[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for atum0:AAK87951.1

[Show Plain Result]


## Summary of Sequence Search
    1::113
    6::109     2e-34  64%  110 aa  CSAA_BACSU RecName: Full=Protein csaA;
  574::672     7e-15  41%  680 aa  SYM_PORG3 RecName: Full=Methionyl-tRNA synthetase;       
  574::672     3e-14  40%  680 aa  SYM_PORGI RecName: Full=Methionyl-tRNA synthetase;       
  580::686     6e-14  37%  687 aa  SYM_BDEBA RecName: Full=Methionyl-tRNA synthetase;       
  574::678     4e-13  38%  679 aa  SYM_PARD8 RecName: Full=Methionyl-tRNA synthetase;       
  574::678     6e-13  38%  679 aa  SYM_BACTN RecName: Full=Methionyl-tRNA synthetase;       
  547::650     8e-13  36%  651 aa  SYM_METJA RecName: Full=Methionyl-tRNA synthetase;       
  606::707     8e-13  34%  711 aa  SYM_FLAJ1 RecName: Full=Methionyl-tRNA synthetase;       
  574::678     1e-12  38%  679 aa  SYM_BACFR RecName: Full=Methionyl-tRNA synthetase;       
  574::678     1e-12  38%  679 aa  SYM_BACFN RecName: Full=Methionyl-tRNA synthetase;       
  574::679     2e-12  39%  680 aa  SYM_BACV8 RecName: Full=Methionyl-tRNA synthetase;       
  609::681     7e-12  51%  715 aa  SYM_LEPIN RecName: Full=Methionyl-tRNA synthetase;       
  609::681     7e-12  51%  715 aa  SYM_LEPIC RecName: Full=Methionyl-tRNA synthetase;       
  600::704     7e-12  35%  705 aa  SYM_CHLCH RecName: Full=Methionyl-tRNA synthetase;       
  604::696     2e-11  38%  710 aa  SYM_METBF RecName: Full=Methionyl-tRNA synthetase;       
  569::672     2e-11  33%  672 aa  SYM_META3 RecName: Full=Methionyl-tRNA synthetase;       
  580::660     2e-11  40%  686 aa  SYM_FLAPJ RecName: Full=Methionyl-tRNA synthetase;       
  579::672     5e-11  38%  688 aa  SYM_SHEWM RecName: Full=Methionyl-tRNA synthetase;       
  566::665     5e-11  39%  669 aa  SYM_METTP RecName: Full=Methionyl-tRNA synthetase;       
  595::682     6e-11  34%  700 aa  SYM_CHLT3 RecName: Full=Methionyl-tRNA synthetase;       
  556::659     6e-11  34%  660 aa  SYM1_BACAN RecName: Full=Methionyl-tRNA synthetase 1;       
  583::676     8e-11  38%  692 aa  SYM_SHESH RecName: Full=Methionyl-tRNA synthetase;       
  571::666     1e-10  39%  680 aa  SYM_THICR RecName: Full=Methionyl-tRNA synthetase;       
  554::655     1e-10  33%  659 aa  SYM_STAHJ RecName: Full=Methionyl-tRNA synthetase;       
  620::723     1e-10  35%  724 aa  SYM_PYRFU RecName: Full=Methionyl-tRNA synthetase;       
  609::714     1e-10  33%  715 aa  SYM_METMA RecName: Full=Methionyl-tRNA synthetase;       
  556::659     1e-10  34%  660 aa  SYM1_BACCR RecName: Full=Methionyl-tRNA synthetase 1;       
  574::680     1e-10  32%  684 aa  SYM_METBU RecName: Full=Methionyl-tRNA synthetase;       
  670::775     2e-10  33%  776 aa  SYM_NANEQ RecName: Full=Methionyl-tRNA synthetase;       
  574::657     2e-10  45%  681 aa  SYM_LEPBP RecName: Full=Methionyl-tRNA synthetase;       
  574::657     2e-10  45%  681 aa  SYM_LEPBA RecName: Full=Methionyl-tRNA synthetase;       
  534::637     3e-10  34%  638 aa  SYM_THETN RecName: Full=Methionyl-tRNA synthetase;       
  621::722     4e-10  34%  723 aa  SYM_PYRHO RecName: Full=Methionyl-tRNA synthetase;       
  618::721     4e-10  34%  722 aa  SYM_PYRAB RecName: Full=Methionyl-tRNA synthetase;       
  586::675     4e-10  34%  691 aa  SYM_GRAFK RecName: Full=Methionyl-tRNA synthetase;       
  525::628     5e-10  34%  629 aa  SYM_THEMA RecName: Full=Methionyl-tRNA synthetase;       
  566::659     5e-10  37%  675 aa  SYM_SHEAM RecName: Full=Methionyl-tRNA synthetase;       
  605::698     7e-10  37%  712 aa  SYM_METAC RecName: Full=Methionyl-tRNA synthetase;       
  559::663     7e-10  30%  664 aa  SYM_BACSU RecName: Full=Methionyl-tRNA synthetase;       
  552::653     9e-10  30%  657 aa  SYM_STAAR RecName: Full=Methionyl-tRNA synthetase;       
  552::653     9e-10  30%  657 aa  SYM_STAAN RecName: Full=Methionyl-tRNA synthetase;       
  552::653     9e-10  30%  657 aa  SYM_STAAM RecName: Full=Methionyl-tRNA synthetase;       
  552::653     9e-10  30%  657 aa  SYM_STAAC RecName: Full=Methionyl-tRNA synthetase;       
  563::667     9e-10  33%  668 aa  SYM_METKA RecName: Full=Methionyl-tRNA synthetase;       
  564::657     1e-09  36%  673 aa  SYM_SHELP RecName: Full=Methionyl-tRNA synthetase;       
  571::664     1e-09  34%  680 aa  SYM_PHOPR RecName: Full=Methionyl-tRNA synthetase;       
  597::696     1e-09  36%  702 aa  SYM_PELLD RecName: Full=Methionyl-tRNA synthetase;       
  575::684     1e-09  32%  685 aa  SYM_ACTSZ RecName: Full=Methionyl-tRNA synthetase;       
  553::654     1e-09  30%  658 aa  SYM_STAS1 RecName: Full=Methionyl-tRNA synthetase;       
  552::653     1e-09  30%  657 aa  SYM_STAAW RecName: Full=Methionyl-tRNA synthetase;       
  552::653     1e-09  30%  657 aa  SYM_STAAS RecName: Full=Methionyl-tRNA synthetase;       
  637::740     1e-09  31%  741 aa  SYM_PYRKO RecName: Full=Methionyl-tRNA synthetase;       
  551::647     1e-09  37%  656 aa  SYM_HELPJ RecName: Full=Methionyl-tRNA synthetase;       
  569::661     2e-09  34%  675 aa  SYM_TOLAT RecName: Full=Methionyl-tRNA synthetase;       
  551::652     2e-09  30%  656 aa  SYM_STAES RecName: Full=Methionyl-tRNA synthetase;       
  551::652     2e-09  30%  656 aa  SYM_STAEQ RecName: Full=Methionyl-tRNA synthetase;       
  607::670     2e-09  48%  704 aa  SYM_LEPBL RecName: Full=Methionyl-tRNA synthetase;       
  607::670     2e-09  48%  704 aa  SYM_LEPBJ RecName: Full=Methionyl-tRNA synthetase;       
  556::656     2e-09  33%  660 aa  SYM_BACHD RecName: Full=Methionyl-tRNA synthetase;       
  568::661     2e-09  37%  677 aa  SYM_AERHH RecName: Full=Methionyl-tRNA synthetase;       
  582::671     2e-09  38%  690 aa  SYM1_SORC5 RecName: Full=Methionyl-tRNA synthetase 1;       
  570::663     3e-09  36%  679 aa  SYM_SHEPA RecName: Full=Methionyl-tRNA synthetase;       
  561::663     3e-09  33%  664 aa  SYM_METHJ RecName: Full=Methionyl-tRNA synthetase;       
  567::660     3e-09  35%  676 aa  SYM_SHESR RecName: Full=Methionyl-tRNA synthetase;       
  567::660     3e-09  35%  676 aa  SYM_SHEON RecName: Full=Methionyl-tRNA synthetase;       
  574::680     3e-09  33%  681 aa  SYM_DEIRA RecName: Full=Methionyl-tRNA synthetase;       
  584::674     4e-09  35%  690 aa  SYM_VIBVY RecName: Full=Methionyl-tRNA synthetase;       
  584::674     4e-09  35%  690 aa  SYM_VIBVU RecName: Full=Methionyl-tRNA synthetase;       
  577::684     4e-09  37%  685 aa  SYM_NEIM0 RecName: Full=Methionyl-tRNA synthetase;       
  574::660     6e-09  41%  683 aa  SYM_SHEFN RecName: Full=Methionyl-tRNA synthetase;       
  560::661     6e-09  33%  662 aa  SYM_METB6 RecName: Full=Methionyl-tRNA synthetase;       
  545::632     6e-09  36%  650 aa  SYM_HELPY RecName: Full=Methionyl-tRNA synthetase;       
  573::663     7e-09  36%  679 aa  SYM_SHEHH RecName: Full=Methionyl-tRNA synthetase;       
  577::684     7e-09  37%  685 aa  SYM_NEIMB RecName: Full=Methionyl-tRNA synthetase;       
