKGLATSLRALRRVKPDVVLGMGGYITFPAGLVTVLTGRPLVLHEQNSIAGLTNKVLAKLAKR
MURG_BURMA      VRFGGLRGKGLATSLRALRRVKPDVVLGMGGYITFPAGLVTVLTGRPLVLHEQNSIAGLTNKVLAKLAKR
MURG_BURM9      VRFGGLRGKGLATSLRALRRVKPDVVLGMGGYITFPAGLVTVLTGRPLVLHEQNSIAGLTNKVLAKLAKR
MURG_BURM7      VRFGGLRGKGLATSLRALRRVKPDVVLGMGGYITFPAGLVTVLTGRPLVLHEQNSIAGLTNKVLAKLAKR
MURG_LACF3      VKTVYLFLKAVAQAKKLIKDFRPDVVLGTGGYVSGAVLYAAAKLGVPTVIHEQNSVVGVTNKFLARYVNE
MURG_ECO55      IAAPLRIFNAWRHARAIMKAYKPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNKWLA----K
MURG_BURP1      FALPFNLLRACAQSLRALRRVKPDVVLGMGGYITFPAGLVTVLTGRPLVLHEQNSIAGLTNKVLAKLAKR
MURG_SHIB3      IAAPLRIFNAWRQARAIMKAYKPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNKWLA----K
MURG_BORPA      XXXXXXXXXXCAQAWRRLADIRPDVVLGMGGYVAFPGGVMAALRRMPLVVHEQNAVAGTANRWLARLARR
MURG_BORBR      XXXXXXXXXXCAQAWRRLADIRPDVVLGMGGYVAFPGGVMAALRRTPLVVHEQNAVAGTANRWLARLARR
MURG_SALAR      LAAPLRIFNAWRQARAIMKRFKPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNKWLAKIATT
MURG_METFK      VGATWRAW-------RLMRELQPQAVLGMGGYVTVPGGWAARLAGVPLAIVNADAALLMSNRALVKHAKR
MURG_HAHCH      VRALWQAFSVFR-------KEKPDCVLGMGGFASGPGGIVACLTGTPLVIHEQNAIAGMTNRWLARGARY
MURG_YERE8      LTAPVRIYRAVRQAKKIMRDYQPDVVLGMGGYVSGPGGLAAWLCGIPVVLHEQNGIAGLTNRWLARIAKK
MURG_YERPN      LTAPIRIYRAVRQAQKIMRDYQPNVVLGMGGYVSGPGGLAAWLCGVPVVLHEQNGIAGLTNRWLARIAKK
MURG_YERPG      LTAPIRIYRAVRQAQKIMRDYQPNVVLGMGGYVSGPGGLAAWLCGVPVVLHEQNGIAGLTNRWLARIAKK
MURG_YERPE      LTAPIRIYRAVRQAQKIMRDYQPNVVLGMGGYVSGPGGLAAWLCGVPVVLHEQNGIAGLTNRWLARIAKK
MURG_YERPA      LTAPIRIYRAVRQAQKIMRDYQPNVVLGMGGYVSGPGGLAAWLCGVPVVLHEQNGIAGLTNRWLARIAKK
MURG_ERWCT      LSAPIRIFQAVRQARAIMRRYQPDVVLGMGGYVSGPGGLAAWLCGIPVVLHEQNGIAGLTNRWLSHIAKK
MURG_ANADE      IRAFLQSW-------RILRRWRPDVVVGVGGYASGPVVLTAWAMRIPTAVQEQNAIAGLTNRLLGRVVKA
MURG_SHEVI      LAAPFKVMRSVMQARRVIQEFKPDVVLGMGGFASGPGGIAARLSGIPLVLHEQNAIPGMTNKLLSRIASK
MURG_ANASK      IEXXXXXXXXXXQSWRILKRWRPDVVVGVGGYASGPVVLTAWAMRIPTAVQEQNAIAGLTNRLLGRVVKA
MURG_ANAD2      IEXXXXXXXXXXQSWRILRRWRPDVVVGVGGYASGPVVLTAWAMRIPTAVQEQNAIAGLTNRLLGRVVKA
MURG_SALNS      LAAPLRIFNAWRQARAIMKRFKPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNQWLAKIATT
MURG_SALG2      LAAPLRIFNAWRQARAIMKRFKPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNQWLAKIATT
MURG_SALDC      LAAPLRIFNAWRQARAIMKRFKPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNQWLAKIATT
MURG_SALCH      LAAPLRIFNAWRQARAIMKRFKPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNQWLAKIATT
MURG_PECCP      LSAPIRIFQAVRQARAIMRRYQPDVVLGMGGYVSGPGGLAAWLCGIPVVLHEQNGIAGLTNRWLSHIAKK
MURG_PARUW      LKGVFNLLRGVWQSIRIIRKFKPDVVVGFGSYYTVPPLLAAKILRIPIVLHEANSIPGKANKWLASMAWR
MURG_NEIMF      PVTLYQT---VREAQRIIRKHRVECVIGFGGFVTFPGGLAAKLLGVPIVIHEQNAVAGLSNRHLSRWAKR
MURG_PHOLL      LAAPVRIFKAIRQAKAIMRRYQPDVVLGMGGYVSGPGGIAAWMCGVPVVLHEQNGIAGLTNRWLAKIATT
MURG_NEIMB      PVTLYQT---VREAQRIIRKHRVECVIGFGGFVTFPGGLAAKLLGVPIVIHEQNAVAGLSNRHLSRWAKR
MURG_SALEP      LAAPLRIFNAWRQARAIMKRFKPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNQWLAKIATT
MURG_NEIG2      PFTLYKT---VREAQRIIRKHRVECVIGFGGFVTFPGGLAAKLLGVPIVIHEQNAVAGLSNRHLSRWAKR
MURG_NEIG1      PFTLYKT---VREAQRIIRKHRVECVIGFGGFVTFPGGLAAKLLGVPIVIHEQNAVAGLSNRHLSRWAKR
MURG_ERWT9      LAAPLRIFNAWRQARAIMKAWQPDVVLGMGGYVSGPGGLAAWSCGIPVVLHEQNGIAGLTNKWLA----K
MURG_CITK8      LAAPLRIFNAWRQARAIMKQFKPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNKWLAKIATT
MURG_YERPP      LTAPIRIYRAVRQAQKIMRDYQPNVVLGMGGYVSGPGGLAAWLCGVPVVLHEQNGIAGLTNRWLARIAKK
MURG_SALTY      LAAPLRIFNAWRQARAIMKRFKPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNQWLAKIATT
MURG_SALSV      LAAPLRIFNAWRQARAIMKRFKPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNQWLAKIATT
MURG_SALPK      LAAPLRIFNAWRQARAIMKRFKPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNQWLARIATT
MURG_SALPB      LAAPLRIFNAWRQARAIMKRFKPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNQWLAKIATT
MURG_SALPA      LAAPLRIFNAWRQARAIMKRFKPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNQWLARIATT
MURG_SALHS      LAAPLRIFNAWRQARAIMKRFKPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNQWLAKIATT
MURG_SALA4      LAAPLRIFNAWRQARAIMKRFKPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNQWLAKIATT
MURG_PSE14      XXAPFMLLKALMQAXXXXXXXXXXXXXXXXXXXXXXXXLAAKLAGVPLIIHEQNAVAGTANRSLASFASR
MURG_NEIM0      KRKLFTLYQTVREAQRIIRKHRVECVIGFGGFVTFPGGLAAKLLGVPIVIHEQNAVAGLSNRHLSRWAKR
MURG_HALOH      FSSLLKTGRGFIQARKLLRKFKPDVVIGTGGFVSGPVVLAAALQKIPTVIHEQNAYPGLANRLLAPFVTR
MURG_ESCF3      LAAPLRIFNAWRQARAIMKAFKPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNKWLA----K
MURG_BURCJ      LRACWQSLGALR-------RVRPDVVLGMGGYITFPAGVMTALSGRPLVLHEQNSIAGLTNKVLAKLAKR
MURG_BURCH      LRACWQSLGALR-------RVRPDVVLGMGGYITFPAGVMTALSGRPLVLHEQNSIAGLTNKVLAKLAKR
MURG_BURCA      LRACWQSLGALR-------RVRPDVVLGMGGYITFPAGVMTALSGRPLVLHEQNSIAGLTNKVLAKLAKR
MURG_ANADF      XXXXXXXXX---QSHRILRKWRPDVVVGVGGYASGPVVLVAWLLRIPTAVQEQNAIAGFTNRVLGRFVDA
MURG_PSEPG      XXAPFTLIKAVLQARRIIRQLKPVCXXXXXXXXXXXXXXAARLCGVPLVIHEQNARAGTANRLLVPLSAR
MURG_NEIMA      KRKLFTLYQTVREAQQIIRKHRVECVIGFGGFVTFPGGLAAKLLGVPIVIHEQNAVAGLSNRHLSRWAKR
