[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for atum0:AAK87903.2

[Show Plain Result]


## Summary of Sequence Search
    1::415
    4::403     6e-70  38%  413 aa  YIHS_ECOLI RecName: Full=Uncharacterized sugar isomerase yihS;     
   34::312     2e-06  28%  387 aa  MANA_RHIME RecName: Full=Mannose-6-phosphate isomerase;       
  246::375     2e-05  32%  419 aa  RENBP_RAT RecName: Full=N-acylglucosamine 2-epimerase;       
  246::375     3e-05  32%  419 aa  RENBP_MOUSE RecName: Full=N-acylglucosamine 2-epimerase;       
    1::415

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxWNTLPWHRQWLVKQVEGLFDFFQHRALNPAGGFFDLDAKGAPLQANDPVRGIHASARMVH
YIHS_ECOLI      ----------FNTLS-HNRWLEQETDRIFDFGKNSVVPT--GFGWLGNKG---QIKEEM-GTHLTARMLH
MANA_RHIME      ----------------------------------------GGFVEIDMKGEPTRDD---RRSRVQPRQVY
RENBP_RAT       ----------------------------------------------------------------------
RENBP_MOUSE     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           CFSIGHLLGRPGCGDIVDHGMTYLWNNHRDGEHGGYFWQVNDAGPVDATKQGYGHAFVLLAASSAKTVGH
YIHS_ECOLI      VYSVAAAMGRPGAYSLVDHGIKAMNGALRDKKYGGWYACVNDEGVVDASKQGYQHFFALLGAASAVTTGH
MANA_RHIME      CFAAAGRRGWDGDWRTAAEG-GLLYFDRVYGQPGGFYGALANADGIDASFDLYNQXXXXXXXXXXXEVLP
RENBP_RAT       ----------------------------------------------------------------------
RENBP_MOUSE     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           PLADQMLADITEVLETRFWEEKHGAIAEEFNRDWSPIDNYRGQNSNMHLTEALMAAYEATGDSNYLTKAE
YIHS_ECOLI      PEARKLLDYTIEIIEKYFWSEEEQMCLESWDEAFSKTEEYRGGNANMHAVEAFLIVYDVTHDKKWLDRAI
MANA_RHIME      ERGAEMVGRSDKLRRQLEARCKHPLAGEEDDPPRLPL----GSNPHMHLFEACLASEEVEGFDRWANLAD
RENBP_RAT       ----------------------------------------------------------------------
RENBP_MOUSE     ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RIADLVIRRRAGELDFRVPEHFDENWTLDKAYRGNEMFRPSGSTPGHWLEWARLILQLWVLGERQHDWMP
YIHS_ECOLI      RVASVIIHDVARNNHYRVNEHFDTQWNPLPDYNKDHRFRAFGGTPGHWIEWGRLMLHIHAALEARCEWLL
MANA_RHIME      EIAHLAMDRFIDAESGALREFFDHDWAPFPGEKGRIV------EPGHLFEWAWLLLR-WA-ERRGNAQAI
RENBP_RAT       --------------------------------------------PGHTLEAGWFLLQYAL---RKGD--P
RENBP_MOUSE     --------------------------------------------PGHTLEAGWFLLQYALRKGDPKLRMH


                         .         *         .         .         .         .         +:350
query           VAAKSLFVQSMALGWDREKGGFFYTLDWNDNPDKRAKLWWPMCEAAGAAHFLNENLPADAFYEDSYRRIW
YIHS_ECOLI      EDAKGLFNATVRDAWAPDADGIVYTVDWEGKPVVRERVRWPIVEAMGTAYAL-YTVTGDRQYETWYQTWW
MANA_RHIME      VKARRLFEIGEKDGTCPDRDVVVMTLDDFSVADPTARL-WPQTEWLKAA---------------------
RENBP_RAT       KLQRHIIDKFLLLGWDPEHGGLFYFQDADDQLEWNMKLWWPHTEAM-IAFLMGYRDSGDPALLNLFYQVA
RENBP_MOUSE     IIDKFLLLPFHS-GWDPEHGGLFYQLEWN------MKLWWPHSEAM-IAFLMGYSDSGDPALLHLFYKVA


                         .         .         .         .         *         .         .:420
query           STIANNFIDHENGGWHEELTEDLVPAHTLFPGKGDIYHALQACLIPLFPAAGSLTTVIxxxxxxx
YIHS_ECOLI      EYCIKYLMDYENGSWWQELDADNKVTTKVWDGKQDIYHLLHCLVIPRIPLAPGMAPAV-------
MANA_RHIME      -----------------------------------------------------------------
RENBP_RAT       EYTFHQFRDPEYGEWFGYLNQEGKVALTIKGG---------------------------------
RENBP_MOUSE     EYTFRQFRDPEYGEWFGYLNQEGKVALTIKGG---------------------------------