  577::684     7e-09  37%  685 aa  SYM_NEIMA RecName: Full=Methionyl-tRNA synthetase;       
  579::685     7e-09  36%  686 aa  SYM_MANSM RecName: Full=Methionyl-tRNA synthetase;       
  567::660     1e-08  34%  676 aa  SYM_SHESA RecName: Full=Methionyl-tRNA synthetase;       
  595::693     1e-08  32%  698 aa  SYM_PARUW RecName: Full=Methionyl-tRNA synthetase;       
  577::684     1e-08  37%  685 aa  SYM_NEIMF RecName: Full=Methionyl-tRNA synthetase;       
  567::660     1e-08  34%  676 aa  SYM_SHESM RecName: Full=Methionyl-tRNA synthetase;       
  577::670     1e-08  33%  686 aa  SYM_ALISL RecName: Full=Methionyl-tRNA synthetase;       
  579::682     2e-08  35%  683 aa  SYM_UNCMA RecName: Full=Methionyl-tRNA synthetase;       
  580::673     2e-08  34%  689 aa  SYM_SHESW RecName: Full=Methionyl-tRNA synthetase;       
  580::673     2e-08  34%  689 aa  SYM_SHEPC RecName: Full=Methionyl-tRNA synthetase;       
  578::666     2e-08  37%  690 aa  SYM_THIDA RecName: Full=Methionyl-tRNA synthetase;       
  633::732     2e-08  31%  733 aa  SYM_THEON RecName: Full=Methionyl-tRNA synthetase;       
  577::670     2e-08  36%  686 aa  SYM_PSYIN RecName: Full=Methionyl-tRNA synthetase;       
  576::683     2e-08  36%  684 aa  SYM_NEIG1 RecName: Full=Methionyl-tRNA synthetase;       
  572::678     2e-08  30%  682 aa  SYM_ACTPJ RecName: Full=Methionyl-tRNA synthetase;       
  572::678     2e-08  30%  682 aa  SYM_ACTP7 RecName: Full=Methionyl-tRNA synthetase;       
  569::675     2e-08  30%  679 aa  SYM_ACTP2 RecName: Full=Methionyl-tRNA synthetase;       
  571::672     3e-08  32%  673 aa  SYM_METLZ RecName: Full=Methionyl-tRNA synthetase;       
  555::644     4e-08  34%  660 aa  SYM_METS3 RecName: Full=Methionyl-tRNA synthetase;       
  568::652     8e-08  36%  677 aa  SYM_SACD2 RecName: Full=Methionyl-tRNA synthetase;       
  600::687     8e-08  38%  706 aa  SYM_NITEU RecName: Full=Methionyl-tRNA synthetase;       
  576::667     8e-08  36%  681 aa  SYM_HAHCH RecName: Full=Methionyl-tRNA synthetase;       
  605::702     8e-08  40%  723 aa  SYM_AZOSB RecName: Full=Methionyl-tRNA synthetase;       
  577::682     1e-07  35%  683 aa  SYM_HAES1 RecName: Full=Methionyl-tRNA synthetase;       
  574::670     1e-07  36%  684 aa  SYM_HAEDU RecName: Full=Methionyl-tRNA synthetase;       
  561::665     1e-07  26%  669 aa  SYM_ENTFA RecName: Full=Methionyl-tRNA synthetase;       
  569::667     1e-07  39%  679 aa  SYM_RHOBA RecName: Full=Methionyl-tRNA synthetase;       
  566::659     1e-07  33%  675 aa  SYM_PSEA6 RecName: Full=Methionyl-tRNA synthetase;       
  596::700     1e-07  32%  701 aa  SYM_NITEC RecName: Full=Methionyl-tRNA synthetase;       
  572::677     1e-07  32%  678 aa  SYM_MARAV RecName: Full=Methionyl-tRNA synthetase;       
  577::682     1e-07  35%  683 aa  SYM_HAES2 RecName: Full=Methionyl-tRNA synthetase;       
  585::659     2e-07  36%  694 aa  SYM_XANAC RecName: Full=Methionyl-tRNA synthetase;       
  574::669     2e-07  30%  683 aa  SYM_VIBCH RecName: Full=Methionyl-tRNA synthetase;       
  574::669     2e-07  30%  683 aa  SYM_VIBC3 RecName: Full=Methionyl-tRNA synthetase;       
  586::674     2e-07  37%  692 aa  SYM_METFK RecName: Full=Methionyl-tRNA synthetase;       
  545::648     2e-07  35%  649 aa  SYM_BACST RecName: Full=Methionyl-tRNA synthetase;       
  595::688     2e-07  33%  702 aa  SYM_XYLFT RecName: Full=Methionyl-tRNA synthetase;       
  595::688     2e-07  33%  702 aa  SYM_XYLF2 RecName: Full=Methionyl-tRNA synthetase;       
  564::662     2e-07  29%  663 aa  SYM_METVS RecName: Full=Methionyl-tRNA synthetase;       
  563::657     2e-07  37%  670 aa  SYM_LEGPL RecName: Full=Methionyl-tRNA synthetase;       
  563::657     2e-07  37%  670 aa  SYM_LEGPC RecName: Full=Methionyl-tRNA synthetase;       
  577::680     2e-07  32%  684 aa  SYM_HAEPS RecName: Full=Methionyl-tRNA synthetase;       
  571::676     3e-07  28%  677 aa  SYM_SALSV RecName: Full=Methionyl-tRNA synthetase;       
  606::705     3e-07  27%  713 aa  SYM_SALRD RecName: Full=Methionyl-tRNA synthetase;       
  571::676     3e-07  31%  677 aa  SYM_SALPC RecName: Full=Methionyl-tRNA synthetase;       
  564::662     3e-07  30%  663 aa  SYM_METM5 RecName: Full=Methionyl-tRNA synthetase;       
  566::657     3e-07  37%  670 aa  SYM_LEGPH RecName: Full=Methionyl-tRNA synthetase;       
  566::657     3e-07  37%  670 aa  SYM_LEGPA RecName: Full=Methionyl-tRNA synthetase;       
  595::681     4e-07  32%  702 aa  SYM_XYLFM RecName: Full=Methionyl-tRNA synthetase;       
  595::681     4e-07  32%  702 aa  SYM_XYLFA RecName: Full=Methionyl-tRNA synthetase;       
  571::676     4e-07  27%  677 aa  SYM_SALPK RecName: Full=Methionyl-tRNA synthetase;       
  571::676     4e-07  27%  677 aa  SYM_SALPA RecName: Full=Methionyl-tRNA synthetase;       
  571::676     4e-07  27%  677 aa  SYM_SALG2 RecName: Full=Methionyl-tRNA synthetase;       
  571::676     4e-07  27%  677 aa  SYM_SALEP RecName: Full=Methionyl-tRNA synthetase;       
  571::676     4e-07  27%  677 aa  SYM_SALCH RecName: Full=Methionyl-tRNA synthetase;       
  624::723     4e-07  35%  728 aa  SYM_NITMU RecName: Full=Methionyl-tRNA synthetase;       
  564::662     4e-07  31%  663 aa  SYM_METM7 RecName: Full=Methionyl-tRNA synthetase;       
  571::676     4e-07  28%  677 aa  SYM_ENT38 RecName: Full=Methionyl-tRNA synthetase;       
  584::673     4e-07  31%  689 aa  SYM_CYTH3 RecName: Full=Methionyl-tRNA synthetase;       
    4::109     5e-07  30%  110 aa  YGJH_ECOLI RecName: Full=tRNA-binding protein ygjH;
  562::663     5e-07  31%  664 aa  SYM_METMJ RecName: Full=Methionyl-tRNA synthetase;       
  587::675     7e-07  38%  696 aa  SYM_XANCP RecName: Full=Methionyl-tRNA synthetase;       
  587::675     7e-07  38%  696 aa  SYM_XANC8 RecName: Full=Methionyl-tRNA synthetase;       
  579::672     7e-07  30%  688 aa  SYM_VIBPA RecName: Full=Methionyl-tRNA synthetase;       
  577::670     7e-07  31%  686 aa  SYM_VIBFM RecName: Full=Methionyl-tRNA synthetase;       
  514::614     7e-07  33%  618 aa  SYM_THET8 RecName: Full=Methionyl-tRNA synthetase;       
  571::676     7e-07  28%  677 aa  SYM_SALAR RecName: Full=Methionyl-tRNA synthetase;       
  576::678     7e-07  30%  682 aa  SYM_HAEIE RecName: Full=Methionyl-tRNA synthetase;       
  553::658     7e-07  32%  658 aa  SYM_ARCFU RecName: Full=Methionyl-tRNA synthetase;       
  557::661     9e-07  32%  665 aa  SYM_STRR6 RecName: Full=Methionyl-tRNA synthetase;       
  557::661     9e-07  32%  665 aa  SYM_STRPN RecName: Full=Methionyl-tRNA synthetase;       
  571::676     9e-07  26%  677 aa  SYM_SALTY RecName: Full=Methionyl-tRNA synthetase;       
  571::676     9e-07  26%  677 aa  SYM_SALTI RecName: Full=Methionyl-tRNA synthetase;       
  571::676     9e-07  26%  677 aa  SYM_SALPB RecName: Full=Methionyl-tRNA synthetase;       
  571::676     9e-07  26%  677 aa  SYM_SALNS RecName: Full=Methionyl-tRNA synthetase;       
  571::676     9e-07  26%  677 aa  SYM_SALHS RecName: Full=Methionyl-tRNA synthetase;       