MURG_BURCC      LRACWQSLGALR-------RVRPDVVLGMGGYITFPAGVMTALSGRPLVLHEQNSIAGLTNKVLAKLAKR
MURG_SALTI      LAAPLRIFNAWRQARAIMKRFKPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNQWLAKIATT
MURG_KLEP3      LLAPVRIFNAWRQARAIMKRFQPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNKWLAKIAKK
MURG_PSEHT      IKAPFMVLNAILQARKVLKSEKPDVVLAMGGYVTGPTGIAAKSLGIPLVIHEQNAIAGMSNKWLAKFANR
MURG_ACIF5      LRAPWRVSRAILQARRILRQTRSHVVLGMGGYVTAPVGIAAWTLGRPLCLHEQNAVAGLSNRLLAPLARR
MURG_ACIF2      LRAPWRVSRAILQARRILRQTRSHVVLGMGGYVTAPVGIAAWTLGRPLCLHEQNAVAGLSNRLLAPLARR
MURG_PSESM      XXAPFMLLKALMQAXXXXXXXXXXXXXXXXXXXXXXXXLAARLAGVPLIIHEQNAVAGTANRSLASFASR
MURG_ENTS8      LLAPVRIFNAWRQARAIMKRFKPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNKKIASRVMQ
MURG_VIBSL      IKAPFQIINAILQARRHIKAWQPDVVLGMGGYVSGPGGIAAWLSGIPVVLHEQNAVAGLTNQWLSKIAKK
MURG_SHEHH      LAAPFKIIRSVMQARAVIKKFKPHVVMXXXXXXXXXXXXXXKLSGIPLVLHEQNAIPGMTNRLLSR----
MURG_BLOFL      ITLLFLIFFAMYQSFKIIRCWKPDIVLSMGGYVSGPSSLVAWLYGIPVIIHEQNRIMGLTNRYVSRFAKK
MURG_YERPY      LTAPIRIYRAVRQAQKIMRDYQPDVVLGMGGYVSGPGGLAAWLCGVPVVLHEQNGIAGLTNRWLARIAKK
MURG_YERPS      LTAPIRIYRAVRQAQKIMRDYQPDVVLGMGGYVSGPGGLAAWLCGVPVVLHEQNGIAGLTNRWLARIAKK
MURG_YERPB      LTAPIRIYRAVRQAQKIMRDYQPDVVLGMGGYVSGPGGLAAWLCGVPVVLHEQNGIAGLTNRWLARIAKK
MURG_YERP3      LTAPIRIYRAVRQAQKIMRDYQPDVVLGMGGYVSGPGGLAAWLCGVPVVLHEQNGIAGLTNRWLARIAKK
MURG_SHEDO      LAAPFKIMRSIMQAREVIAEFKPQVILXXXXXXXXXXXXXXRLAGIPLVLHEQNAIPGMTNKLLARIATK
MURG_PSEU2      XXXXXXXXXXXXQAXXXXXXXXXXXXXXXXXXXXXXXXLAAKLAGVPLIIHEQNAVAGTANRSLASFASR
MURG_MYXXD      VKXXXXXXXXXIESFRILARQKPDVVVGVGGYASGPVVMAAWLMGIPTAIQEQNALPGFTNKVLGRIVRV
MURG_KLEP7      LLAPVRIFNAWRQARAIMKRFQPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNKWLAKIAKK
MURG_BURM1      LRACAQSLAALR-------RVRPDVVLGMGGYITFPAGVMTALSGRPLVLHEQNSIAGLANKVLAKLAKR
MURG_VIBVY      VLAPFQILNAIFQAKAHIKRWQPDAVLGMGGYVSGPGGIAAWLSGIPVVLHEQNAVAGLTNHWLAKIAKK
MURG_VIBHB      LAAPFQIINAIMQARAHMKRWQPDAVLGMGGYVSGPGGIAAWMSGIPVVLHEQNAVAGLTNQWLSKIAKK
MURG_VIBVU      VLAPFQILNAIFQAKAHIKRWQPDAVLGMGGYVSGPGGIAAWLSGIPVVLHEQNAVAGLTNHWLAKIAKK
MURG_POLSQ      ARACHQSW-------KIMRRLKPNVVLGMGGYITFPGGLISKLLKRPLVLHEANSVAGSANRALAKIAMR
MURG_ACIBL      IKTMFDLPKAILESRRIIREFKPDVMIGVGGYASGPAMLAARLCRVPTVIFEPNIYPGFANRLVAPFXXX
MURG_PSEA6      LAAPFKIIKAVIQARGVIKQVKPDVVIGMGGFASGPGGVAAWLMGKPLVLHEQNAAPGMTNRLLARIANK
MURG_CLOD6      VKRVFKLFKGLEQSRKIVKKFKPDIVIGTGGYVSGPVLFNASMGKIPAIIHEQNSFPGVTNKILSKTVTK
MURG_SULSY      IQGVFSLLSTTFKVYKQIKKEKPDFSICFGGYTSIPLGLASFLARVPLYIHEQNSIPSYSNKILSYFAKK
MURG_SHEFN      LAAPFKIIRSIIQAKAVIDDFQPDVILXXXXXXXXXXXXXXKLSGIPVVLHEQNAIPGLTNKLLSKIAKK
MURG_NITOC      LRAPFKXXXXXXXXXXXXXXWQPAXXXXXXXXXXXXXXXXAWLLRRPLLIHEQNAIVGTANRLLAGRVME
MURG_CALS8      VEVFLKFISGYRQALQILKRIKPKVVFVTGGYVSLPVALAARRLKIKTILHEQNAYPGLANKIISRFCEK
MURG_BURS3      LRACGQSLAALR-------RVRPDVVLGMGGYITFPAGVMTALSGRPLVLHEQNSIAGLTNKVLAKFAKR
MURG_HAEDU      IKAPFTILKAVLQALNIIKKYRPDAVLGMGGYVSGPGGIAARLCNVPIVLHEQNAIAGLTNVWLAKIAKR
MURG_DESAP      TNXXXXXXXXXXXXXXXXXXFRPQVVVGTGGYVCGPVVLAAALRGIKTLIHEQNALPGLTNRMLSRYASR
MURG_ACTP2      XXXPFAIFKAVMQARKIIKNYQPDAVLGMGGYVSGPGGIAAKLCGVPVILHEQNAVAGLTNVWLSKIARR
MURG_HAEIN      LNAPFAIFRAVLQAKKIIQEEKPDAVLGMGGYVSGPAGVAAKLCGVPIILHEQNAIAGLTNKLLGKIATC
MURG_HAEIE      FNAPFAIFRAVLQAKKIIQEEKPDAVLGMGGYVSGPAGVAAKLCGVPIILHEQNAIAGLTNKLLGKIASC
MURG_HAEIG      LNAPFAIFRAVLQAKKIIQEEKPDAVLGMGGYVSGPAGVAAKLCGVPIILHEQNAIAGLTNKLLGKIATC
MURG_HAEI8      LNAPFAIFRAVLQAKKIIQEEKPDAVLGMGGYVSGPAGVAAKLCGVPIILHEQNAIAGLTNKLLGKIATC
MURG_PEDPA      FKTIGLFLSSVVKARKMVKEFKPDVVLGTGGYVSGAVVFAASMMGVPTVIHEQNSVVGVTNKFLSKFVKK
MURG_BURPP      VRFGGLRGKGMKTKLMLLRRVKPDVVLGMGGYITFPAGLMTALSGRPLVLHEQNSIAGXXXXXXXXXXXX
MURG_BORPD      LRACSQAWGHL-------TRVRPDVVLGMGGYVAFPGGMMAALRGLPLVVHEQNAVAGTANRWLARLARR
MURG_ACTPJ      XXXPFAIFKAVMQARKIIKNYQPDAVLGMGGYVSGPGGIAAKLCGVPVILHEQNAVAGLTNSKIACRVLQ
MURG_ACTP7      XXXPFAIFKAVMQARKIIKNYQPDAVLGMGGYVSGPGGIAAKLCGVPVILHEQNAVAGLTNSKIACRVLQ
MURG_VIBFM      IAAPFQILGAISQAKKHIKAWQPDVVLGMGGYVSGPGGIAAWLSGIPVVLHEQNAVAGLTNQWLSKIAKR
MURG_VIBF1      IAAPFQILGAISQAKKHIKAWQPDVVLGMGGYVSGPGGIAAWLSGIPVVLHEQNAVAGLTNQWLSKIAKR
MURG_THEYD      XXXXXXXXXXXXXXXNIINSFAPDIVFGVGGYASFPVVLAAFLKKIPTIILEQNTVPGLANKLLGKIASA
MURG_RALME      XRAFWQSIGALR-------RVKPDVVLGMGGYITFPAGMMASLLGRPLVLHEQNSIAGLANKVLAKVADR
MURG_CLOTH      LVAVKELFQGLAEARKIIKDYKPDLVIGTGGYVCGPVLFNASRMKIPTLVHEQNAFPGVTNKILSKFVDR
MURG_SHEPA      LAAPFKILRSVMQARAVIKSFKPDVVMXXXXXXXXXXXXXXKLSGIPLVLHEQNAIPGMTNRLLSR----
MURG_PASMU      LSAPFSIFRAILQARKIIKAYQPHAVLGMGGYVSGPGGIAAKLCGIPVILHEQNAVAGLTNSWLAKIARR
MURG_LACRJ      FKTIYLFLNSVHHAKKIISEFKPDVVLGTGGYVSGAVLYAAAKKHIPTVIHEQNSVVGVTNKFLSRYVDQ
MURG_LACRD      FKTIYLFLNSVHHAKKIISEFKPDVVLGTGGYVSGAVLYAAAKKHIPTVIHEQNSVVGVTNKFLSRYVDQ
MURG_NITEC      LLLPWRLAKACWQSFCILRRQRPQIVLGMGGYPALPGGIMAVLSGKPLLIHEQNRIAGLTNKILAKIASR
MURG_BORPE      XXXXXXXXXXCAQAWRRLADIRPDVVLGMGGYVAFPGGVMAALRRTPLVVHEQNAVAGTANRWLARLARR
MURG_BACLD      VKTVMRFLKGVKECKEELKRFKPDAVIGTGGYVCGPVVYAASKLGIPTIIHEQNSLPGLTNKFLSKYVDK