  571::676     9e-07  26%  677 aa  SYM_SALDC RecName: Full=Methionyl-tRNA synthetase;       
  571::676     9e-07  26%  677 aa  SYM_SALA4 RecName: Full=Methionyl-tRNA synthetase;       
  581::688     9e-07  35%  689 aa  SYM_CHRVO RecName: Full=Methionyl-tRNA synthetase;       
  571::676     1e-06  27%  677 aa  SYM_SHISS RecName: Full=Methionyl-tRNA synthetase;       
  571::676     1e-06  27%  677 aa  SYM_SHIFL RecName: Full=Methionyl-tRNA synthetase;       
  571::676     1e-06  27%  677 aa  SYM_SHIF8 RecName: Full=Methionyl-tRNA synthetase;       
  571::676     1e-06  27%  677 aa  SYM_SHIDS RecName: Full=Methionyl-tRNA synthetase;       
  571::676     1e-06  27%  677 aa  SYM_SHIBS RecName: Full=Methionyl-tRNA synthetase;       
  571::676     1e-06  27%  677 aa  SYM_SHIB3 RecName: Full=Methionyl-tRNA synthetase;       
  564::662     1e-06  29%  663 aa  SYM_METMP RecName: Full=Methionyl-tRNA synthetase;       
  571::676     1e-06  27%  677 aa  SYM_ESCF3 RecName: Full=Methionyl-tRNA synthetase;       
  571::676     1e-06  27%  677 aa  SYM_ECOUT RecName: Full=Methionyl-tRNA synthetase;       
  571::676     1e-06  27%  677 aa  SYM_ECOSM RecName: Full=Methionyl-tRNA synthetase;       
  571::676     1e-06  27%  677 aa  SYM_ECOSE RecName: Full=Methionyl-tRNA synthetase;       
  571::676     1e-06  27%  677 aa  SYM_ECOLU RecName: Full=Methionyl-tRNA synthetase;       
  571::676     1e-06  27%  677 aa  SYM_ECOLI RecName: Full=Methionyl-tRNA synthetase;       
  571::676     1e-06  27%  677 aa  SYM_ECOLC RecName: Full=Methionyl-tRNA synthetase;       
  571::676     1e-06  27%  677 aa  SYM_ECOL6 RecName: Full=Methionyl-tRNA synthetase;       
  571::676     1e-06  27%  677 aa  SYM_ECOL5 RecName: Full=Methionyl-tRNA synthetase;       
  571::676     1e-06  27%  677 aa  SYM_ECOK1 RecName: Full=Methionyl-tRNA synthetase;       
  571::676     1e-06  27%  677 aa  SYM_ECOHS RecName: Full=Methionyl-tRNA synthetase;       
  571::676     1e-06  27%  677 aa  SYM_ECODH RecName: Full=Methionyl-tRNA synthetase;       
  571::676     1e-06  27%  677 aa  SYM_ECOBW RecName: Full=Methionyl-tRNA synthetase;       
  571::676     1e-06  27%  677 aa  SYM_ECO8A RecName: Full=Methionyl-tRNA synthetase;       
  571::676     1e-06  27%  677 aa  SYM_ECO81 RecName: Full=Methionyl-tRNA synthetase;       
  571::676     1e-06  27%  677 aa  SYM_ECO7I RecName: Full=Methionyl-tRNA synthetase;       
  571::676     1e-06  27%  677 aa  SYM_ECO5E RecName: Full=Methionyl-tRNA synthetase;       
  571::676     1e-06  27%  677 aa  SYM_ECO57 RecName: Full=Methionyl-tRNA synthetase;       
  571::676     1e-06  27%  677 aa  SYM_ECO55 RecName: Full=Methionyl-tRNA synthetase;       
  571::676     1e-06  27%  677 aa  SYM_ECO45 RecName: Full=Methionyl-tRNA synthetase;       
  571::676     1e-06  27%  677 aa  SYM_ECO27 RecName: Full=Methionyl-tRNA synthetase;       
  571::676     1e-06  27%  677 aa  SYM_ECO24 RecName: Full=Methionyl-tRNA synthetase;       
  571::676     1e-06  27%  677 aa  SYM_CITK8 RecName: Full=Methionyl-tRNA synthetase;       
  577::670     2e-06  30%  686 aa  SYM_VIBSL RecName: Full=Methionyl-tRNA synthetase;       
  577::661     2e-06  33%  686 aa  SYM_VIBF1 RecName: Full=Methionyl-tRNA synthetase;       
  576::678     2e-06  29%  682 aa  SYM_HAEIG RecName: Full=Methionyl-tRNA synthetase;       
  604::696     2e-06  36%  718 aa  SYM_AZOSE RecName: Full=Methionyl-tRNA synthetase;       
  573::660     2e-06  36%  678 aa  SYM_ACIF5 RecName: Full=Methionyl-tRNA synthetase;       
  573::660     2e-06  36%  678 aa  SYM_ACIF2 RecName: Full=Methionyl-tRNA synthetase;       
  585::659     2e-06  34%  694 aa  SYM_XANC5 RecName: Full=Methionyl-tRNA synthetase;       
  576::681     2e-06  37%  686 aa  SYM_RALEH RecName: Full=Methionyl-tRNA synthetase;       
  575::680     2e-06  33%  689 aa  SYM_POLSJ RecName: Full=Methionyl-tRNA synthetase;       
  595::699     2e-06  30%  700 aa  SYM_PELPB RecName: Full=Methionyl-tRNA synthetase;       
  566::672     2e-06  28%  673 aa  SYM_OCEIH RecName: Full=Methionyl-tRNA synthetase;       
  569::660     2e-06  33%  674 aa  SYM_NITOC RecName: Full=Methionyl-tRNA synthetase;       
  576::678     2e-06  29%  682 aa  SYM_HAEIN RecName: Full=Methionyl-tRNA synthetase;       
  601::697     2e-06  30%  713 aa  SYM_COLP3 RecName: Full=Methionyl-tRNA synthetase;       
  585::659     3e-06  39%  694 aa  SYM_XANCB RecName: Full=Methionyl-tRNA synthetase;       
  585::657     3e-06  35%  692 aa  SYM_STRMK RecName: Full=Methionyl-tRNA synthetase;       
  578::676     3e-06  34%  688 aa  SYM_RALEJ RecName: Full=Methionyl-tRNA synthetase;       
  576::678     3e-06  32%  682 aa  SYM_PASMU RecName: Full=Methionyl-tRNA synthetase;       
  576::678     3e-06  29%  682 aa  SYM_HAEI8 RecName: Full=Methionyl-tRNA synthetase;       
  566::669     3e-06  30%  674 aa  SYM_FRATW RecName: Full=Methionyl-tRNA synthetase;       
  566::669     3e-06  30%  674 aa  SYM_FRATT RecName: Full=Methionyl-tRNA synthetase;       
  566::669     3e-06  30%  674 aa  SYM_FRATO RecName: Full=Methionyl-tRNA synthetase;       
  566::669     3e-06  30%  674 aa  SYM_FRATH RecName: Full=Methionyl-tRNA synthetase;       
  566::669     3e-06  30%  674 aa  SYM_FRATF RecName: Full=Methionyl-tRNA synthetase;       
  566::669     3e-06  30%  674 aa  SYM_FRAT1 RecName: Full=Methionyl-tRNA synthetase;       
  569::661     3e-06  32%  675 aa  SYM_ALHEH RecName: Full=Methionyl-tRNA synthetase;       
  571::676     3e-06  27%  677 aa  SYM_KLEP7 RecName: Full=Methionyl-tRNA synthetase;       
  571::676     3e-06  27%  677 aa  SYM_KLEP3 RecName: Full=Methionyl-tRNA synthetase;       
  565::668     3e-06  30%  673 aa  SYM_FRATN RecName: Full=Methionyl-tRNA synthetase;       
  580::666     3e-06  36%  726 aa  SYM_BORRA RecName: Full=Methionyl-tRNA synthetase;       
  580::666     3e-06  36%  726 aa  SYM_BORDL RecName: Full=Methionyl-tRNA synthetase;       
  572::680     4e-06  29%  681 aa  SYM_CHRSD RecName: Full=Methionyl-tRNA synthetase;       
  586::658     6e-06  35%  693 aa  SYM_STRM5 RecName: Full=Methionyl-tRNA synthetase;       
  580::667     6e-06  34%  690 aa  SYM_RALME RecName: Full=Methionyl-tRNA synthetase;       
  598::679     6e-06  33%  703 aa  SYM_MYXXD RecName: Full=Methionyl-tRNA synthetase;       
  586::661     8e-06  32%  700 aa  SYM_RHOFD RecName: Full=Methionyl-tRNA synthetase;       
  588::696     8e-06  29%  697 aa  SYM_PSYWF RecName: Full=Methionyl-tRNA synthetase;       
  589::693     8e-06  30%  694 aa  SYM_METCA RecName: Full=Methionyl-tRNA synthetase;       
  567::653     8e-06  31%  673 aa  SYM_DICNV RecName: Full=Methionyl-tRNA synthetase;       
  539::640     8e-06  26%  641 aa  SYM_CLOTE RecName: Full=Methionyl-tRNA synthetase;       
  597::701     8e-06  29%  702 aa  SYM_CHLPD RecName: Full=Methionyl-tRNA synthetase;       
  610::697     8e-06  34%  720 aa  SYM_BURCM RecName: Full=Methionyl-tRNA synthetase;       
  610::697     8e-06  34%  720 aa  SYM_BURA4 RecName: Full=Methionyl-tRNA synthetase;       
  597::696     1e-05  29%  702 aa  SYM_PROVI RecName: Full=Methionyl-tRNA synthetase;       
  598::681     1e-05  33%  710 aa  SYM_BURXL RecName: Full=Methionyl-tRNA synthetase;       
  574::665     1e-05  33%  688 aa  SYM_RALSO RecName: Full=Methionyl-tRNA synthetase;       
  575::666     1e-05  32%  689 aa  SYM_LEPCP RecName: Full=Methionyl-tRNA synthetase;       
  615::712     1e-05  30%  717 aa  SYM_HALMA RecName: Full=Methionyl-tRNA synthetase;       
  597::702     1e-05  26%  703 aa  SYM_CHLTE RecName: Full=Methionyl-tRNA synthetase;       
  611::698     1e-05  33%  721 aa  SYM_BURVG RecName: Full=Methionyl-tRNA synthetase;       
  608::695     1e-05  33%  718 aa  SYM_BURTA RecName: Full=Methionyl-tRNA synthetase;       
  615::702     1e-05  33%  725 aa  SYM_BURPS RecName: Full=Methionyl-tRNA synthetase;       
  615::702     1e-05  33%  725 aa  SYM_BURP6 RecName: Full=Methionyl-tRNA synthetase;       
  615::702     1e-05  33%  725 aa  SYM_BURP1 RecName: Full=Methionyl-tRNA synthetase;       
  615::702     1e-05  33%  725 aa  SYM_BURP0 RecName: Full=Methionyl-tRNA synthetase;       
  615::702     1e-05  33%  725 aa  SYM_BURMS RecName: Full=Methionyl-tRNA synthetase;       
  615::702     1e-05  33%  725 aa  SYM_BURMA RecName: Full=Methionyl-tRNA synthetase;       
  615::702     1e-05  33%  725 aa  SYM_BURM9 RecName: Full=Methionyl-tRNA synthetase;       
  615::702     1e-05  33%  725 aa  SYM_BURM7 RecName: Full=Methionyl-tRNA synthetase;       
  596::683     1e-05  34%  706 aa  SYM_ACIAC RecName: Full=Methionyl-tRNA synthetase;       
  587::659     2e-05  33%  694 aa  SYM_XANOR RecName: Full=Methionyl-tRNA synthetase;       
  587::659     2e-05  33%  694 aa  SYM_XANOP RecName: Full=Methionyl-tRNA synthetase;       
  587::659     2e-05  33%  694 aa  SYM_XANOM RecName: Full=Methionyl-tRNA synthetase;       
  599::687     2e-05  30%  710 aa  SYM_HERAR RecName: Full=Methionyl-tRNA synthetase;       
  539::631     2e-05  30%  645 aa  SYM_CLOPE RecName: Full=Methionyl-tRNA synthetase;       
  610::691     2e-05  34%  720 aa  SYM_BURS3 RecName: Full=Methionyl-tRNA synthetase;       
  612::693     2e-05  34%  722 aa  SYM_BURM1 RecName: Full=Methionyl-tRNA synthetase;       
  608::689     2e-05  34%  718 aa  SYM_BURCJ RecName: Full=Methionyl-tRNA synthetase;       
  608::689     2e-05  34%  718 aa  SYM_BURCH RecName: Full=Methionyl-tRNA synthetase;       
  606::687     2e-05  34%  716 aa  SYM_BURCC RecName: Full=Methionyl-tRNA synthetase;       
  608::689     2e-05  34%  718 aa  SYM_BURCA RecName: Full=Methionyl-tRNA synthetase;       
  589::677     3e-05  30%  700 aa  SYM_JANMA RecName: Full=Methionyl-tRNA synthetase;       
  571::676     3e-05  25%  677 aa  SYM_ENTS8 RecName: Full=Methionyl-tRNA synthetase;       
  591::675     3e-05  33%  696 aa  SYM_DECAR RecName: Full=Methionyl-tRNA synthetase;       
  583::665     3e-05  36%  688 aa  SYM_CUPTR RecName: Full=Methionyl-tRNA synthetase;       
  577::679     4e-05  27%  683 aa  SYM_LACPL RecName: Full=Methionyl-tRNA synthetase;       
  597::698     5e-05  34%  707 aa  SYM_POLNA RecName: Full=Methionyl-tRNA synthetase;       
  558::663     5e-05  25%  664 aa  SYM_LISMO RecName: Full=Methionyl-tRNA synthetase;       
  559::664     5e-05  25%  665 aa  SYM_LISMF RecName: Full=Methionyl-tRNA synthetase;       
  558::663     5e-05  25%  664 aa  SYM_LISIN RecName: Full=Methionyl-tRNA synthetase;       
  570::675     5e-05  26%  676 aa  SYM_ERWT9 RecName: Full=Methionyl-tRNA synthetase;       
  564::666     5e-05  31%  726 aa  SYM_BORT9 RecName: Full=Methionyl-tRNA synthetase;       
  580::667     5e-05  35%  685 aa  SYM_ACIAD RecName: Full=Methionyl-tRNA synthetase;       
  589::670     6e-05  30%  686 aa  SYM_VIBHB RecName: Full=Methionyl-tRNA synthetase;       
  581::685     8e-05  30%  691 aa  SYM_BORA1 RecName: Full=Methionyl-tRNA synthetase;       
  580::671     1e-04  33%  689 aa  SYM_SHEDO RecName: Full=Methionyl-tRNA synthetase;       
  594::699     1e-04  26%  700 aa  SYM_PSYCK RecName: Full=Methionyl-tRNA synthetase;       
  578::665     1e-04  35%  688 aa  SYM_DIAST RecName: Full=Methionyl-tRNA synthetase;       
  596::701     1e-04  28%  702 aa  SYM_CHLL2 RecName: Full=Methionyl-tRNA synthetase;       
  596::666     2e-04  32%  698 aa  SYM_NATPD RecName: Full=Methionyl-tRNA synthetase;       
  594::689     2e-04  26%  700 aa  SYM_PSYA2 RecName: Full=Methionyl-tRNA synthetase;       
  561::645     2e-04  31%  663 aa  SYM_METPE RecName: Full=Methionyl-tRNA synthetase;       
  639::709     2e-04  32%  741 aa  SYM_HALWD RecName: Full=Methionyl-tRNA synthetase;       
  527::624     2e-04  27%  628 aa  SYM_CAMJE RecName: Full=Methionyl-tRNA synthetase;       
  582::686     2e-04  29%  692 aa  SYM_BORPE RecName: Full=Methionyl-tRNA synthetase;       
  582::686     2e-04  29%  692 aa  SYM_BORPA RecName: Full=Methionyl-tRNA synthetase;       
  582::686     2e-04  29%  692 aa  SYM_BORBR RecName: Full=Methionyl-tRNA synthetase;       
  578::665     3e-04  34%  688 aa  SYM_ACISJ RecName: Full=Methionyl-tRNA synthetase;       
  580::673     4e-04  28%  689 aa  SYM_SHEB9 RecName: Full=Methionyl-tRNA synthetase;       
  580::673     4e-04  28%  689 aa  SYM_SHEB5 RecName: Full=Methionyl-tRNA synthetase;       
  580::673     4e-04  28%  689 aa  SYM_SHEB2 RecName: Full=Methionyl-tRNA synthetase;       
  568::663     4e-04  28%  677 aa  SYM_IDILO RecName: Full=Methionyl-tRNA synthetase;       
  581::668     5e-04  31%  691 aa  SYM_VEREI RecName: Full=Methionyl-tRNA synthetase;       
  580::673     5e-04  27%  689 aa  SYM_SHEB8 RecName: Full=Methionyl-tRNA synthetase;       
  209::283     5e-04  28%  376 aa  G4P1_YEAST RecName: Full=GU4 nucleic-binding protein 1;       
  558::635     0.001  32%  651 aa  SYM_METTH RecName: Full=Methionyl-tRNA synthetase;       
    1::113

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSGEISYADFEKVDIRVGTIVEAVPFPEARKPAIKVKIDFGPEIGIKKSSAQITVHYTPESLVGRQVLGV
CSAA_BACSU      --------DFEKLDIRTGTIVKAEEFPEARVPAIKLVIDFGTEIGIKQSSAQITKRYKPEGLINKQVIAV
SYM_PORG3       ---DIAFEDFLKLDIRVGTVLECEKVPKADK-LLRFRIDDG--LGGRTIVSGIAKHYAPEELVGKQVCFI
SYM_PORGI       ---DIAFEDFLKLDIRVGTVLECEKVPKADK-LLRFRIDDG--LSGRTIVSGIAKHYAPEELVGKQVCFI
SYM_BDEBA       ---EIEFADFDKVDLRIGQVIEAEEIKEADK-LLRLKIDIG-EGQIRQIISGIKAAYKPEQLVGRKVLVC
SYM_PARD8       ----IEFDDFMKLDIRVGTVLECVKVPKADK-LLQFRIDDGLEKRTIVSG--IAQHYKPEELVGKQVCFI
SYM_BACTN       ----IEFDDFTKLDIRVGTILECQKVPKADK-LLQFKIDDGLETRTIVSG--IAKHYQPEELVGKQVCFI
SYM_METJA       ---DISY--LEKIDLRVGEVVEAEDIPKSKK-LLKLMVDLGDEK--RQIVSGIKGYYKPEDLVGKKVIVI
SYM_FLAJ1       ----IQFEDFAKMDIRIGTILEAEKMPKANK-LLVLKVDTG--IDVRTIVSGIAESFSPEEIIGKRVSVL
SYM_BACFR       ----IEFDDFMKLDIRVGTVLECQKVPKADK-LLQFKIDDGLETRTIVSG--IAQHYKPEELVGKQVCFI
SYM_BACFN       ----IEFDDFMKLDIRVGTVLECQKVPKADK-LLQFKIDDGLETRTIVSG--IAQHYKPEELVGKQVCFI
SYM_BACV8       ----IAFEEFEKLDIRVGTVLECEVVPKMKK-LLKFKIADGLENRTIVSG--IAQHYKPEELVGKQVLFI