MURG_CARHZ      LKKLFLVPKSLINAFIFLKKEKPDIVVGTGGYASFPVVFAATVLKIPTVIHEQNAYPGIANKILAARVDA
MURG_LAWIP      LGRKWKAFSALYSARKILQKCMPDIVVGFGSYASFAPLVAAKLKRIPTAIHEQNVRPGLANRMLARLADR
MURG_CELJU      EGVRGRGLTGLLKAPFLITKMNADLVLXXXXXXXXXXXXXXRLLGKPLVIHEQNAVAGTTNRLLARIAQR
MURG_AZOSB      XXXXXXXXXGFWQALGQLRRIKPDVVLGMGGYITFPGGMMAALLGWPLVLHEQNSVAGLANRVLAGVADR
MURG_LACCB      SNTVRKFLGSLGEAKKLLQDFQPDIVVGTGGYVSGAILFAATRLHIPTVIHESNSVAGVTNKFLSHFVDR
MURG_LACC3      SNTVRKFLGSLGEAKKLLQDFQPDIVVGTGGYVSGAILFAATRLHIPTVIHESNSVAGVTNKFLSHFVDR
MURG_HERAR      VTGVLRLLASFGTCFSILARRKPGVVLGMGGYVTVPGGWMAKLRGVPXXXXXXXXXXXXXXXXXTPIAQR
MURG_SODGM      LLAPVRIWRALRQARRIMRAWRPDVVLGMGGYVSGPGGLAAWSCGIPVVLHEQNGIAGLTNRGLAKISRK
MURG_BACSU      VKTVMRFLKGVKKSKSYLAEFKPDAVIGTGGYVCGPVVYAAAKMGIPTIVHEQNSLPGITNKFLSKYVNK
MURG_PSYCK      XXMPVTLLSATMAVIKIIRGNNIDIVVGFGGYVSAPGGIAARLTKTPLIIHEQNAIAGMSNRYLAKMATK
MURG_ENTFA      FKTIYLFLTSINKAKKIIREFQPDVVIGTGGYVSGAVVYAAHQLKIPTIIHEQNSIPGMTNKFLSRYVDK
MURG_BURXL      VRFXXXXXXACTQSLSVLRRVKPDVVLGMGGYITFPAGLMTALSGRPLVLHEQNSIAGXXXXXXXXXXXX
MURG_VIBCM      LKAPFQIVNAILQARRHLLTYQPDAVLGMGGYVSGPGGIAAWLLGIPVVLHEQNAVAGLTNQWLAKIARR
MURG_VIBCH      LKAPFQIVNAILQARRHLLTYQPDAVLGMGGYVSGPGGIAAWLLGIPVVLHEQNAVAGLTNQWLAKIARR
MURG_SYNS9      LVQLIRLLAASITVRRLIRTHQIDAVFTTGGYIAAPAILGARWCGVPAVLHESNAIPGRVTRLLGRFCSA
MURG_DIAST      XXXXXXXXXXXXXXXXXXXXXQPDVVIGLGGYVTFPGGIAARLARKPLLLHEQNSVPGMANKLLATRVYT
MURG_ACISJ      XXXXXXXXXXXXXXXXXXXXXQPDVVIGLGGYVTFPGGIAARLARKPLLLHEQNSVPGMANKLLATRVYT
MURG_LISMF      IKTVMRFLSGAKKSKQILRDFKPDVVIGTGGYVCGPVVYAAAKLKIPTLIHEQNSVAGLTNKFLSRYTDK
MURG_LISMC      IKTVMRFLSGAKKSKQILRDFKPDVVIGTGGYVCGPVVYAAAKLKIPTLIHEQNSVAGLTNKFLSRYTDK
MURG_EXISA      VKTAYWFLKAVRALKKDMAAFKPDVVIGTGGFVSGPVVYTAQQLGIPTILHEQNSIPGLTNKFLSKKADR
MURG_DESRM      FKVLWQAYRGYREAVGIIKTFNPDVVIGTGGYVCGPVVMAAARRGIPTLIHEQNAFPGITNRILSKFADQ
MURG_DEIRA      -RQLLKAGQGLAQARRTLAGLNPAAVVGYGGFASLPGVLAAQSLGIPTILHEQNARLGLTQRLAVRRARA
MURG_BURTA      VRFGGLRGKGLATSLRALRRVKPDVVLGMGGYITFPAGLVTVLTGRPLVLHEQNSIAGLTNKVLAKLAKR
MURG_BACA2      VKTVMRFLKGVKKSKSYLKEFKPDAVIGTGGYVCGPVVYAAAKMGIPTIIHEQNSLPGITNKFLSKYVNK
MURG_SHEPW      LAAPFKILRSVMQARSVIQDFKPDVVMXXXXXXXXXXXXXXRLSGIPLVLHEQNAIPGMTNKLLSKVATE
MURG_OPITP      ARFIGTQSRGLWFCRGLVRAARPAGVVAFGGFTSAGVVLAARWRGVPVALHEANRVPGRAIRVLSRFANR
MURG_DEIGD      -RELLRAARGVAEARAFLRDARPGAVVGFGGFASLPGVLAAQTLGIPTVLHEQNARLGLTQRLAAGRARA
MURG_DECAR      XXXXXXFWQGLKAIRQV----KPNVVLGMGGYITFPGGMMAALTGVPLVLHEQNSVAGLANRVLASVADR
MURG_PSYA2      XXMPVTLLSATMAVIKIIRGNKIDMVVGFGGYVSAPGGIAARLTKTPLIIHEQNAIAGMSNRYLAKMATK
MURG_CHLFF      IRNTRSLYIGYKKAKKELIAFGPDVVIGFGSYHSLPVLMAALKKKIPIFLHEQNLVPGKVNKLFSRFAKG
MURG_VIBC3      LKAPFQIVNAILQARRHLLAYQPDAVLGMGGYVSGPGGIAAWLMGIPVVLHEQNAVAGLTNQWLAKIARR
MURG_NOSP7      IRIFGKLAGSIIEVRRILKQGNFQGVFTTGGYIAGPAVIAARSLGLPVVFHESNALPGKVTRFFGPWCSA
MURG_LISMO      IKTVMRFLSGAKKSKQILRDFKPDVVIGTGGYVCGPVVYAAAKLKIPTLIHEQNSVAGLTNKFLSRYTDK
MURG_LISMH      IKTVMRFLSGAKKSKQILRDFKPDVVIGTGGYVCGPVVYAAAKLKIPTLIHEQNSVAGLTNKFLSRYTDK
MURG2_BACAH     VKTVMRFLKGVQDSKRYIRRFNPDIVIGTGGYVCGPVVYAAAKLGIPTIVHEQNSVPGVTNKFLSRYVDK
MURG1_BACCZ     VKTVMRFLKGVQDSKRYIRRFNPDIVIGTGGYVCGPVVYAAAKLGIPTIVHEQNSVPGVTNKFLSRYVDK
MURG1_BACAN     VKTVMRFLKGVQDSKRYIRRFNPDIVIGTGGYVCGPVVYAAAKLGIPTIVHEQNSVPGVTNKFLSRYVDK
MURG_BURP8      LRACMQSLSVLR-------RVKPDVVLGMGGYITFPAGMMTALSGTPLVLHEQNSIAGLANKVLAKLAKR
MURG1_BACCR     VKTVMRFLKGVQDSKRYIRRFNPDIVIGTGGYVCGPVVYAAAKLGIPTIVHEQNSVPGVTNKFLSRYVDK
MURG1_BACC1     VKTVMRFLKGVQDSKRYIRRFNPDIVIGTGGYVCGPVVYAAAKLGIPTIVHEQNSVPGVTNKFLSRYVDK
MURG_CHLMU      FSGARQLYQGYTAALRMIKSFAPDVAVGFGSYHSLPAILASIRKRIPLFLHEQNVVPGKVNKLFSHFAKG
MURG_SYNPW      LRLL----AASRDVRRLIRRNGIDVVFTTGGYIAAPAILGARWSGVPVVLHESNAIPGRVTRLLGRACTQ
MURG_PELCD      IRSVWQ---GLCILR----KFQPDVVLGVGGYASAPMLVAARLKRIPTVIHEQNAWPGLTNRLLGPWARC
MURG_ENTHR      LKTIQLFLKSIREAKKILKEFKPDVVIGTGGYVSGAVVYAASKLAIPTIIHEQNSVPGITNKFLSRYVDR
MURG_BUCBP      MAIPFKLIIACYQAKKIIENINPDIILGMGGYVSVPGGIISYLYKKPLIIHEQNKIAGLANKLLSKFTTI
MURG_ALKMQ      VKSIAKLIKGLVEARRLIKDFNPDVVIGTGGFVCGPVLYMATKLGYKTLIHEQNVFPGLTNRVLGNYVDR
MURG_PROMH      IAAPIRIIKAIFQARRIMKRYQPDAXXXXXXXXXXXXXXAAWSCGIPVVLHEQNGIAGLTNRWLSKIAKR
MURG_ALHEH      LRALWQALGVLRRHR-------PRAVLXXXXXXXXXXXXXXWLTRRPLIIHEQNAVAGLTNRLLSRLARR
MURG1_BACHK     VKTVMRFLKGVQDSKRYIRRFNPDIVIGTGGYVCGPVVYAAAKLGIPTIVHEQNSVPGVTNKFLSRYVDK
MURG_LACPL      VKTVYLFLKSVVTARKYIKAFKPDVVVGTGGYVSGAVVFAASQMHIPTVIHEQNSVVGVTNKFLSRFVDK
MURG_EXIS2      VKTGFRFLKSVVRVRKLLRDFQPDIVVGTGGFVCGPVLYTAAKMGYKTLVHEQNSLPGITNKFLARYVDR
MURG_BACHD      VKTVVRFLRGTKRAKALLNEFKPDVVIGTGGYVCGPVVYAAAKLKIPTVIHEQNSVPGLTNKFLSRYVDR
MURG_ANOFW      VKTIVRFIKSVRACKKLLKQYKPDVVLGTGGYVCGPVVYAAAKLGIPTIIHEQNSIPGLTNTFLSRYANK
MURG_THEPX      LKTIYKAMVGLKEANNILNEFKPDVVIGTGGYVCGPVLMMAALKGIPTLIHEQNAFPGLTNKVLSRFVKV
MURG_THEP3      LKTIYKAMVGLKEANNILNEFKPDVVIGTGGYVCGPVLMMAALKGIPTLIHEQNAFPGLTNKVLSRFVKV
MURG_HAEPS      LTAPFAILRAVLQAKKIINAYKPDAVLGMGGYVSGPGGIAAKLCGVPVILHEQNAVVGLTNVWLSKIARR
MURG_PROM4      ----FKLLAATGSVICLIRRNRIQIVLTTGGYIAVPAVLAAKLTGKKVILHESNAIPGKATRLLGRLCDK
MURG_MICAN      LKILFSQLRAIWQVRSLIKKRQIAAVFTTGGYIAGPTILAARLANIPVILHESNYIPGKVTKVLGRWCDT