SYM_LEPIN       ---EISIDDLSKVELRVGQIVEAGPVDGADK-LVNVKVDLG-ELGIKNVFAGIKVAYQPENLKGLKVVVV
SYM_LEPIC       ---EISIDDLSKVELRVGQIVEAGPVDGADK-LVNVKVDLG-ELGIKNVFAGIKVAYQPENLKGLKVVVV
SYM_CHLCH       ----ISFDEFQKVDLRVATVVAAEPVAKANK-LLKLRVQVGSLT--RQVLAGIAKHYTPEEMVGKQVLLV
SYM_METBF       ----IEYEDFAKLDIRVGKVLLAEPVKKSKK-LIRIEVDIGEE-KTRQLVAGLSSYYAPEELVGKSVIVL
SYM_META3       ----IGIDDFAKIELKVAQILEAEEVPKSKK-LLKLIVDIGDEK--RQVVAGIKGHYTPEELIGKKIVLV
SYM_FLAPJ       ----IQYDDFAKMDLRVGTIIEAEKMPKANK-LLVLKVDTG--IDVRTIVSGIAESFSPEEIIGKQVTVL
SYM_SHEWM       ISEEISFEDFAKIDLRIARIAKAEHVPEANK-LLKLQLDLGGE--TKQVFAGIKSAYAPEDLEGKLTVMV
SYM_METTP       ----IPFDQFKALDLRVGTVLEAERIKGSDK-LLRLIVDIGEK---RQIVAGIAKMYKPEELVGRQVVVV
SYM_CHLT3       ----ITFDEFEKIDLRVAKVLECERVPKTDK-LLRLKVQLGTET--RQVLAGLAKYYTPEALLGKNVVMV
SYM1_BACAN      ----ITIDDFFKVELRVAEVLSAEPVKKADK-LLKIQLDLGTE--KRQVVSGIAKFYSPEDLKGKKVICV
SYM_SHESH       ISDEISFDDFAKLDLRIARIAKAEHVPEANK-LLKLQLDLGGE--TKQVFAGIKSAYAPEDLEGKLTVMV
SYM_THICR       IADEITFDDFAKVDFRIAKIVNAEQVPEADK-LIKLTLDIG--VGERQVFAGIKSAYKPEDLVGKLTVMV
SYM_STAHJ       ---QIDIKDFDKVEIKAATITDAENVPKSDK-LLKIQIDLGLE--QRQIVSGIAKFYRPEDIIGKKVAVV
SYM_PYRFU       ----VSFEEFSKIDLRIGKIVEVQDHPNADKLYV-VKVDLGGE--IRTLVAGLKKYYKPEELLNRYVVIV
SYM_METMA       ----IDYEDFAKLDIRVGKVLLVEPVKKSKK-LLRIEVDIGEEKP-RQLVAGMASYYTPEELVGKSVIVL
SYM1_BACCR      ----ITIDDFFKVELRVAEVLSAEPVKKADK-LLKIQLDLGTE--KRQVVSGIAKFYSPEDLKGKKVICV
SYM_METBU       MKDLITFDDFSKLDIRIGTIVSAEAIKKSKK-LLKLQVDLGEE-ETRQIVAGLKESHEPEQLIGKQVAVL
SYM_NANEQ       --GLVSYLDFAKLDMRVGKIIDVQDHPNADKLYI-IKVSLGNK--QKTLVGGLKQYYKKEELIGKYVVLI
SYM_LEPBP       --GFITIDELSKVELRVGLIKEANPVEGADK-LLFVKVDLG-EKGIKNVFAGIKASYTAEELVGKKVVVV
SYM_LEPBA       --GFITIDELSKVELRVGLIKEANPVEGADK-LLFVKVDLG-EKGIKNVFAGIKASYTAEELVGKKVVVV
SYM_THETN       ----ITIEDFSKVQLRVAEILEAEKV-EGSDKLIKMKLKVGEEI--RQIVGGIGKYYSPEELIGKKIIIV
SYM_PYRHO       ------FEDFAKLDLRVGKIIEVKDHPNADKLYI-VKVDLGKE--VRTLVAGLKKYYKPEELLNKYVIIV
SYM_PYRAB       ----VKFDDFAKLDLRVGKIIEVKDHPNADKLYV-VKVDLGDE--VRTLVAGLKKYYKPEELLNRYVVVV
SYM_GRAFK       -----TFEDFTKMDLRVGTIIEAQKMPKTKKLMV-LKVDTG--IDQRTVVSGIAEHFKAEDIIGKKVTVL
SYM_THEMA       ----ITIDDFSKVDLRIAKVLEAEKVPNSRK-LLRLIIDLGTEK--RQIVAGIAEHYRPEELVGKLIVVV
SYM_SHEAM       ISETISYEDFAKIDLRVALIQKAEAVPEADK-LLKLQLDIGGE--VRQVFAGIKSAYNPEDLEGKLTVMV
SYM_METAC       ---QIEYEDFAKLDIRVGKVLFVEPVKKSRK-LLRVEVDIGEE-KPRQLVAGMASYYTSEELVGKYVVVL
SYM_BACSU       ---EITIDQFMDVELRVAEVIEAEPVKKADR-LLKLQLDLGFEK--RQVVSGIAKHYTPEELVGKKLVCV
SYM_STAAR       ---QIDIKDFDKVEIKAATIIDAEHVKKSDK-LLKIQVDLDSEQ--RQIVSGIAKFYTPDDIIGKKVAVV
SYM_STAAN       ---QIDIKDFDKVEIKAATIIDAEHVKKSDK-LLKIQVDLDSEQ--RQIVSGIAKFYTPDDIIGKKVAVV
SYM_STAAM       ---QIDIKDFDKVEIKAATIIDAEHVKKSDK-LLKIQVDLDSEQ--RQIVSGIAKFYTPDDIIGKKVAVV
SYM_STAAC       ---QIDIKDFDKVEIKAATIIDAEHVKKSDK-LLKIQVDLDSEQ--RQIVSGIAKFYTPDDIIGKKVAVV
SYM_METKA       ----VSLEEFNRLDLRVGKIKEAERV-EGSDRLIKLRIDIGDRTVTAVAGLYPT--YEPEELVGRKVVVL
SYM_SHELP       ISEEISFDDFAKLDLRIARIAKAEHVPDANK-LLKLQLDLGGE--TKQVFAGIKSAYAPEDLEGKLTVMV
SYM_PHOPR       IEAEIEFDDFAKVDMRIAKIISCEAVPKANK-LLKFQLDIGGE--MRQVFSGIKSAYTPEELVGKHTVMV
SYM_PELLD       ----IGFDDFQKVDLRVATVRAAEKVKKASK-LLKLQVQVGSTQ--RQVLAGVAEHYSPEEMVGKNVLLV
SYM_ACTSZ       LEAEISIDDFAKMDLRVAKVISCEAVPESKK-LLKFQLDLGFETRQVLSGIK-AAYGNPEELMGRFVIMV
SYM_STAS1       ---QIDIKDFDKVEIKAATIIDAEQVKKSDK-LLKIQVDLDSEQ--RQIVSGIAKFYQPEDIIGKKVAVV
SYM_STAAW       ---QIDIKDFDKVEIKAATIINAEHVKKSDK-LLKIQVDLDSEQ--RQIVSGIAKFYTPDDIIGKKVAVV
SYM_STAAS       ---QIDIKDFDKVEIKAATIINAEHVKKSDK-LLKIQVDLDSEQ--RQIVSGIAKFYTPDDIIGKKVAVV
SYM_PYRKO       ----VSFDEFAKLDLRVGKIIEVNDHPNADRLYV-VKVDLGDE--VRQLVAGLKKYYKPEELLGHYVVII
SYM_HELPJ       ----ISIEDFKKVEIKVGLIKEAQRIEKSNK-LLRLKVDLG-ENRLRQIISGIALDYEPESLVGQMVCVV
SYM_TOLAT       ---EITYDDFAKLDLRIALIKKAEAVPEADK-LLRLQLDLGGE--VRQVFAGIKSAYSPEQLEGKLTVMV
SYM_STAES       ---QIDIKDFDKVEIKAATIIDAENVKKSEK-LLKIKVELDNEQ--RQIVSGIAKFYRPEDIIGKKVAVV
SYM_STAEQ       ---QIDIKDFDKVEIKAATIIDAENVKKSEK-LLKIKVELDNEQ--RQIVSGIAKFYRPEDIIGKKVAVV
SYM_LEPBL       ------------VELRVGEIVEAKPVEGADK-LVNVKVDLG-ELGIKNVFAGIKIAYQPENLKGLKVVVV
SYM_LEPBJ       ------------VELRVGEIVEAKPVEGADK-LVNVKVDLG-ELGIKNVFAGIKIAYQPENLKGLKVVVV
SYM_BACHD       ----ITIDDFSKVELRIAEVIDAEPVKKADR-LLKIQLDLGYEK--RQVVSGIAKYYSPSDLIGKKVICV
SYM_AERHH       ISETISYDDFAKIDLRVALIKKAEAVPEADK-LLKLQLDIGGE--TRQVFAGIKSAYNPEDLEGKLTVMV
SYM1_SORC5      LAPECTIDDFSKVDLRVARIVAAEHVPEAKK-LLKLTVSLGGE-ARRTVFAGIKAYYKPEDLIGRLVIVC
SYM_SHEPA       ISEEISFEDFAKIDLRIARIAKAEHVKEANK-LLRLELDLGGE--TKQVFAGIKSAYAPEDLEGKLTVMV
SYM_METHJ       ---EISIEEFAKVEMKTGKILSAEQVPKSTK-LLKLQVSIGDE--VRQIVSGIAQFHNPEELVGKDVVVC
SYM_SHESR       ISDTINYEDFAKIDLRIARIVKAEHVAEADK-LLKLQLDIGGE--TRQVFAGIKSAYSPEDLEGKLTVMV
SYM_SHEON       ISDTINYEDFAKIDLRIARIVKAEHVAEADK-LLKLQLDIGGE--TRQVFAGIKSAYSPEDLEGKLTVMV
SYM_DEIRA       --GLISIDDFAKIDLRIXXXXXXXXXXKADK-LLKLTVKLGDETRTVVSG--IRKWYEPEALVGRKVVLV
SYM_VIBVY       ---EIEFDDFAKVDLRIAKIVSCESVPKADK-LLKFQLDIGGE--MRQVFSGIKAAYNPEDLVGKYTVVV
SYM_VIBVU       ---EIEFDDFAKVDLRIAKIVSCESVPKADK-LLKFQLDIGGE--MRQVFSGIKAAYNPEDLVGKYTVVV
SYM_NEIM0       ---QASFDDFMKIDMRVAKVLEAV---EGSTKLLKFDLDFGFEQRIIFSGIAAS-YLNPAELNGRMVIAV
SYM_SHEFN       ISPEISFEDFAKIDLRIARISKAEHIEKANK-LLRLELDLGGD--TKQVFAGIKSAYAPEDLVGKLTVMV
SYM_METB6       ----ISIEDFSKVEIKTGKVLAAESIPKSSK-LLKLQVDIGGET--RQIVSGIAAFYKPDELVGKDVIVL
SYM_HELPY       ----IGIEDFKKVEIKVGLIKEAQRIEKSNK-LLRLKVDLG-EGRLRQIISGIALDYEPESLVGQMVCVV
SYM_SHEHH       ---EISFDDFAKIDLRIARIAKAEHVKEANK-LLRLELDLGGE--TKQVFAGIKSAYAPEDLEGKLTVMV
SYM_NEIMB       ---QASFDDFMKIDMRVAKVLEAV---EGSTKLLKFDLDFGFEKRIIFSGIAAS-YPNPAELNGRMVIAV
SYM_NEIMA       ---QASFDDFMKIDMRVAKVLEAV---EGSTKLLKFDLDFGFEKRIIFSGIAAS-YPNPAELNGRMVIAV
SYM_MANSM       ---EISIDDFAKIDLRVAKVIKCEEVPESKK-LLKFQLDLGFESGIKGA------YNNPEELEGRFVIVV
SYM_SHESA       ISDTINFEDFAKIDLRIARIVKAEHVAEADK-LLKLQLDIGGE--TRQVFAGIKSAYSPEDLEGKLTVMV
SYM_PARUW       ----VDIEDFRKLDLRVGKIIQANPVPKSKK-LFQLLVDIGIEKRI--VVAGVAEFYKVEDLIGKNVVVV
SYM_NEIMF       ---QASFDDFMKIDMRVAKVLEAV---EGSTKLLKFDLDFGFEKRIIFSGIAAS-YPNPAELNGRMVIAV
SYM_SHESM       ISDTINFDDFAKIDLRIARIVKAEHVAEADK-LLKLQLDIGGE--TRQVFAGIKSAYSPEDLEGKLTVMV
SYM_ALISL       IADEIEFDAFEAVDMRIARIISCEEIPKANK-LLKFQLDIGGET--RQVFSGIKSAYTPEELVGKHTVMV
SYM_UNCMA       ----ITIDDFAKMELRVGKVIASEKIKGSKK-LLKNLIDLG-EDKPRQIVSGIAEVYTPEEMVGKTVIVI
SYM_SHESW       ISETINFDDFAKIDLRIARIVKAEHVAEADK-LLKLQLDIGGE--TRQVFAGIKSAYSPEDLEGKLTVMV
SYM_SHEPC       ISETINFDDFAKIDLRIARIVKAEHVAEADK-LLKLQLDIGGE--TRQVFAGIKSAYSPEDLEGKLTVMV
SYM_THIDA       ----ISIDDFAKVDLRIARIANAEHVEGADK-LLRLTLDVG-ELGPRQVFAGIKSAYAPEALVGRLTVMV
SYM_THEON       --------DFMKLDLRVGKIVDVQDHPNADKLYV-VKVDLGNE--VRQLVAGLKKYYSKDDLLNRYVVII
SYM_PSYIN       LAPEIDFDTFAKTDLRVALITKAEAVPKANK-LLKLTLDLGGET--RTVFAGIKSAYTPEELEGRLTVMV
SYM_NEIG1       ---QAGFDDFMKIDMRVAKVLEAV---EGSTKLLKFDLDFGFEKRIIFSGIAAS-YPNPAELNGRMVIAV
SYM_ACTPJ       IAAEITIDDFAKLDLRVAKVISCEAVPESNK-LLKFQLDLGDHQRQVLSGIK-AAYNNPEELVGRFVIMV
SYM_ACTP7       IAAEITIDDFAKLDLRVAKVISCEAVPESNK-LLKFQLDLGDHQRQVLSGIK-AAYNNPEELVGRFVIMV
SYM_ACTP2       IAAEITIDDFAKLDLRVAKVISCEAVPESNK-LLKFQLDLGDHQRQVLSGIK-AAYNNPEELVGRFVIMV
SYM_METLZ       ----ITIDDVAKLDLRVGRVVKAERVPKTTK-LLRLQVDIGTEV--RQIVSGIADVYTPEEMVDKKIIVV
SYM_METS3       MSDLISIDDFDKVVIKIGQVKEAEKIEKSDK-LLKLQVDIGDET--RQIVAGLAKQYAPEELIDRKVAVV
SYM_SACD2       IADEIEFADFAKVDLRVALIANAEHVEGADK-LLRLTLDLGGE--TRNVFAGIKSAYLPEDLIGKHTIMV
SYM_NITEU       ----ISIEDFVKIDLRIARIVDAQHVPGADK-LLQLTLDIGSEQ--RTVFAGIKSAYDPEQLKGRLTVMV
SYM_HAHCH       ----IKFDDFAKIDLRIAKIVSAEHVEGADK-LLRLQLDIGSEQ--RQVFAGIKSAYAPEDLVGRLTVMV
SYM_AZOSB       -SPHISIDDFTKVDLRIAKIVDAQHVEGADK-LIRLQLDIGEEAGNPKPRAGIKSAYDPATLVGRLTVMV
SYM_HAES1       ----ITIDDFFKVDLRVAKVLKCEAVPESNK-LLKFILDIGNETGIKAAYGK------PEDLEGRFVIMV
SYM_HAEDU       IAAEISIDDFAKLDLRVAKVIQCEAVPESNK-LLKFQLDLGDHSGIKAAYSK------PEELNGRFVIMV
SYM_ENTFA       ---QIKYDDFDKVELKVAEVIDCKKVKGADK-LLQFRLDAGDENHRQILSGIAEFYPDPAALIGKKVVIV
SYM_RHOBA       LADEITIDDFMKVDLRVARVLSAEHVPEANXXXXXXXXXXXDET--RQVFAGIKAAYDPEKLVGRLVVMV
SYM_PSEA6       ISDTIEFDDFAKIDLRIAKIVVAEHVEKADK-LLRLELDLGGET--RQVFAGIKSAYQPEDLVGKLTVMV
SYM_NITEC       ----ISIEDFSKIDLRIARILDAQHVPGADK-LLQLTLDIGSE--QRSVFAGIKSAYDPEQLKGRLTVMV
SYM_MARAV       ---EIEFPDFAKVDLRVAKIVKAEHVEGADK-LLRLTLDIGH--GERNVFAGIKSAYKPEDLEGRMTVMV
SYM_HAES2       ----ITIDDFCKVDLRVAKVLKCEAVPESNK-LLKFILDIGNETGIKAAYGK------PEDLEGRFVIMV
SYM_XANAC       --GFIGMDDFAKLDLRIGKVL-ACEFVEGSDKLLRFELDAG-ELGTRQIFSGIRASYRPETLVGRSVVFI
SYM_VIBCH       LAAEIEFDDFAKVDLRIAKILSCEAVEKSDK-LLKFELDIGGET--RQVFSGIKSAYQPEDLIGKYTVVV
SYM_VIBC3       LAAEIEFDDFAKVDLRIAKILSCEAVEKSDK-LLKFELDIGGET--RQVFSGIKSAYQPEDLIGKYTVVV
SYM_METFK       ----ISIDDFAKVDLRIARIANAEHVEGAEK-LLRLSLDIGEERP-RQVFAGIKSAYDPESLKGRLTVMV
SYM_BACST       ----ISIDDFAKVDLRVAEVVQ----PERMKNAXXXXXXXXXXXXEKRQVISIAEFYKPEELIGKKVICV
SYM_XYLFT       ----IGIDDFAKLDLRIGKVL-VCEYVEGSDKLLRFELDAGP-LGKRQIFSGIRASYSPEALIGRNVVFI
SYM_XYLF2       ----IGIDDFAKLDLRIGKVL-VCEYVEGSDKLLRFELDAGP-LGKRQIFSGIRASYSPEALIGRNVVFI
SYM_METVS       ---------FTKVDLRVGKVLEVEDVKKSKK-LYKIIVDLGNE--QRQIISGLKGDYEVEELIGKNVIVI
SYM_LEGPL       -SNLISIEDFAKVDLRIAKIVNAEPVEGADK-LMRLILDLGD--AQKQVFAGIKKAYDAEELIGRLTVMV
SYM_LEGPC       -SNLISIEDFAKVDLRIAKIVNAEPVEGADK-LMRLILDLGD--AQKQVFAGIKKAYDAEELIGRLTVMV
SYM_HAEPS       ---EITIDDFAKLDLRVAKVLKCEAVPKSDK-LLRFELDLGDHTGIKAAYSQ------PEELEGRFVIMI
SYM_SALSV       ----ITFDDFAKVDLRVA-LIENAEFVEGSDKLLRLTLDLGGEKRNVFSGIR-SAYPDPQALIGRQTVMV
SYM_SALRD       LSDNISFDDFTQLDLRAGTVTTAEPVPDADK-LLRLEVDLGFE--ERQILAGVAEQMAPDDXXXXXXXXX
SYM_SALPC       ----ITFDDFAKIDLRVA-LIENAEFVEGSDKLLRLTLDLGGESGIRSS------YPDPQALIGRQTVMV
SYM_METM5       ---------FGNIDLRVGQILEVEEVPRSKK-LYKITADLGDE--KRQIVSGLKGAYEAEELVGKKVIII
SYM_LEGPH       ----ISIEDFAKVDLRIAKIVNAEPVEGADK-LMRLILDLGD--AQKQVFAGIKKAYDAEELIGRLTVMV
SYM_LEGPA       ----ISIEDFAKVDLRIAKIVNAEPVEGADK-LMRLILDLGD--AQKQVFAGIKKAYDAEELIGRLTVMV
SYM_XYLFM       ----IGIDDFAKLDLRIGKVL-VCEYVEGSDKLLRFELDAGP-LGKRQIFSGIRASYSPETLIGRNVVFI
SYM_XYLFA       ----IGIDDFAKLDLRIGKVL-VCEYVEGSDKLLRFELDAGP-LGKRQIFSGIRASYSPETLIGRNVVFI
SYM_SALPK       ----ITFDDFAKIDLRVA-LIENAEFVEGSDKLLRLTLDLGGEKRNVFSGIR-SAYPDPQALIGRQTVMV
SYM_SALPA       ----ITFDDFAKIDLRVA-LIENAEFVEGSDKLLRLTLDLGGEKRNVFSGIR-SAYPDPQALIGRQTVMV
SYM_SALG2       ----ITFDDFAKIDLRVA-LIENAEFVEGSDKLLRLTLDLGGEKRNVFSGIR-SAYPDPQALIGRQTVMV
SYM_SALEP       ----ITFDDFAKIDLRVA-LIENAEFVEGSDKLLRLTLDLGGEKRNVFSGIR-SAYPDPQALIGRQTVMV
SYM_SALCH       ----ITFDDFAKIDLRVA-LIENAEFVEGSDKLLRLTLDLGGEKRNVFSGIR-SAYPDPQALIGRQTVMV
SYM_NITMU       ----ISIEDFGKIDLRVAKILDAEHVPGADK-LLKLTLDVASEQ--RTVFAGIKSAYDPGQLKGRLTVMV
SYM_METM7       ---------FGNVDLRVGQILEVEEVPRSKK-LYKIIADLGDE--KRQIVSGLKGAYEAEELVGKKVIII
SYM_ENT38       ----ITFDDFAKVDLRVA-LIENAEFVEGSDKLLRLTLDLGGEKRNVFSGIR-SAYPDPQVLIGRQTVMV
SYM_CYTH3       ----VSFDDFAKMDIRVATIIAA---EKVAXXXXXXXXXXXXGIDERTVVSGIAEHFEPEAIIGQQVSLL
YGJH_ECOLI      ----VAYADFARLEMRVGKIVEVKRHENADKLYI-VQVDVGQK--TLQTVTSLVPYYSEEELMGKTVVVL
SYM_METMJ       ----VSIEEFGNLDIRIAKVVSAEPIKGSKK-LYKLVVDLGSEK--RQVVSGIAQFYAPDELVGKDVALI
SYM_XANCP       --GLIGMDDFAKLDLRIGKVLEAV---EGSDKLLRFELDAG-ELGKRQIFSGIRASYEPETLVGRSVVFI
SYM_XANC8       --GLIGMDDFAKLDLRIGKVLEAV---EGSDKLLRFELDAG-ELGKRQIFSGIRASYEPETLVGRSVVFI
SYM_VIBPA       IADEIEFDTFAQVDLRIARIISCEEVPKANK-LLKFQLDIGGE--TRQVFSGIKSAYKPEELEGKLTVMV
SYM_VIBFM       IADEIEFDAFEAVDMRIARIISCEEVPKANK-LLKFQLDIGGE--TRQVFSGIKSAYKPEELEGKLTVMV
SYM_THET8       ----IGIEDFAKVELRVAEVLAAEKHPNADRLLV-LRLSLGNEERTVVSG--IAKWYRPEELVGKKVVLV
SYM_SALAR       ----ITFDDFAKVDLRVA-LIENAGFVEGSDKLLRLTLDLGGEKRNVFSGIR-SAYPDPRALIGRQTVMV
SYM_HAEIE       ----ITIDDFAKLDMRVAKVLKCEAVPESNK-LLRFELDLGDHTRQVFSSIK-AAYNKPEELEGRFVIMV
SYM_ARCFU       ---EISIEDFQKLDIRIGR-VXXXXXXXXXXXXXXXXXDIGDE--QRQIVSGIAEDYTPEELEGKLVVVL
SYM_STRR6       ---EIKFEDFDKVEIRVAEVKE-VSKVEGSDKLLQFRLDAGDGEDRQILSGIAKYYPNEQELVGKKVQIV
SYM_STRPN       ---EIKFEDFDKVEIRVAEVKE-VSKVEGSDKLLQFRLDAGDGEDRQILSGIAKYYPNEQELVGKKVQIV
SYM_SALTY       ----ITFDDFAKIDLRVA-LIENAEFVDGSDKLLRLTLDLGGEKRNVFSGIR-SAYPDPQALIGRQTVMV
SYM_SALTI       ----ITFDDFAKIDLRVA-LIENAEFVDGSDKLLRLTLDLGGEKRNVFSGIR-SAYPDPQALIGRQTVMV
SYM_SALPB       ----ITFDDFAKIDLRVA-LIENAEFVDGSDKLLRLTLDLGGEKRNVFSGIR-SAYPDPQALIGRQTVMV
SYM_SALNS       ----ITFDDFAKIDLRVA-LIENAEFVDGSDKLLRLTLDLGGEKRNVFSGIR-SAYPDPQALIGRQTVMV
SYM_SALHS       ----ITFDDFAKIDLRVA-LIENAEFVDGSDKLLRLTLDLGGEKRNVFSGIR-SAYPDPQALIGRQTVMV
SYM_SALDC       ----ITFDDFAKIDLRVA-LIENAEFVDGSDKLLRLTLDLGGEKRNVFSGIR-SAYPDPQALIGRQTVMV
SYM_SALA4       ----ITFDDFAKIDLRVA-LIENAEFVDGSDKLLRLTLDLGGEKRNVFSGIR-SAYPDPQALIGRQTVMV
SYM_CHRVO       ----IKIDDFAKVDLRVGKVLEC-NFVEGSDKLLQFKVDLGFETGIRKA------YQEPEKLVGRHVIVV
SYM_SHISS       ----ITFDDFAKVDLRVA-LIENAEFVEGSDKLLRLTLDLGGEKRNVFSGIR-SAYPDPQALIGRHTIMV
SYM_SHIFL       ----ITFDDFAKVDLRVA-LIENAEFVEGSDKLLRLTLDLGGEKRNVFSGIR-SAYPDPQALIGRHTIMV
SYM_SHIF8       ----ITFDDFAKVDLRVA-LIENAEFVEGSDKLLRLTLDLGGEKRNVFSGIR-SAYPDPQALIGRHTIMV
SYM_SHIDS       ----ITFDDFAKVDLRVA-LIENAEFVEGSDKLLRLTLDLGGEKRNVFSGIR-SAYPDPQALIGRHTIMV
SYM_SHIBS       ----ITFDDFAKVDLRVA-LIENAEFVEGSDKLLRLTLDLGGEKRNVFSGIR-SAYPDPQALIGRHTIMV
SYM_SHIB3       ----ITFDDFAKVDLRVA-LIENAEFVEGSDKLLRLTLDLGGEKRNVFSGIR-SAYPDPQALIGRHTIMV
SYM_METMP       ---------FGNIDLRVGQILEVEEVPRSKK-LYKIIADLGDE--KRQIVSGLIGAYDAEELVGKKVIII
SYM_ESCF3       ----ITFDDFAKVDLRVA-LIENAEFVEGSDKLLRLTLDLGGEKRNVFSGIR-SAYPDPQALIGRHTIMV
SYM_ECOUT       ----ITFDDFAKVDLRVA-LIENAEFVEGSDKLLRLTLDLGGEKRNVFSGIR-SAYPDPQALIGRHTIMV
SYM_ECOSM       ----ITFDDFAKVDLRVA-LIENAEFVEGSDKLLRLTLDLGGEKRNVFSGIR-SAYPDPQALIGRHTIMV
SYM_ECOSE       ----ITFDDFAKVDLRVA-LIENAEFVEGSDKLLRLTLDLGGEKRNVFSGIR-SAYPDPQALIGRHTIMV
SYM_ECOLU       ----ITFDDFAKVDLRVA-LIENAEFVEGSDKLLRLTLDLGGEKRNVFSGIR-SAYPDPQALIGRHTIMV
SYM_ECOLI       ----ITFDDFAKVDLRVA-LIENAEFVEGSDKLLRLTLDLGGEKRNVFSGIR-SAYPDPQALIGRHTIMV
SYM_ECOLC       ----ITFDDFAKVDLRVA-LIENAEFVEGSDKLLRLTLDLGGEKRNVFSGIR-SAYPDPQALIGRHTIMV
SYM_ECOL6       ----ITFDDFAKVDLRVA-LIENAEFVEGSDKLLRLTLDLGGEKRNVFSGIR-SAYPDPQALIGRHTIMV
SYM_ECOL5       ----ITFDDFAKVDLRVA-LIENAEFVEGSDKLLRLTLDLGGEKRNVFSGIR-SAYPDPQALIGRHTIMV
SYM_ECOK1       ----ITFDDFAKVDLRVA-LIENAEFVEGSDKLLRLTLDLGGEKRNVFSGIR-SAYPDPQALIGRHTIMV
SYM_ECOHS       ----ITFDDFAKVDLRVA-LIENAEFVEGSDKLLRLTLDLGGEKRNVFSGIR-SAYPDPQALIGRHTIMV
SYM_ECODH       ----ITFDDFAKVDLRVA-LIENAEFVEGSDKLLRLTLDLGGEKRNVFSGIR-SAYPDPQALIGRHTIMV