MURG_LEUMM      IKTVSLFLKAVKEAKKIIKDFDPDVVVGTGGYVSGAVVYAAQRLHIPTVIHEQNSVAGVTNKFLSRGATK
MURG_LISW6      VKTIMRFLSGAKKSKQILRDFKPDVVIGTGGYVCGPVVYAAAKLKIPTLIHEQNSVAGLTNKFLSRYTDK
MURG_LISIN      IKTVMRFLSGAKKSKQILREFKPDVVIGTGGYVCGPVVYAAAKLKIPTLIHEQNSIAGLTNKFLSRYTDK
MURG_BORA1      XXXXXXXXXXXXXXXXHMAEIQPDVVLGMGGYVAFPGGVVAALRRTPLVVHEQNAVAGTANRWLARMAKN
MURG_PROM3      XXXXXXXXXTGRV-RKLLRKQGIQTVFTTGGYIAAPAILAARWCGIPVVLHESNAIPGRVTRLLGRFCQV
MURG_CLOCE      LIAIKELIQSFFQASRLLKRIKPDVVIGTGGYVCGPVLYMAAKKGIPTLIHESNAFPGVTNRLLERYVSY
MURG_SACD2      LAAPFRVLKAIEQAKQILQKLRPALVIXXXXXXXXXXXXXXRKLKIPLVIHEQNAAAGTTNKILRRFANL
MURG_MANSM      LGAPFAICRAIMQARKIILRQKPDAXXXXXXXXXXXXXXAAKLCGVPVILHEQNAVAGLTNVWLSKIAKR
MURG_BACCN      VKTVMRFVKGVQDSKRYIRRFNPDVVIGTGGYVCGPVVYAAAKLGIPTIVHEQNSVPGVTNKFLSRYVDK
MURG_HAES1      LKAPFVILRAVLQARKIIKKYQPDVXXXXXXXXXXXXXXAAKLCNIPVVVHEQNAVLGLTNSLLAKIATR
MURG_DESVH      XXXXXXXXXXXXXXXXXXXRFDPDIVLGFGGYAAFAGVLAARLRGRPAAIHEQNSVPGLTNRVLSRVVPR
MURG_CHLTR      FSGAKQLYKGYVAALQKIRDFTPDLAIGFGSYHSLPAMLASIRSRIPLFLHEQNIVPGKVNKLFSRFAKG
MURG_CHLTA      FSGAKQLYKGYVAALQKIRDFTPDLAIGFGSYHSLPAMLASIRSRIPLFLHEQNIVPGKVNKLFSRFAKG
MURG_THIDA      XXXXXXXXXXXXFAQSLILRRRPDVVLGMGGYTAFPGGMMASLLNRPLVVHEQNSVGGLTNRLLACLADR
MURG_DESVV      XXXXXXXXXXXXXXXXXXXRFDPDIVLGFGGYAAFAGVLAARLRGRPAAIHEQNSVPGVTNRVLSRVVPR
MURG_CHLTB      FSGAKQLYKGYVAALQKIRDFTPDLAIGFGSYHSLPAMLASIRSRIPLFLHEQNIVPGKVNKLFSRFAKG
MURG_CHLT2      FSGAKQLYKGYVAALQKIRDFTPDLAIGFGSYHSLPAMLASIRSRIPLFLHEQNIVPGKVNKLFSRFAKG
MURG_BACP2      VKTVMRFLKGVQKSKSYLKEFKPDAVIGTGGYVCGPVVYAASKLKIPTIIHEQNSLPGITNKFLARYVNK
MURG_ANASP      LVILGKLIGSILKVRRLLKQGNFQGVVTTGGYIAGPAVIAARSLGLPVIFHESNALPGKVTRFFGPWCSV
MURG_PROMM      XXXXXXXXXTGRV-RKLLRKQGIQTVFTTGGYIAAPAILAARWCGIPVVLHESNAIPGRVTRLLGRFCQV
MURG_CYAP8      LQILFKLIRGIFEVRHLIKTHHIDVVFTTGGYIAAPAILGARLAGIRAILHESNFIPGKVTRLLSRFCDR
MURG_PHOPR      LAAPFKIVGAILQARKYIKAWQPDVVLGMGGYVSGPGGIAAWLSGVPVVLHEQNAVAGLTNQWLS----R
MURG_FLAJ1      QNMMFKLASSLLESKRIIKKFKPNVVIGTGGFASGPLLQAAGSAGIPTVVQEQNSFPGITNKLLSKKANA
MURG_DICNV      LKAPFMIGRAVFQAKKIMQHIQPDVVIGMGGFASGPGGIAAKILNIPLLIHEQNAVMGLTN-ALLSRV--
MURG_GLOVI      LEAASQTFAAYRYARNLLSQERFAGVFTTGGYIAAPAVLAARSLNLPAIGHESNVLPGKVIRYLARWMRS
MURG_BDEBA      MKTLLKIPVGLWQSIRLLGQLKPLYVIGVGGYASGPFVLAASIIGFNTAVWEPNAMPGMANRILSRFVDK
MURG_LACJO      FETIELFIKATKEAKQIIKNFKPDVVVGTGGYVSGAIVYEAAKMHVPTIIHESNSVVGLANKFLAHYVDK
MURG_BACFR      VAVLLKLVRSQWKARNIIRQFRPQVAVGVGGYASGPTLKMAGMMGVPTLIQEQNSYAGVTNKLLAQKARR
MURG_BACFN      VAVLLKLVRSQWKARNIIRQFRPQVAVGVGGYASGPTLKMAGMMGVPTLIQEQNSYAGVTNKLLAQKARR
MURG_VIBPA      LAAPFQIINAIMQARAHMKRWQPDAVLGMGGYVSGPGGIAAWLSGIPVVLHEQNAVAGLTNQWLSKIAKK
MURG_DESPS      VKALLVLPISCLQALFILARFRPDLVLGVGGYVTGPVVAMAKLCRRPTLIHEQNSVPGLANRKLAKLVDR
MURG_AZOVD      LKAPFQLIRSLFQARRIMNELRPVCXXXXXXXXXXXXXXAAKLTGAPLVIHEQNAVAGTSNRALAPLADR
MURG_SYNS3      IQLL----AASGSIRRLIQRERIDAVFTTGGYIAAPAILAARWCGIPVVLHESNAIPGRVTRLLGRFCTR
MURG_SOLUE      NQKFATL------SRLPITTLKASAVFSMGGYVAGPPVMAALVRRVPVVVMEPNAFPGFTNRVIARLVSR
MURG_OENOB      FKTVNLFIKAVKKSKHIIHDFKPDIVLGTGGYVSGAVLYAAQRLRIPTVINEQNSIAGVTNKFLSRGADR
MURG_LACSS      FKRSMNL-NGIKTNLKTIEEFKPDVVIGTGGYVSGSLLYAASRLKVPTIIHEQNSAAGVTNKFLARFVDK
MURG_LACGA      FETIELFIKATKEAKQIIKDFKPDVVVGTGGYVSGAIVYEAAKMHIPTIIHESNSVVGLANKFLAHYVDK
MURG_TOLAT      VRKLFQICKAVLQAFMILRRIRPDVVLXXXXXXXXXXXXXXKLLGIPVVLHEQNAAAGLTNRLLAKIATR
MURG_LACH4      FETIKLFLQATKSARKILKEFKPDVVLGTGGYVSGAMVYEAAKMHIPTMIHESNSVVGLANKFLGHYVDR
MURG_BUCAP      IMTPINVLNSYLQVRKIIKNWIPDIILGMGGYVSGPGGLAAWSCKIPFILHEQNKIAGITNKLLSKNMQA
MURG_THETN      LKTVYKAFTGFKQANKILKDFKPHVVIGTGGYVCGPVLMAAVIKRIPTLIHEQNAFPGLTNRLLSPFVDI
MURG_ACIAC      XXXXXXXXXXFWQALAXXXXXXXXXXXGLGGYVTFPGGMMAVLCGKPLVVHEQNSVAGLVNKVLAGVADR
MURG_CHLP8      VGVLKDFGSSLMQAFSIIRKETPNVVVGTGGYVSAPLLLAAQLSGCKTLIQEQNAFPGVTTRMLARMASE
MURG_SYNR3      IQLLWSAW----PVTRLIRKQECAVVFTTGGYIAAPAILAARLCRRPVVLHESNAIPGQVTRLFGRFCSR
MURG_MOOTA      VRALVKTGRGLGEAWQQVRRFRPDVVVGTGGYVSGPVCLAAALQGVPVILHEQNAFPGVTNRLLAILARC
MURG_LACAC      FETIKLFFQATKSARKILQEFKPDVVLGTGGYVSGAMVYEAAKMHIPTMIHESNSVVGLANKFLGHYVDK
MURG_CHRSD      LLAPWRLAKAVWQARQVIAKFDPQLVVXXXXXXXXXXXXXXWLMRRRLIVHEQNAVAGMTNRYLSRLADG
MURG_CHLCV      IRRMSSLYNGYRKAKKELCIFDPDVVIGFGSYHSLPVLMAALKKKIPIFLHEQNLIPGRVNKLFSRFAKG
MURG_BACV8      VSVLFKLVKSQLLARKIIKDFKPHAAVGVGGYASGPTLKMAGMMGIPTLIQEQNSYAGVTNKLLAKKACK
MURG_PORG3      YKVAIAVIRSMRLANKTIRNFRPDMVIGVGGYASGPTLRRAHSLGIPTLIQEQNSYAGVTNKLLSRGAHK
MURG_LEUCK      IKTVQLFLKAVKVSKKIIKEFKPDXXXXXXXXXXXXXXXXXQRMNIPTVIHEQNSVAGVTNKFLARGATK
MURG_FRATN      -------------------------VIGFGGYVSGPICLAAALINIPVIIHEQNAKIGLTNRILAKFATT
MURG_PORGI      YKVAIAVIRSMRLANKTIRNFRPDMVIGVGGYASGPTLRRAHSLGIPTLIQEQNSYAGVTNKLLSRGAHK
MURG_LACBA      FKTVYLFLKSVHEAKKMIRQFKPDXXXXXXXXXXXXXXXXXXRLHVPTLIHEQNSVVGITNRFLSRYVDR
MURG_XANOR      LGAPLRVMRAVRAAGFVLRKRQPRAVISXXXXXXXXXXXXXXXXXXXXXVHEQNRAPGMTNKVLSRFARR
MURG_SULDN      LKALWLVLRAFFASRAILKKHNIQATYSVGGXXXXXXXXXXLSRLIPLFIHEQNAVYGKLNSIL----KP
MURG_LACLS      IKTAYKFFKSVSDAKKIMKDFKPDVVLGTGGYVAGPVVFAAAQLKIPTIIHEGNSFPGITNRFLAKKVDR