SYM_ECOBW       ----ITFDDFAKVDLRVA-LIENAEFVEGSDKLLRLTLDLGGEKRNVFSGIR-SAYPDPQALIGRHTIMV
SYM_ECO8A       ----ITFDDFAKVDLRVA-LIENAEFVEGSDKLLRLTLDLGGEKRNVFSGIR-SAYPDPQALIGRHTIMV
SYM_ECO81       ----ITFDDFAKVDLRVA-LIENAEFVEGSDKLLRLTLDLGGEKRNVFSGIR-SAYPDPQALIGRHTIMV
SYM_ECO7I       ----ITFDDFAKVDLRVA-LIENAEFVEGSDKLLRLTLDLGGEKRNVFSGIR-SAYPDPQALIGRHTIMV
SYM_ECO5E       ----ITFDDFAKVDLRVA-LIENAEFVEGSDKLLRLTLDLGGEKRNVFSGIR-SAYPDPQALIGRHTIMV
SYM_ECO57       ----ITFDDFAKVDLRVA-LIENAEFVEGSDKLLRLTLDLGGEKRNVFSGIR-SAYPDPQALIGRHTIMV
SYM_ECO55       ----ITFDDFAKVDLRVA-LIENAEFVEGSDKLLRLTLDLGGEKRNVFSGIR-SAYPDPQALIGRHTIMV
SYM_ECO45       ----ITFDDFAKVDLRVA-LIENAEFVEGSDKLLRLTLDLGGEKRNVFSGIR-SAYPDPQALIGRHTIMV
SYM_ECO27       ----ITFDDFAKVDLRVA-LIENAEFVEGSDKLLRLTLDLGGEKRNVFSGIR-SAYPDPQALIGRHTIMV
SYM_ECO24       ----ITFDDFAKVDLRVA-LIENAEFVEGSDKLLRLTLDLGGEKRNVFSGIR-SAYPDPQALIGRHTIMV
SYM_CITK8       ----ITFDDFAKVDLRVA-LIENAEFVEGSDKLLRLTLDLGGEKRNVFSGIR-SAYPDPQALIGRHTVMV
SYM_VIBSL       IADEIEFDAFSAVDMRIARIISCEEVPKANK-LLKFQLDIGGET--RQVFSGIKSAYKPEELEGKLTVMV
SYM_VIBF1       IADEIEFDAFEAVDMRIARIISCEEVPKANK-LLKFQLDIGGE--TRQVFSGIKSAYKPEELEGKLTVMV
SYM_HAEIG       ----ITIDDFAKLDMRVAKVLKCEAVPESNK-LLRFELDLGDHTRQVFSGIK-AAYNKPEELEGRFVIMV
SYM_AZOSE       ----ISIDDFTKVDLRIARIVGAEHVEGADK-LIRLRLDIGEQAKLRQVFAGIKSAYDPATLVGRLTVMV
SYM_ACIF5       ----IGIDDFSKVDLRIARIVAATNVDGADK-LLHLTLDIGE--GTRSVFAGIKSAYDPASLVGRLTVMV
SYM_ACIF2       ----IGIDDFSKVDLRIARIVAATNVDGADK-LLHLTLDIGE--GTRSVFAGIKSAYDPASLVGRLTVMV
SYM_XANC5       --GFIGMDDFAKLDLRIGKVL-VCEFVEGSDKLLRFELDAG-ELGKRQIFSGIRASYEPDALVGRSVVFI
SYM_RALEH       ----ITIDDFAKVDLRVAKIVECQKVEGSNK-LLQLTLDLG-EGRTRNVFSGIQSAYTPEQLVGKLTVVV
SYM_POLSJ       LAAPITIDDFAKVDLRIAKIVEAV---EGSTKLLRLTLDVG-EGKMRNVFSGIASAYTPDQLIGKHTVVV
SYM_PELPB       ----ISFDDFLKVDLRVARVITAEXXXXXXXXXXXXXXXGS---ATKQVLAGIAKYYTPEEMVGKNVVIV
SYM_OCEIH       ---QIKYDVFDKVELKVAEVKDCSKVEGADK-LLKFRLDAGDN-GDRQILSGIAEYYSPEQLIGKKVVIV
SYM_NITOC       ----IQFESFAKLDLRIARILKAEQVEGADK-LLRLELDLDGET--RQVFAGIKAAYAPESLVGRLTVMV
SYM_HAEIN       ----ITIDDFAKLDMRVAKVLKCEAVPESNK-LLRFELDLGDHTRQVFSGIK-AAYNKPEELEGRFVIMV
SYM_COLP3       ISEEIEFDDFAKIDLRIVKIINAEHVEKADK-LIQLTLALNEETETRQVFAGIKSAYNPEDLIGKHTVMV
SYM_XANCB       --GFIGMDDFAKLDLRIGKVLEAV---EGSDKLLRFELDAG-ELGKRQIFSGIRASYEPETLVGRSVVFI
SYM_STRMK       ----IGIDDFAKLDLRIGKVL-VCEFVEGSDKLLRFELDAG-ELGKRQIFSGIRASYEPEKLVGRSVVFI
SYM_RALEJ       ----ITIDDFAKIDLRVAKIVECQKV-EGSSKLLQLTLDLG-EGRTRNVFSGIQSAYTPEQLVGKLTVVV
SYM_PASMU       ----ISIEDFAKLDLRVAKVMKCEAVPESNK-LLRFELDLGDHTGIKEA------YNNPAELEGRFVVVI
SYM_HAEI8       ----ITIDDLAKLDMRVAKVLKCEAVPESNK-LLRFELDLGDHTRQVFSGIK-AAYNKPEELEGRFVIMV
SYM_FRATW       IAAECTFDDFMKVDLRIAKITEASHVEGAXXXXXXXXXXXXVT---KQVFAGIKSAYKPEDLIGKHTIMV
SYM_FRATT       IAAECTFDDFMKVDLRIAKITEASHVEGAXXXXXXXXXXXXVT---KQVFAGIKSAYKPEDLIGKHTIMV
SYM_FRATO       IAAECTFDDFMKVDLRIAKITEASHVEGAXXXXXXXXXXXXVT---KQVFAGIKSAYKPEDLIGKHTIMV
SYM_FRATH       IAAECTFDDFMKVDLRIAKITEASHVEGAXXXXXXXXXXXXVT---KQVFAGIKSAYKPEDLIGKHTIMV
SYM_FRATF       IAAECTFDDFMKVDLRIAKITEASHVEGAXXXXXXXXXXXXVT---KQVFAGIKSAYKPEDLIGKHTIMV
SYM_FRAT1       IAAECTFDDFMKVDLRIAKITEASHVEGAXXXXXXXXXXXXVT---KQVFAGIKSAYKPEDLIGKHTIMV
SYM_ALHEH       ---QIEIGDFAKVDLRIARIEQAEHVEGADK-LLRLQLDLGGET--RQVFAGIKQAYRPEDLEGRLTVMA
SYM_KLEP7       ----ITFDDFAKVDLRVA-LIENAEFVEGSDKLLRLTLDLGGEKRNVFSGIR-SAYPDPQPLIGRLTVMV
SYM_KLEP3       ----ITFDDFAKVDLRVA-LIENAEFVEGSDKLLRLTLDLGGEKRNVFSGIR-SAYPDPQPLIGRLTVMV
SYM_FRATN       ITAECTFDDFMKVDLRIAKITEASHVEGAXXXXXXXXXXXXVT---KQVFAGIKSAYKPEDLIGKHTVMV
SYM_BORRA       --------------------------PDAEKLFI-LKLDDGTPEG-KQIVSSIADHYTEEELIGKHIIIV
SYM_BORDL       --------------------------PDAEKLFI-LKLDDGTPEG-KQIVSSIADHYTEEELIGKHIIIV
SYM_CHRSD       IADEIGFDDFAKLDLRIVRIAKA-EYVEGAXXXXXXXXXXGGETRTVFSG--IRAVYAPEALEGRLTVMV
SYM_STRM5       ----IGIDDFAKLDLRIGKVL-VCEFVEGSDKLLRFELDAG-ELGKRQIFSGIRGSYEPEKLVGRSVVFI
SYM_RALME       ----ITIDDFAKIDLRVAKIV-ACDKVEGSNKLLQLTLDLG-EGKTRNVFSGIQSAYTPEQLVGKLTVVV
SYM_MYXXD       ----IEYDDFAKVVLKAGKVLAAEKVQKADK-LLKLTVDVG-EGSPRTIVSGIAEAFAPEALTGRNVVVV
SYM_RHOFD       MAPVISMDDFSKIDLRIAKIVNCETVSGSTK-LLRLTLDVG-ETNTRNVFSGIASSYQPEQLIGKLTVMV
SYM_PSYWF       -SDYIEFDDFMKVEMTVAQVLECNHVEGADK-LLQFTLDIGKEQPINVFSG-IRKFYEPEQLANKKVICV
SYM_METCA       ----ISIDDFAKVDLRIARIANAEHVEGAXXXXXXXXXXXXXX---RTVFAGIKSAYAPETLIGRLTVMV
SYM_DICNV       ---EITIDDFAQLDLRIAKVL-ACEAVEGSDKLLKFQLDVG-DLGKRQVFSGIKRFHQPEELVGQLVVYV
SYM_CLOTE       --------DFDKIDLRVVKVISCEPVKGAXXXXXXX-VDLGGEE--RQVISGIAQYYKPEELVGKSVVLV
SYM_CHLPD       ----ISFDEFLKVDLRVATVLDC-QXXXXXXXXXXXXXXVGSET--RQVLAGIAKHYSPEEMIGKNVILV
SYM_BURCM       ----ISIDDFAKVDLRIAKIV-ACQAVEGSDKLLQLTLDIGEE-KTRNVFSGIKSAYQPEQLVGKLTVMV
SYM_BURA4       ----ISIDDFAKVDLRIAKIV-ACQAVEGSDKLLQLTLDIGEE-KTRNVFSGIKSAYQPEQLVGKLTVMV
SYM_PROVI       ----IEFDDFQKVDLRAASVIXXXXXXXXXXXXXXXXXXGSTT---RQVLAGVAEHYSPEEMVGKNVLLV
SYM_BURXL       --GIISIDDFAKIDLRIAKIVDCKAV-EGSDKLLQLTLDVGEE-KTRNVFSGIKSAYQPEQLVGKLTVMV
SYM_RALSO       MAETIAIDDFAKIDLRVAKIV-ACQRVEGSNKLLQLTLDVG-EGKTRNVFSGIQSAYAPEDLVGKLTVMV
SYM_LEPCP       IAAEIRIDDFSKVDLRIAKIVKAEAV-EGSDKLLRLTLDVG-EGRTRNVFSGIKGAYKPEDLEGKFIVMV
SYM_HALMA       ----ISFEDFEGVDMRVGEIRSAEPVEGADK-LLRLEVDIGHE--VRQVVAGLRQLHDAEKLPGTRVILL
SYM_CHLTE       ---EITFDDFQKIDLRVAKVVACEPVXXXXXXXXXXXXVGSEQRQVLSGIAQ---YFTPEQMVGKNVVLV
SYM_BURVG       ----ISIDDFAKIDLRIAKIV-ACQAVEGSDKLLQLTLDVGEE-KTRNVFSGIKSAYQPEQLVGKLTVMV
SYM_BURTA       ----ISIDDFAKIDLRIAKIV-ACQAVEGSDKLLQLTLDVGEE-KTRNVFSGIKSAYQPEQLVGKLTVMV
SYM_BURPS       ----ISIDDFAKIDLRIAKIV-ACQAVEGSDKLLQLTLDVGEE-RTRNVFSGIKSAYRPEQLVGKLTVMV
SYM_BURP6       ----ISIDDFAKIDLRIAKIV-ACQAVEGSDKLLQLTLDVGEE-RTRNVFSGIKSAYRPEQLVGKLTVMV
SYM_BURP1       ----ISIDDFAKIDLRIAKIV-ACQAVEGSDKLLQLTLDVGEE-RTRNVFSGIKSAYRPEQLVGKLTVMV
SYM_BURP0       ----ISIDDFAKIDLRIAKIV-ACQAVEGSDKLLQLTLDVGEE-RTRNVFSGIKSAYRPEQLVGKLTVMV
SYM_BURMS       ----ISIDDFAKIDLRIAKIV-ACQAVEGSDKLLQLTLDVGEE-RTRNVFSGIKSAYRPEQLVGKLTVMV
SYM_BURMA       ----ISIDDFAKIDLRIAKIV-ACQAVEGSDKLLQLTLDVGEE-RTRNVFSGIKSAYRPEQLVGKLTVMV
SYM_BURM9       ----ISIDDFAKIDLRIAKIV-ACQAVEGSDKLLQLTLDVGEE-RTRNVFSGIKSAYRPEQLVGKLTVMV
SYM_BURM7       ----ISIDDFAKIDLRIAKIV-ACQAVEGSDKLLQLTLDVGEE-RTRNVFSGIKSAYRPEQLVGKLTVMV
SYM_ACIAC       ----ITIDDFAKIDLRIALIVNCEPVEGSTK-LLRLTLDVG-EGRHRNVFSGIASAYRPEELVGKLTVMV
SYM_XANOR       ----IGMDDFAKLDLRIGKVL-VCECVEGSDKLLRFELDAG-ELGKRQIFSGIRASYEPEALVGRSVVFI
SYM_XANOP       ----IGMDDFAKLDLRIGKVL-VCECVEGSDKLLRFELDAG-ELGKRQIFSGIRASYEPEALVGRSVVFI
SYM_XANOM       ----IGMDDFAKLDLRIGKVL-VCECVEGSDKLLRFELDAG-ELGKRQIFSGIRASYEPEALVGRSVVFI
SYM_HERAR       ---EIKIDDFAKIDLRIAKIVNC-EHVEGSDKLLRLTLDMG-EGRLRNVFSGIKSAYQPEDLIGKLTVMV
SYM_CLOPE       ---EITIDDFDKIDLRVVKVLECEPVXXXXXXXXXX-VDLGGEE--RQVISGIAQYYKPEELVGKYVVLV
SYM_BURS3       ----ISIDDFAKIDLRIAKIV-ACQAVEGSDKLLQLTLDVGEE-KTRNVFSGIKSAYQPEQLVGKLTVMV
SYM_BURM1       ----ISIDDFAKIDLRIAKIV-ACQAVEGSDKLLQLTLDVGEE-KTRNVFSGIKSAYQPEQLVGKLTVMV
SYM_BURCJ       ----ISIDDFAKIDLRIAKIV-ACQAVEGSDKLLQLTLDVGEE-KTRNVFSGIKSAYQPEQLVGKLTVMV
SYM_BURCH       ----ISIDDFAKIDLRIAKIV-ACQAVEGSDKLLQLTLDVGEE-KTRNVFSGIKSAYQPEQLVGKLTVMV
SYM_BURCC       ----ISIDDFAKIDLRIAKIV-ACQAVEGSDKLLQLTLDVGEE-KTRNVFSGIKSAYQPEQLVGKLTVMV