MURG_LACLM      IKTAYKFFKSVSDAKKIMKDFKPDVVLGTGGYVAGPVVFAAAQLKIPTIIHEGNSFPGITNRFLAKKVDR
MURG_HALHL      AALPWXXXXXXXXXXXXXXXQRPDVVLGMGGYVAGPVGLAARLAGRPLIIHEQNARAGMTNRFLARLGHR
MURG_XANOM      LGAPLRVMRAVRAAGFVLRKRQPRAVISXXXXXXXXXXXXXXXXXXXXXVHEQNRAPGMTNKVLSRFARR
MURG_CYTH3      DNLAFPLKVSYFKAKKIVSTFKPDIAIGVGGYASWPLLQAANASGVATLIQEQNSYAGVANKALSKKVKA
MURG_CLOPH      FSDPFKVLKGYREAKKLLKNLDPNVVFSKGGFVAVPVVLAAKKRKIPAIIHESDMTPGLANRLCIPSAAK
MURG_CHLTE      RALVENALISLSMAMALVRKEQPDVVVGTGGYVSAPLLLAAQLSGKKTLIQEQNAFPGVTTRLLARMATE
MURG_XYLFM      LGAPVRVLRAIFAAMGVLRRYRPRVVVSXXXXXXXXXXXXXXXMRLPLIVHEQNRAPGMTNRVLARVAKR
MURG_SALRD      LLLPFRVAQGLVQSWRLVGAIEPDVAVGTGGYVAAPVLMAAWLRGRPLLIQEQNAYAGLTNRVLARLALR
MURG_FLAPJ      QNAMFKLLSSLVKSFGIVQQFKPDVVIGTGGFASGAVLKVASILGIATVIQEQNSYPGITNKLLSKKANK
MURG_CHLAB      VRRVCSLYAGYKKAKKELLIFDPDVVIGFGSYHSLPVLMAALKKKIPIFLHEQNVVPGKVNKLFSRFAKG
MURG_PELLD      LLSLTDFAASLFRAAALIRRERPDVVVGTGGFVSAPVLLAAQLLGRKTLIQEQNAFPGLTTRLLSILARE
MURG_PARD8      VKVMVRLAKSLRLARKTIREFKPDIAVGVGGYASGPTLWMAASQGVPALIQEQNSYAGVTNKLLAKKASK
MURG_DESVM      XXXXXXXWRAVSVVRRFDPDIXXXXXXXXXXXXXXXXRLC----GRPAAIHEQNAIPGLTNRLLGHVVQR
MURG_FINM2      FKALKELFQGLREANKILKEFKPDLVIGTGGYVSGPILYKATKTKAKVAFHEQNSFPGITNRILSRYVDK
MURG_DESHD      LKVGGKSFKALWETKQILKKFKPDLVVGTGGYVAGPVVLTAALFGIPTLLHEQNALPGITNKILTRFVRK
MURG_MYCVP      FRLPMRVLRAVRQTRRILDEVSADVVVGFGGYVAVPAYLAARSLRVPVVVHEANASAGWANKVGARSAQR
MURG_FUSNN      IRKYLK---AIRTAYKVIKEEKPDAIIGFGNYISVPVIIAGILLRKKIYLQEQNVNIGSANKMFYKIAKM
MURG_DESHY      LKVGGKSFKALWETKQILKKFKPDLVVGTGGYVAGPVVLTAALFGIPTLLHEQNALPGITNKILTRFVRK
MURG_CHLPN      MSRTLSLCSGYLKARKELKIFDPDLVIGFGSYHSLPVLLAGLSHKIPLFLHEQNLVPGKVNQLFSRYARG
MURG_TRIEI      LKVLSRLIGSILKVRHILKEGKFQGLFTTGGYXXXXXXXXXRYLGLPVILHESNVLPGKVTRWFSRLCNV
MURG_SYNSC      XXXXXXXXXASVSVRRAIRRNAIDAVFTTGGYIAAPAILAARWCCIPVVLHESNAIPGRVTRLLGRFCSA
MURG_PROM2      IFLFYQYIEILMSTFQIIRILKEKKVFTTGGYISAPTIIASKFLRIPVIIHESNLIPGMVTKYFGFLCNY
MURG_FRASC      FKLPARFLDAICQAGETLDLVRADVVVGFGGYVSAPAYLAARRRGIPIVVHEANPLPGLANR-LGARLTP
MURG_ALKOO      VKSAAMLLKGIAEARKIIKEFKPDIVIGTGGFVCGPVLYMASKLGIRTMIHEQNVFPGLTNRILDRYVDR
MURG_PROMS      FYQYIKILMSTFQIIRILKEKKINLVFTTGGYISAPTIVASKILKIPIIIHESNVVPGMVTKYFGFLCNY
MURG_GRAFK      IDRSFSLXXXXXXXXXXXXXXXPDIVIGTGGFGSGPLLRIAISKGIPTLIQEQNSLPGVTNRILSKNASI
MURG_CHLL2      ILANVGILIALINAGGLIRRENPDVVVGTGGFVSAPVLLAAQMMGRRTLIQEQNAFPGVTTKLLSILASE
MURG_PROM0      IFLFYQYFRILMSTFQVIWILKEEKVFTTGGYISAPTIIASKLLRIPVIIHESNLIPGMVTKNFGFLCNY
MURG_COREF      VKLPFRVAKSLRQARQVLRDTGAHAVVGFGGYVSAPAYLAARSLGIPFFVHEANARAGMANK-LGVRL--
MURG_CHLT3      KELFENLKVPMRLQRSLLQREKPNVVIGTGGFVSGPIVWEAQSKKIPTLIQEQNSMPGVTTRLLSLRASE
MURG_PROMP      VFQYLKILFSIFXXXXXXXXXXXXXVFTTGGYISAPTILAAKWLKIPVILHESNLIPGTVTKYFGFLCEF
MURG_PELTS      -RNLLALWQAVRQAVEIIGRWRPEAVIGTGGYVCGPVVLAAVLKRIPTLIHEQNALPGVTNRILSRFASR
MURG_PROM9      FYQYIEILISTFQIIRILKEKKINLVFTTGGYISAPTIVASKLLRIPIIIHESNVIPGMVTKYFGFLCNY
MURG_HELPJ      IRSLFLQXXXXXXXXEILKKHQITHTISVGGFSAGPASFASLLNKIPLYIHEQNAIKGSLNRYLSPKAKA
MURG_XANC5      SXXXXXXXXXXXXAPXVLRKRRPRAVISXXXXXXXXXXXXXXXXXXXXXVHEQNRAPGMTNKVLSRFARR
MURG_PROM1      LFDLCKLLFASVQVSVLLRQKKINVIFTTGGYISAPCILGAKMAGIPVLLHESNAIPGKVTRLLGRFCDH
MURG_LACDB      VKTIQLFLKATKRAKEILADFQPDVVLGTGGYVSGAIVYEASKMKIPTMIHESNSVVGVANKFLGHYVDK
MURG_LACDA      VKTIQLFLKATKRAKEILADFQPDVVLGTGGYVSGAIVYEASKMKIPTMIHESNSVVGVANKFLGHYVDK
MURG_DESMR      AAPFWMLRAGLAGAR--IREFSPDVVCGFGGYAGFIPVAAARLMGVPTAIHEQNSVPGVTNKVLGRFVDR
MURG_PROMT      LFNLCKLLFASVQVSVLLRQKKINVIFTTGGYISAPSILGAKMAGIPVLLHESNAIPGKVTRLLGRFCDH
MURG_PROM5      LFQYLKILYSTFXXXXXXXXXXXXXVFTTGGFISAPTILAAKLLNIPVIIHESNLIPGTVTKYFGFLCEF
MURG_PROAC      FKVPARLAGAVRKAGEVLQRRQTDVVVGFGGYVSLPAYLAARRAKIPVVIHEQNAVPGLANK-IAARFAV
MURG_NOCSJ      LKVPFRLRAAVRATHAVLDRVRPDVVVGYGGYVSMPAYVATRKRGIPLVVHEQNTVPGLANRAGARFAQR
MURG_MYCA1      ARLPSRVWRAVRETRAVLHAVDADVVIGFGGYVALPAYLAARGVSVPVVIHEANASAGLANRVTAQRVSA
MURG_ALCBS      LTAPFNLLRAVLQARQLIRARQPVLXXXXXXXXXXXXXXXXRLCKVPVVVHEQNAVPGLTNRLLSRLSTV
MURG_SYNY3      IKIGWNLLRSVFTVRKLIKSKKINAVATTGGYIAAPAIVAAKLCNIPVIFHESNFIPGKVTTWLGRWCDT
MURG_ANAVT      LVILGKLIGSILKVRRLLKQGNFQGVVTTGGYIAGPAVIAARSLGLPVIFHESNALPGKVTRFFGPWCSV
MURG_NATTJ      VYFLRDFLKGLYQSYRLIKNFTPDVVIGTGGYVCGPVLMAASLMKIPTVLHEQNVIPGITNKFLSRFADY
MURG_HELPY      IGSLFLQXXXXXXXXEILKKHQITHTISVGGFSAGPASFASLLNKIPLYIHEQNAIKGSLNRYLSPKAKA
MURG_RUTMC      IKALFLLSYATLQIMGIFLKFKPNIVLGMGGFTSGIGGLVACIFRIPLVIHEQNSISGTTNKILNKIAKK
MURG_PELPB      ---IADFVXXXXXXXXXXXXXXPDVVVGTGGFVSAPLLLAAQLMRKKTLIQEQNAFPGVTTKLLAALASE
MURG_MYCPA      ARLPSRVWRAVRETRAVLHAVDADVVIGFGGYVALPAYLAARGVSVPVVIHEANASAGLANRVGARTAQR
MURG_FRAAA      LKLPVRLFDAVRQAGATLDRVRADVVVGFGGYVSVPAYLAARRRGIPIVVHEANPLPGMANR-LGARFTP
MURG_XYLFA      -------------------------------------------MGLPLIVHEQNRAPGMTNRILARVARR
MURG_LACS1      FKTVYLFLKSVHDCKKIIRDFKPDXXXXXXXXXXXXXXXXXXRMKIPTFVHEQNSVAGVTNKFLSRFVDK
MURG_CHRVO      XXXXXXXXXXFFSSAAQIFRHRPDVVLGMGGYVCLPGGVMAGLLWKPLVLVNADAGLLLSNKALLPFASK
MURG_SYNWW      SRSLVKFPRSFFQAWDIIKDFQPDIVIGTGGYVSFPIVMAGTFFPSKTVIHEQNAIPGLANRNLARRVDY
MURG_HELPH      IGSLFLQXXXXXXXXEILKKHQITHTISVGGFSAGPASFASLLNKIPLYIHEQNAIKGSLNRYLSPKAKA
MURG_CHLCH      LRILFDFARSLGITIQLLRSEAPDVVVGTGGFVSAPLLFAAQLLGKKTLIQEQNAFPGVTTRLLSLFASE
MURG_BUCAT      IISPIYILRAYYAVKKIIKTWSPDIXXXXXXXXXXXXXXASWNCNIPLLLHEQNKIAGITNKWLSR----
MURG_BUCAI      IISPIYILRAYYAVKKIIKTWSPDIXXXXXXXXXXXXXXASWNCNIPLLLHEQNKIAGITNKWLSR----
MURG_CLONN      FSDPFKVLKGVFEAKKIIKREKPNIVFSKGGFVSVPVVIGARLNRIPVISHESDMTPGLANKLAAPFCNK
MURG_BAUCH      IVSILQ---AVLQSYYIMRKWRPDIVLGMGGYISGPCGLAAWMCKIPLVIHEQNRVTGLTNYYLSKFAKK
MURG_XYLFT      LGAPVRVLPAIFAAMXXXXXXXXXXXXSXXXXXXXXXXXXXRLMGLPLIVHEQNRAPGMTNXXXXXXXXX
MURG_XYLF2      LGAPVRVLPAIFAAMXXXXXXXXXXXXSXXXXXXXXXXXXXRLMGLPLIVHEQNRAPGMTNXXXXXXXXX
MURG_HELP2      INSLFLQVKAAFKAKEILKKHQITHTISVGGFSAGPASFASLLNHIPLYIHEQNAIKGSLNRYLSPKAKA
MURG_EUBE2      YRSLFRVLHGLFQAKRLMKKIKPDIVFSKGGFVSVPVVLAAGSRHIPVIIHESDMTPGLANKIAMRKATK
MURG_BUCA5      IISPIYILRAYYAVKKIIKTWSPDIXXXXXXXXXXXXXXASWNCNIPLLLHEQNKIAGITNKWLSR----
MURG_SORC5      VRGAARAGSVLPEARRLVERLDARVALSLGGYAGGPVSLAARSLGVPVAILEPNSVLGLSNRLLAPIVDR
MURG_PROA2      VRAVVK-------AAGIIRAEQPDVVVGTGGFVSGPLLAAAELMGRKTLIQEQNAFPGVTTRFLAAFATE
MURG_BIFAA      PAK-WK--AEKAKVRDILTRHQAQVVVGFGGYTSAPVYAAAHSMGIPIAIHEQNARAGMANK-LGARWAS
MURG_SYNJA      LGSLVQLARATLQVRQILASGQFDVVLTTGGYIAAPTILAARSLGVPVLLHESNCLPGKVTRWLGRFCRL
MURG_PROMA      YFQLLKLILAIFFVIYLIKRKQIKLVFTTGGYIAAPAIIASKLCGINVILHESNSYPGKVTRLLGKFCDE
MURG_CYAA5      XXXXXXXXXXXFEVKQLIEQQKIDVVFTTGGYXXXXXXXXXXXXGIPAILHESNYIPGKVTKLLSRFCTT
MURG_CLOAB      FSDPFKVILGIFQSVSILRKKKPNIVFSKGGFVSVPVVIAAHFCRIPVIAHESDITPGLANRIAVPYCTK
MURG_THEEB      LRPLWQFWGVFWQTRQLLKQGDFQGVFTTGGYIAAPAILAARSLGRVAILHESNALPGKVTRWLAPWCTL
MURG_PROVI      VRGLRRXXXXXXXXXXLVRRERPDVVVGTGGFVSAPVLFAAQLLGKKTLIQEQNAFPGVTTRLLSALATE
MURG_ELUMP      IIFCYKFIVSFWQTLGIINAFKPDVCVGMGGYLSFPVIVWAKIKGIKSAVHDSNTKIGLANKICAKFTNI
MURG_CHLPD      GALVDNLGVAVRSALAIINSESPDVVVGTGGFVSAPLLLAAQMRGKKTLIQEQNAFPGVTTKLLSLFASE
MURG_SYNJB      XXXXXXXXXXXXXXXXMSGRFD--IVLTTGGYIAAPAILAARSLGVPVLLHESNWIPGKVTRWLGRFCQV
MURG_HELPS      IGSLFLQXXXXXXXXEILKKHQITHTISVGGFSAGPASFASLLNKIPLYIHEQNAIKGSLNRYLSPKAKA
MURG_FRATT      -------------------------VIGFGGYVSGPICLAAAQINIPVIIHEQNAKIGLTNRILAKFATT
MURG_FRAT1      -------------------------VIGFGGYVSGPICLAAAQINIPVIIHEQNAKIGLTNRILAKFATT
MURG_SYNPX      XXXXXXXXXXXXXXXXXIRRERIQLVLSTGGYIAAPAILAARFCGVPTVLHEANAIPGRVTRLLGRFCXX
MURG_FRATW      -------------------------VIGFGGYVSGPICLAAAQINIPVIIHEQNAKIGLTNRILAKFATT
MURG_FRATO      -------------------------VIGFGGYVSGPICLAAAQINIPVIIHEQNAKIGLTNRILAKFATT
MURG_FRATM      -------------------------VIGFGGYVSGPICLAAAQINIPVIIHEQNAKIGLTNRILAKFATT
MURG_FRATH      -------------------------VIGFGGYVSGPICLAAAQINIPVIIHEQNAKIGLTNRILAKFATT
MURG_FRATF      -------------------------VIGFGGYVSGPICLAAAQINIPVIIHEQNAKIGLTNRILAKFATT
MURG_DICTD      ------YYLSIKDALKILGELEPDILVVFGSYITVPIIVASIIKKLPFFLHEQNVIPGRVTKLFYRFSQG
MURG_CORJK      ATLPLRLRKALKETKRVLREVEADVVIGFGGYVSAPAYLAARSLKIPFFVHEANARAGVANK-LGVKL--
MURG_ACIAD      LLAPFKILKATYSAMRYMKQLKXXXXXXXXXXXXXXXXXXXRILGIPILIHEQNAVAGFTNTQLARVASK
MURG_ACIBY      LAAPFKILKATFSAMRYMKQLKXXXXXXXXXXXXXXXXXXXXXXXIPVLIHEQNAVAGFTNAQLSRVAKV
MURG_ACIBC      LAAPFKILKATFSAMRYMKQLKXXXXXXXXXXXXXXXXXXXXXXXIPVLIHEQNAVAGFTNAQLSRVAKV
MURG_ACIB5      LAAPFKILKATFSAMRYMKQLKXXXXXXXXXXXXXXXXXXXXXXXIPVLIHEQNAVAGFTNAQLSRVAKV
MURG_ACIB3      LAAPFKILKATFSAMRYMKQLKXXXXXXXXXXXXXXXXXXXXXXXIPVLIHEQNAVAGFTNAQLSRVAKV
MURG_DICT6      ------YYLSISDAIKILNEVKPDILVVFGSYITVPVIIASIVKKYPFFLHEQNVVPGRVTKLFYEFSEG
MURG_METPP      XXXXXXXXXAFAACAKILRRRATTAVLGMGGYVCFPGGLMASLLGKPLILVNADAALLMSNRALKP-VXX
MURG_ACIBS      LAAPFKILKATFSAMRYMKQLKXXXXXXXXXXXXXXXXXXXXXXXIPVLIHEQNAVAGFTNAQLSRVAKV
MURG_FRAP2      ---------------------------GFGGYVSGPICLAAVQKDIPIIIHEQNAKIGLTNRILAKLATK
MURG_CLOK5      FTDPFKVIKGIFQAIFIMRKEKPNVVFSKGGFVSVPVVFAAYINGIPVIAHESDITPGLANRLSSPYCTK
MURG_CYAP7      VKILLGLFSSVFQVRKLLRERKIDIVFTTGGYIASPAILAARLEGIPVILHESNYLPGKVTRFFSRWCQT
MURG_CORGB      LKLPFRVAKALGQARKALKDTDAQAVIGFGGYVSAPAYMAAKSLGLPFFVHEANARAGM--XXXXXXXXX
MURG_RHOE4      VKLPTRILASVRKTREVLDSVDADVIVGFGGYVALPAYXXXXXXXIPIVIHEANASAGIANKILATRVLA
MURG_DESDG      AA----MTAGVARGMRLVGRFNPDXXXXXXXXXXXXXXXXXKLREKPCAVHEQNSVPGMANRLLAKIADR
MURG_CORGL      LKLPFRVAKALGQARKALKDTDAQAVIGFGGYVSAPAYMAAKSLGLPFFVHEANARAGM--XXXXXXXXX
MURG_AMOA5      LISLWKV-------KRIIKDFKPNVVIGTGGYAGFPTIYMAARMHIPIVLQEQNAYAGVANRLLAKYAHK
MURG_ALISL      XIAPFQIIGAILQAKKHIQAWQPDVVLGMGGYVSGPGGIAAWLSGIPVVLHEQNAVAGLTNQWLSKIAKR
MURG_VESOH      IKAPFLLSYATLQVIKIFLKFKPDVVLGMGGFTSGIGGLVAWVFKTTLVIHEQNSIPGTTNKIL----NK
MURG_HELPG      IGSLFLQXXXXXXXXEILKNHQITHTISVGGFSAGPASFASLLNKIPLYIHEQNAIKGSLNRYLSPKAKA
MURG_BACTN      ARSQWK-------ARSIIKNFRPQVAVGVGGYASGPTLKTAGMMGVPTLIQEQNSYAGVTNKLLAQKAKA
MURG_ACIBT      LAAPFKILKATFSAMRYMKQLKXXXXXXXXXXXXXXXXXXXXXXXIPVLIHEQNAVAGFTNAQLSRVAKV
MURG_THEP1      PKNLWRLKIGIATVKKHLKRFKPDLVVLTGGYISGVVGLAAKDLGIPIFVHEQNVVPGLAVKVLSQYAKK
MURG_THEMA      PKNLWRLKIGIATVKKHLKRFKPDLVVLTGGYISGVVGLAAKDLGIPIFVHEQNVVPGLAVKVLSQYAKK
MURG_HELHP      IKAIFKQLKAAWEARNILKKHKIEYXXXXXXXXXXXXXXXXXLSNTPLFIHEQNAIKGKLNEILTPFAKA
MURG_AQUAE      LKAIWKF---LKAQEEINEFLKEYRALIFGGYASLPLGINTVLRRKELFIHEQNSIPSKTNKILSKKAKK
MURG_PELUB      IFMIFLIFKSISFFR----KNKIDTLISTGGYMSLPLCLGARILNIKLLLFEPNMVLGRSNKFFLSYCQK
MURG_HELAH      IGSXXXXXXXXXXXXXXXXXHQITHTISVGGFSAGPASFASLLNKIPLYIHEQNAIKGSLNRYLSPKAKA
MURG_SULNB      LKSLWMMLQAMMKARKLLKKYDAKVVXXXXXXXXXXXXXXXXXXXXPLVIHEQNAALGSLNKLL----RP
MURG_THEFY      LSVPGRLANAISTAAKHLDRVQADILVGFGGYVATPGYLAARSRRIPIVVHEANPLPGLANRLGARLTPH
MURG_MYCS2      LRLPMRVRTAIRQTRDVLTGVNADVVVGFGGYVALPAYLAARGRKVPVVVHEANARAGLANRVGARSARR
MURG_CORDI      FKLPFRLLATISQTRKILKEFDTDVVIGFGGYVAAPAYIAAKLQKIPFIVHEANARSGMANK-LGVRL--
MURG_XANAC      SXXXXXXXXXXXXAPXVLRKRQPRAVISXXXXXXXXXXXXXXXXXXXXXVHEQNRAPGMTNKVLSRFARR
MURG_ROSS1      VRNLITLARGTGAAHRLIARDRPAAILGTGGYVCVPVFLAARLACVPTVIYQPDVVPGXXXXXXXXXXXA
MURG_STRAW      ITVPGRLRGTIKAAEQILERTKADAVVGFGGYVALPGYLAAKRLGVPIVIHEANARPGLANK-IGSRYAA
MURG_MYCUA      ARLPPRVWRSVRETRXXXXXXXXXXXIGFGGYVALPAYLAARGIRIPVVIHEANARAGLANRVGLRTADR
MURG_LACLA      LKTAYKFFKSVSDAKKIMKEFKPDVVLXXXXXXXXXXXXXXXQLKIPTIIHEGNSFPGITNRFLAKKVDR
MURG_CAMHC      ILSLFKILALSFGCRKIFAKHDVKAVISVGGYSSAPAAFWAVANKIPLFIHEQNAEIGKINALLKRFAKR
MURG_DEIDV      -RELFXXXXXXXXXXXXLQARRPALVVGYGGFASLPGVLAAQSLGIATVLHEQNARLGLTQXXXXXXXXX
MURG_MYCMM      ARLPPRVWRAVRETRXXXXXXXXXXXIGFGGYVALPAYLAARGIRIPVVIHEANARAGLANRVGLRTADR
MURG_VEREI      XXXXXXXXXXFWQARAVLRRVQPDVLVGLGGYISFPGALMGLLRRKPLVLHEQXXXXXXXXXXXXXXXDR
MURG_MYCLE      ARLPLRVWRAVRETRXXXXXXXXXXXXXXXGYVALPAYLAARGXXXXXXXHEANARAGIANRVTAERVSA
MURG_MYCLB      ARLPLRVWRAVRETRXXXXXXXXXXXXXXXGYVALPAYLAARGXXXXXXXHEANARAGIANRVTAERVSA
MURG_MYCSS      ARLPMRVRRAVRETREILDTVHADVVIGFGGYVALPAYLAARRNRVPIVVHEANASAGLANKVGARFARR
MURG_MYCSK      ARLPMRVRRAVRETREILDTVHADVVIGFGGYVALPAYLAARRNRVPIVVHEANASAGLANKVGARFARR
MURG_STRCU      ITVPGRLRGTIKAAEQILERTKADCVVGFGGYVALPGYLAAKRLGVPIVIHEANARPGLANKRYAARVAR
MURG_CLOTE      FTDPFKVLKGIMEARKIIKKEKPNIVFSKGGFVAVPVVIGAYLNKVPVISHESDMTPGLANKLSTPYCNK
MURG_NITSB      -------------------------------------------LNLPLFIHEQNAVKGKLNRLLSPFAKR
MURG_WOLSU      IRSLSSQFQAMLEARKILKNHQIKRVVSVGGYXXXXXXXXXXXXGIPLYIHEQNAKVGLLNRLL----KP
MURG_ACIC1      LAVPSRLRAAVGEVERILAETGADVLVGFGGYVALPGYLAARRTGLPYVVHEANARPGLANRARFTRYVA
MURG_CLOPS      FTDPFKVLKGVMDASRILSKEKPDVIFSKGGFVTVPVVIAASMKKIPVVSHESDLTPGLANKIASPFCDT
MURG_CAMJD      ISSLLHTLKLSKDCREIFKKYHIQAVFSVGGYXXXXXXXXXXXXHLPLFIHEQNSKSGSLNMLL----KP
MURG_BIFLO      MLRFPAKWKRETAKVRSILETRHADVVGFGGYASAPVYATAHKMGIPIAIHEQNARAGMANKLGARWADF
MURG_BIFLD      MLRFPAKWKRETAKVRSILETRHADVVGFGGYASAPVYATAHKMGIPIAIHEQNARAGMANKLGARWADF
MURG_SACEN      ----------VKRTREVLDRVGADVVVGFGGYVSLPAYLAARGK-TPIVVHEANARAGLANKVGAKFAER
MURG_LEPBL      FLFPFRYTIQILKTFLLFKKLNVDVVIGMGGYSTVSSILYGILFKKKIYLCEQNTVPGNVSRLFFRFANK
MURG_LEPBJ      FLFPFRYTIQILKTFLLFKKLNVDVVIGMGGYSTVSSILYGILFKKKIYLCEQNTVPGNVSRLFFRFANK
MURG_TROWT      LCFPFKFFSSVKLVRSILIEHKIQXXXXXXXXXXXXXXXXXISLNIPYVVHESNARPGLAN-LLAAHFAK
MURG_TROW8      LCFPFKFFSSVKLVRSILIEHKIQXXXXXXXXXXXXXXXXXISLNIPYVVHESNARPGLAN-LLAAHFAK
MURG_GEOTN      LKGVWQ-------AYRLIQKEKPDIVFSKGGFVSVPVILGAWLNGVPSVIHESDLTPGLANKIAMPFATK
MURG_CLOPE      FTDPFKVLKGVMDASRILSKEKPDVIFSKGGFVTVPVVIAASMKKIPVVSHESDLTPGLANKIASPFCDT
MURG_CLOP1      FTDPFKVLKGVMDASRILSKEKPDVIFSKGGFVTVPVVIAASMKKIPVVSHESDLTPGLANKIASPFCDT
MURG_BIFLI      LRFPAKWKRETAKVRSILETRHADVVAGFGGYASAPVYATAHKMGIPIAIHEQNARAGMANKLGARWADF
MURG_CLOBB      FSDPFKVLKGIKDANRILKKEKPDVIFSKGGFVAVPVVIAAHLRKIPVVAHESDMTPGLANKLSAPFCNK
MURG_THESQ      PKNLWRLKIGIATVKKHLKRFKPDLVVLTGGYISGVVGLAAKDLGIPIFVHEQNVVPGLAVKVLSQYAKK
MURG_THENN      PKNFWKVVNAILKAKKELLRFKPDVIVLTGGYISGVVGLAAKNMGVPIFLHEQNVVPGLAVKTVAKYARK
MURG_CLOBA      FSDPFKVLKGIKDANKILKKEKPDVVFSKGGFVAVPVVIAAHLRKIPVVAHESDMTPGLANKLSAPFCSK
MURG_STAAB      AKDVFKVLKGILDARKVLKKEKPDLLFSKGGFVSVPVVIAAKSLNIPTIIHESDLTPGLANKIALKFAKK
MURG_STRCO      ITVPGRLRGTIKATEQILERTKADAVAGFGGYVALPAYLAAKRLGVPIVVHEANARPGLANK-IGSRYAA
MURG_STAAR      AKDVFKVLKGILDARKVLKKEKPDLLFSKGGFVSVPVVIAAKSLNIPTIIHESDLTPGLANKIALKFAKK
MURG_GEOSW      FKDPFKVLKGTFQAYRIIKKEKPSIVFSKGGFVSVPVIIGAWLNGVPSIIHESDITPGLANKIAMPFATK
MURG_GEOKA      LKGVWQ-------AYRLIQKEKPDVVFSKGGFVSVPVILGAWLNGVPSVIHESDLTPGLANKIAMPFATK
MURG_WIGBR      ----------------------PDIVLSIGGYVSFPGAIATWISKVPLIIHEQNSVPGLSNYILYKLTNC
MURG_STAAW      AKDVFKVLKGILDARKVLKKEKPDLLFSKGGFVSVPVVIAAKSLNIPTIIHESDLTPGLANKIALKFAKK
MURG_STAAS      AKDVFKVLKGILDARKVLKKEKPDLLFSKGGFVSVPVVIAAKSLNIPTIIHESDLTPGLANKIALKFAKK
MURG_STAAN      AKDVFKVLKGILDARKVLKKEKPDLLFSKGGFVSVPVVIAAKSLNIPTIIHESDLTPGLANKIALKFAKK
MURG_STAAM      AKDVFKVLKGILDARKVLKKEKPDLLFSKGGFVSVPVVIAAKSLNIPTIIHESDLTPGLANKIALKFAKK
MURG_STAAE      AKDVFKVLKGILDARKVLKKEKPDLLFSKGGFVSVPVVIAAKSLNIPTIIHESDLTPGLANKIALKFAKK
MURG_STAAC      AKDVFKVLKGILDARKVLKKEKPDLLFSKGGFVSVPVVIAAKSLNIPTIIHESDLTPGLANKIALKFAKK
MURG_STAA9      AKDVFKVLKGILDARKVLKKEKPDLLFSKGGFVSVPVVIAAKSLNIPTIIHESDLTPGLANKIALKFAKK
MURG_STAA8      AKDVFKVLKGILDARKVLKKEKPDLLFSKGGFVSVPVVIAAKSLNIPTIIHESDLTPGLANKIALKFAKK
MURG_STAA2      AKDVFKVLKGILDARKVLKKEKPDLLFSKGGFVSVPVVIAAKSLNIPTIIHESDLTPGLANKIALKFAKK
MURG_STAA1      AKDVFKVLKGILDARKVLKKEKPDLLFSKGGFVSVPVVIAAKSLNIPTIIHESDLTPGLANKIALKFAKK
MURG_CLOBM      FSDPFKVLKGVFQAKKIIKREKPDIVFSKGGFVTVPVVIAAHLNKIPVIAHESDITPGLANKLATPYCTR
MURG_CAMJR      -----------KDCREIFKKYHIQAVFSVGGYXXXXXXXXXXXXHLPLFIHEQNSKSGSLNMLLKPFATK
MURG_CAMJJ      -----------KDCREIFKKYHIQAVFSVGGYXXXXXXXXXXXXHLPLFIHEQNSKSGSLNMLLKPFATK
MURG_CAMJE      -----------KDCREIFKKYHIQAVFSVGGYXXXXXXXXXXXXHLPLFIHEQNSKSGSLNMLLKPFATK
MURG_CAMJ8      -----------KDCREIFKKYHIQAVFSVGGYXXXXXXXXXXXXHLPLFIHEQNSKSGSLNMLLKPFATK
MURG_STAAT      AKDVFKVLKGILDARKVLKKEKPDLLFSKGGFVSVPVVIAAKSLNIPTLIHESDLTPGLANKIALKFAKK
MURG_STAA3      AKDVFKVLKGILDARKVLKKEKPDLLFSKGGFVSVPVVIAAKSLNIPTLIHESDLTPGLANKIALKFAKK
MURG_MYCSJ      ARLPMRVRRAVRETREILDTVHADVVIGFGGYVALPAYLAARRNRVPIVVHEANASAGLANKVGARFARR
MURG_CLOB8      VKNFFKILKGIAQALKILSKEKPDVIFSKGGFVAVPVVIAASIKKIPVVAHESDMTPGLANKLSAPFCDK
MURG_THEAB      IKRLFKIFNANNIVLKELKKFKPDIVFVTGGYVSYPVGTAAKKLKIPLYIQEQNVIPGLANIKLSSFAKK
MURG_BACSK      VTDIARIANGFRQARKILKAEKPDVVFSKGGFVTVPVVAAAYTLRIPVHLHESDLTPGLANRLAKRFANT
MURG_STRU0      LIDVFKVATGLLQSLVIINKVKPQALFSKGGFVSVPPVIASRLMGVPVFVHESDLSMGLANKIA------
MURG_STACT      IKDVFKVLKGVLDARKVLKKQKPDLLFSKGGFVSVPVVIAARSLNIPVVIHESDITPGLANKISLKFAKK
MURG2_BACCZ     IKDPFLVMKGVMDAYVRIRKLKPDVIFSKGGFVSVPVVIGGWLNRVPVLLHESDMTPGLANKIALRFASK
MURG2_BACCR     IKDPFLVMKGVMDAYVRIRKLKPDVIFSKGGFVSVPVVIGGWLNRVPVLLHESDMTPGLANKIALRFASK
MURG2_BACC1     IKDPFLVMKGVMDAYVRIRKLKPDVIFSKGGFVSVPVVIGGWLNRVPVLLHESDMTPGLANKIALRFASK
MURG_LEPIN      NFFLFPIRYTIQXXXXXXXXLNIDVVIGMGGYSTVSSILYGIFFRKKIYLCEQNTIPGNVNRLFFRFASK
MURG_LEPIC      NFFLFPIRYTIQXXXXXXXXLNIDVVIGMGGYSTVSSILYGIFFRKKIYLCEQNTIPGNVNRLFFRFASK
MURG3_BACAH     IKDPFLVMKGVMDAYVRIRKLKPDVIFSKGGFVSVPVVIGGWLNRVPVLLHESDMTPGLANKIALRFASK
MURG2_BACHK     IKDPFLVMKGVMDAYVRIRKLKPDVIFSKGGFVSVPVVIGGWLNRVPVLLHESDMTPGLANKIALRFASK
MURG2_BACAN     IKDPFLVMKGVMDAYVRIRKLKPDVIFSKGGFVSVPVVIGGWLNRVPVLLHESDMTPGLANKIALRFASK
MURG_OCEIH      LKDPFKVLKGTMQAYRIIGKRKPSIVFSKGGFVSVPVVAAAKLRGVPSIIHESDYTPGLANKLSIPFTKR
MURG_STAHJ      AKDVFKVLKGVIDARKVLKREKPDLLFSKGGFVSVPVVIAARSLNIPTIIHESDLTPGLANKISLKFAKK
MURG_CLAMS      VRFAPAFTRAVGQIRRMIAERXXXXXXXXXXXXXXXXXXXXRRSGVPVVVHEANASPGLANR-LGARVAT
MURG_STRGC      FKVIWGIFQSLS----IMLKVRPQALFSKGGFVSVPPVIAARLSGVPVYVHESDLSIGLANKIAYKCATK
MURG3_BACCR     LRRYWKIIRGCLQSYNLIKKTKPDVIFSAGGFVSVPVAIGAWLNRVPIIIREPDSTLGLANKIALPFATK
MURG_STRS7      LLDIFKVGFGVMQSLFIIARLRPKALFSKGGFVSVPPVIAARLLGVPAFIHESDLSMGLANRIAYRFATT
MURG_STREM      LLDAFKVGFGVMQSLFIIARLRPKALFSKGGFVSVPPVIAARLLGVPAFIHESDLSMGLANRIAYRFATT
MURG_XANCP      LGAPXXXXXXXXXXGFVLRKRQPRAVISXXXXXXXXXXXXXXXXXXXXXXHEQNRAPGMTNKVLSRFARR
MURG_XANCB      LGAPXXXXXXXXXXGFVLRKRQPRAVISXXXXXXXXXXXXXXXXXXXXXXHEQNRAPGMTNKVLSRFARR
MURG_XANC8      LGAPXXXXXXXXXXGFVLRKRQPRAVISXXXXXXXXXXXXXXXXXXXXXXHEQNRAPGMTNKVLSRFARR
MURG_STRP6      LADVFKVALGLLQSLFIVAKLRPQALFSKGGFVSVPPVVAAKLLGKPVFIHESDRSMGLANKIAYKFATT
MURG_STRPG      LADVFKVALGLLQSLFIVAKLRPQALFSKGGFVSVPPVVAAKLLGKPVFIHESDRSMGLANKIAYKFATT
MURG1_BACAH     LRRYWKIIKGCIQSYKLMKRIKPDVIFSAGGFVSVPVVIGAWMNKVPVIIREPDSTLGLANKIALPFTTK
MURG_STRPD      LADVFKVALGLLQSLFIVAKLRPQALFSKGGFVSVPPVVAAKLLGKPVFIHESDRSMGLANKIAYKFATT
MURG_STRP3      LADVFKVALGLLQSLFIVAKLRPQALFSKGGFVSVPPVVAAKLLGKPVFIHESDRSMGLANKIAYKFATT
MURG_STRMU      VLDVFKVGWGVLQSLTIMVKVRPQVLFSKGGFVSVPPVVAANLLRIPVFVHESDLSMGLANRIAYKFATT
MURG_CLOB6      FSDPFKVLKGVFQAKKIIKKEKPDIVFSKGGFVTVPVVIAAHLNKIPVIAHESDITPGLANKLATPYCTR
MURG_THELT      PSNFTRLLKISQSESIIALEIKQCDFLMTGGYISYPVGKVCKKLKKPFFIQEQNVVPGLANKALSLSAKK
MURG_SYMTH      ISSXXXXXXXXXXXXXXIRRFRPDIVIGTGGFXXXXXXXXXXXXXXXXXIQEQNAFPGVTNRLAARWATA
MURG_STRE4      LLDIFKVGFGVMQSLFIIARLRPKALFSKGGFVSVPPVIAARLLGVPAFIHESDLSMGLANRIAYRFATT
MURG_STRPZ      LADVFKVALGLLQSLFILAKLRPQALFSKGGFVSVPPVVAAKLLGKPVFIHESDRSMGLANKIAYKFATT
MURG_STRPM      LADVFKVALGLLQSLFIVAKLRPQALFSKGGFVSVPPVVAAKLLGKPVFIHESDRSMGLANKIAYKFATT
MURG_STRP8      LADVFKVALGLLQSLFIVAKLRPQALFSKGGFVSVPPVVAAKLLGKPVFIHESDRSMGLANKIAYKFATT
MURG_STRP1      LADVFKVALGLLQSLFIVAKLRPQALFSKGGFVSVPPVVAAKLLGKPVFIHESDRSMGLANKIAYKFATT
MURG_STAS1      IKDIFKVLKGVLDARSVLKKEKPDLLFSKGGFVSVPVVIAAKSLKIPTIIHESDLTPGLANKISLKFAKK
MURG_CLOBL      FSDPFKVLKGVFQAKKIIKREKPDIVFSKGGFVTVPVVIAAHLNKIPVIAHESDITPGLANKLATPYCTR
MURG_CLOBK      FSDPFKVLKGVFQAKKIIKREKPDIVFSKGGFVTVPVVIAAHLNKIPVIAHESDITPGLANKLATPYCTR
MURG_STRPC      LADVFKVALGLLQSLFIIAKLRPQALFSKGGFVSVPPVVAAKLLGKPVFIHESDRSMGLANKIAYKFATT
MURG_STRPB      LADVFKVALGLLQSLFIIAKLRPQALFSKGGFVSVPPVVAAKLLGKPVFIHESDRSMGLANKIAYKFATT
MURG_CLOBJ      FSDPFKVLKGVFQAKKIIKREKPDIVFSKGGFVTVPVVIAAHLNKIPVIAHESDITPGLANKLATPYCTR
MURG_CLOBH      FSDPFKVLKGVFQAKKIIKREKPDIVFSKGGFVTVPVVIAAHLNKIPVIAHESDITPGLANKLATPYCTR
MURG_CLOB1      FSDPFKVLKGVFQAKKIIKREKPDIVFSKGGFVTVPVVIAAHLNKIPVIAHESDITPGLANKLATPYCTR
MURG_TREPS      ---VFRVLVGTVQSYCILRALRPQALFSKGGFVSVPPCIAAWLLRIPVVTHESDISPGLATRINARFADR
MURG_TREPA      ---VFRVLVGTVQSYCILRALRPQALFSKGGFVSVPPCIAAWLLRIPVVTHESDISPGLATRINARFADR
MURG_ARTAT      VKLPARLSGAVRQARRILEEARADVLVGVGGYVCTPMYLAARKLRIPIVIHEANMKAGLANRVGARFSNH
MURG_STRPF      LADVFKVALGLLQSLFIVAKLRPQALFSKGGFVSVPPVVAAKLLGKPVFIHESDRSMGLANKIAYKFATT
MURG_RUBXD      ----------------------PGAVL