SYM_BURCA       ----ISIDDFAKIDLRIAKIV-ACQAVEGSDKLLQLTLDVGEE-KTRNVFSGIKSAYQPEQLVGKLTVMV
SYM_JANMA       ---EIKIDDFAKIDLRIAKIVNC-EHVEGSDKLLRLTLDVG-EGRMRNVFSGIKSAYKPEDLIGKLTVMV
SYM_ENTS8       ----ITFDDFAKIDLRVA-LIENAEFVDGSDKLLRLTLDLDGEKRNVFSGIR-SAYPDPQALIGRLTVMV
SYM_DECAR       --------DFMKVDLRIVRIANAEHVEGADK-LVRLTLDVGNN-ETRNVFAGIKAAYDPAQLIGRLTVMV
SYM_CUPTR       ---------FAKIDLRVAKIVECQKVEGSNK-LLQLTLDLG-EGRTRNVFSGIQSAYTPEQLVGKLTVVV
SYM_LACPL       ----ITIDDFDKVELKVAEVITVQKLKGADK-LLQFRLDAGDADHRQILSGIAKWYPEPEELIGKKVIIV
SYM_POLNA       ----ITIDDFAKVDLRIAKIVEAV---EGSTKLLRLTLDAG-EGRMRNVFSGIASSYRPADLIGKHTVLV
SYM_LISMO       ---QIGIEDFDKIDLRXXXXXXXXXXXXXXX-LLCFQLDLG-EGKLRQVLSGIAEFYQPEELIGKKVIVV
SYM_LISMF       ---QIGIEDFDKIDLRXXXXXXXXXXXXXXX-LLCFQLDLG-EGKLRQVLSGIAEFYQPEELIGKKVIVV
SYM_LISIN       ---QIGIEDFDKIDLRXXXXXXXXXXXXXXX-LLCFQLDLG-EGKLRQVLSGIAEFYQPEELIGKKVIVV
SYM_ERWT9       ----ISFDDFAKVDMRIA-LIENAELVDGSDKLLRLTLDIGGEKRNVFSGIR-AAYPDPALLVGRLTVMV
SYM_BORT9       ----------EKVCLKVVQIKTIERNPDAEKLFI-LKLDDGTPDG-KQIVSSLADYYKEEKLIGKHIIIV
SYM_ACIAD       ----IGIEDFIKVDLRVALVQEAATV-EGSDKLLQLTLDVG-EAEPRNVFSGIREFYQPEDLKGKLVVMV
SYM_VIBHB       ------------VDMRIARIISCEEVPKANK-LLKFQLDIGGET--RQVFSGIKSAYKPEELEGKLTVMV
SYM_BORA1       ----ISIDDFVKVDLRIAKIINCEEVEGSTK-LLRLTLDAG-EGRHRNVFSGIKSFYKPQDLIGKLTVLV
SYM_SHEDO       ISDEISFEDFAKLDLRIALIAKAEHVXXXXXXXXXXXXXGGV---TKQVFAGIKSAYAPEDLEGKLTVMV
SYM_PSYCK       ----IGIEDFAKVEMKVAHVI-ACNHVEGADKLLQFTLDVG-EAQPRNVFSGIRKFYEPEQLQGKKVICV
SYM_DIAST       ----ITIDDFAKVDLRIAKIVEAV---EGSTKLLRLTLDAG-EGQTRNVFSGIASMYKPEDLQGKLTVMV
SYM_CHLL2       ---EISFDDFLKVDLRVATXXXXXXXXXXXXXXXXXXXXXTEARQVLAGIAQF---YSPEEMVGKQVVLV
SYM_NATPD       ----ISFGDFQDLDIRVAEVLEAEPI-EGADDLAKLAVDIGVE--TRQIVAGIKQLHDLDSLSGTRIVVV
SYM_PSYA2       ----IGIEDFAKVEMKVAHVI-ACSYVEGADKLLQFTLDVG-EAQPRNVFSGIRKFYEPEQLLDKKVICV
SYM_METPE       ----ISIDEFGKMKLIVGTVISAEKIPXXXXXXXXI-VDLGSER--RQIVSGIAKFYDPEHLVGSSVVVI
SYM_HALWD       ----IDFEEFEELDLRVAEIIETEPIEDADKLA-RIVVDLG--IEQRQLVAGIRQLHDLDDLIGETVVIV
SYM_CAMJE       --------DFAKIEIKVAKVLDCQNI-EGSEKLLKFQLELDDK-EIRQVLSGIAKYYKASDLIGKQVCVI
SYM_BORPE       ----ITIDDFAKIDLRIARIVNCEEVEGSTK-LLRLTLDVG-EGRHRNVFSGIKSAYQPQDLVGKLTVLV
SYM_BORPA       ----ITIDDFAKIDLRIARIVNCEEVEGSTK-LLRLTLDVG-EGRHRNVFSGIKSAYQPQDLVGKLTVLV
SYM_BORBR       ----ITIDDFAKIDLRIARIVNCEEVEGSTK-LLRLTLDVG-EGRHRNVFSGIKSAYQPQDLVGKLTVLV
SYM_ACISJ       ----ITIDDFAKVDLRIAKIVEAV---EGSTKLLRLTLDVG-EGQTRNVFSGIASMYKPKDLQGKLTVMV
SYM_SHEB9       ISETINFDDFAKIDLRIARIVKAEHVXXXXXXXXXXXXIGGET---RQVFAGIKSAYSPEDLEGKLTVMV
SYM_SHEB5       ISETINFDDFAKIDLRIARIVKAEHVXXXXXXXXXXXXIGGET---RQVFAGIKSAYSPEDLEGKLTVMV
SYM_SHEB2       ISETINFDDFAKIDLRIARIVKAEHVXXXXXXXXXXXXIGGET---RQVFAGIKSAYSPEDLEGKLTVMV
SYM_IDILO       IADEISFDDFAKVDLRVARIANA---EHVEGAXXXXXXXXXXXXXXRQVFAGIKSAYDPEALKGQLTVMV
SYM_VEREI       ----IGIDDFDRVDLRVALIVDCAAVAGSTK-LLRLTLDIG-EGRQRQVFSGIASACQPADLIGKHTVMV
SYM_SHEB8       ISETINFDDFAKIDLRIARIIKAEHVXXXXXXXXXXXXIGGET---RQVFAGIKSAYSPEDLEGKLTVMV
G4P1_YEAST      ------------IDFRVGFIQKAIKHPDADSLYVST-IDVGDEEGPRTVCSGLVKHFPLDAMQERYVVVV
SYM_METTH       ------------MDIRVGVIRSAERI-EGSDKLLKLIIDVGERE--MQVVAGLAEKYSPEDLVERKITVL


                         .         .         *         .         .         .         .:140
query           VNFPPRQIGPFRSEVLTLGFADANGDIVLAAVERPVPNGEKMC
CSAA_BACSU      VNFPPRRIAGFKSEVLVLGGIPGQGDVVLLQPDQPVPNGTKI-
SYM_PORG3       ANLPPRKLKGIESEGMILSAEDADGSVIMPAAE----------
SYM_PORGI       ANLPPRKLKGIESEGMILSAEDADGSVIMPAAE----------
SYM_BDEBA       VNLKPRKMKFGMSEGMVLAAGTGGSDLFVLSADDGAQVGQRV-
SYM_PARD8       ANLAPRKLKGIVSEGMILSAENFDGKLAVITPEKEVKPGSEV-
SYM_BACTN       ANLAPRKLKGIVSEGMILSAENNDGSLAVIMPQKEVKPGSEV-
SYM_METJA       CNLKPAKLCGVLSEGMILAAEDDEGNVSLLTVDKDIKAGSKV-
SYM_FLAJ1       ANLAPRALRGVESQGMILMTTNAEGKLVFVNPDADAPNG----
SYM_BACFR       ANLAPRKLKGIVSEGMILSAENNDGSLAVVMPGREVKPGSEV-
SYM_BACFN       ANLAPRKLKGIVSEGMILSAENNDGSLAVVMPGREVKPGSEV-
SYM_BACV8       ANLAPRQFNGLVSEGMILSAENFDGTLAVTSLLREVKPGSEV-
SYM_LEPIN       ANLKPRKM-----------------------------------
SYM_LEPIC       ANLKPRKM-----------------------------------
SYM_CHLCH       ANLEERTIRGELSQGMILAVENSDGKLFIVQPSGEGINGQSV-
SYM_METBF       ANLKPAKLCGVKSNGMMLA-ADDGGEIVSA-------------
SYM_META3       CNLKPAKLCGVESQGMVLAAGDE--EVALLSPEKDLPVGSTIC
SYM_FLAPJ       VNLAPRALRGIESQGMIL-------------------------
SYM_SHEWM       ANLAPRKMRFGMSEGMVLAAGPGNKDL----------------
SYM_METTP       ANLEPVKIFGVESRGMLLA-ADINGDAVLLKPDKEVPAG----
SYM_CHLT3       ANLAPRKMRGMESQGMVLAVEDAAG------------------
SYM1_BACAN      TNLKPVKLRGELSQGMILA-GEENGVLSLASIDQNIPNGTKI-
SYM_SHESH       ANLAPRKMRFGMSEGMVLAAGPGNKDL----------------
SYM_THICR       ANLKPRKMRFGLSEGMVLAAGPGGKDLFL--------------
SYM_STAHJ       TNLKPAKLMGQKSEGMILS-AEKDGVLTLVSLPSAIPNG----
SYM_PYRFU       ANLEPKKLRGVESQGMLLA-ADDGEKVALLMPDKEVKLGAKV-
SYM_METMA       ANLKPAKLCGVESNGMMLA-ADDGGAIVAALMDKEIKSGSRI-
SYM1_BACCR      TNLKPVKLRGELSQGMILA-GEENGVLSLASIDQNLPNGTKI-
SYM_METBU       TNLAPAKLCGVESNGMVLAGVDAADNAILLQPEKETNPG----
SYM_NANEQ       NNLKPKQLRGITSEGMLLA-ADDGKEVALLMPDKPISLGSKV-
SYM_LEPBP       ANLKPRQMKFGLSEAMLL-------------------------
SYM_LEPBA       ANLKPRQMKFGLSEAMLL-------------------------
SYM_THETN       YNLQPRKLMGIESQGMLLA-ATNEGKMALLTVDKDIESGSKI-
SYM_PYRHO       ANLEPKKLRGVESQGMLLA-ADDGENVALLMPDKEVKLGAKV-
SYM_PYRAB       ANLEPKKLRGIGSQGMLLA-ADDGERVALLMPDKEVKLGAKV-
SYM_GRAFK       ANLAPRKLRGVDSEGMILMTENAEGKLV---------------
SYM_THEMA       ANLKPAKLMGIESQGMLLA-AKSGDTLRLLTVDGEITPGAKV-
SYM_SHEAM       ANLAPRKMRFGMSEGMVLAAGPGGKDL----------------
SYM_METAC       ANLKPAKLCGVESNGMMLA-ADDGGAIVAA-------------
SYM_BACSU       TNLKPVKLRGELSQGMILA-GEADGVLKVVSIDQSLPKGTRI-
SYM_STAAR       TNLKPAKLMGQKSEGMILS-AEKDGVLTLVSLPSAIPNG----
SYM_STAAN       TNLKPAKLMGQKSEGMILS-AEKDGVLTLVSLPSAIPNG----
SYM_STAAM       TNLKPAKLMGQKSEGMILS-AEKDGVLTLVSLPSAIPNG----
SYM_STAAC       TNLKPAKLMGQKSEGMILS-AEKDGVLTLVSLPSAIPNG----
SYM_METKA       ANIQPKEMFGVRSEAMILAVGDEPALLTIDESKREVEPGERI-
SYM_SHELP       ANLAPRKMRFGMSEGMVLAAGPGKKDL----------------
SYM_PHOPR       ANLKPRKMKFGMSEGMILAAGPGGKDL----------------
SYM_PELLD       ANLAPRTIRGEISEGMLLAVEGEGGRLFMVE-----PQGEKI-
SYM_ACTSZ       ANLAPRKMKFGMSEGMILSAGSGGEDLFLLDVDAGVKAGSRV-
SYM_STAS1       TNLKPAKLMGRKSEGMILS-AEKDGVLTLVSLPSAIPNG----
SYM_STAAW       TNLKPAKLMGQKSEGMILS-AEKDGVLTLVSLPSAIPNG----
SYM_STAAS       TNLKPAKLMGQKSEGMILS-AEKDGVLTLVSLPSAIPNG----
SYM_PYRKO       ANLEPKKLRGVESQGMLLA-ADDGERVALLMPDKEVKLGARI-
SYM_HELPJ       ANLKPAKLMGEMSEGMILAVRD-NDNLALISPTR---------
SYM_TOLAT       ANLAPRKMRFGMSEGMVLAAGPGGKDLFI--------------
SYM_STAES       TNLKPAKLMGQKSEGMILS-AEKDGVLTLISLPSAIPNG----
SYM_STAEQ       TNLKPAKLMGQKSEGMILS-AEKDGVLTLISLPSAIPNG----
SYM_LEPBL       ANLKPRKM-----------------------------------
SYM_LEPBJ       ANLKPRKM-----------------------------------
SYM_BACHD       TNLKPVKLRGELSQGMIL--AGSEGDLRLATVDGALPNG----
SYM_AERHH       ANLAPRKMRFGMSEGMVLAAGPGGKDL----------------
SYM1_SORC5      ANLAPRKMKFGLSEGMVLAAGD---------------------
SYM_SHEPA       ANLAPRQMRFGVSEGMVLAAGPGGKDL----------------
SYM_METHJ       TNLKPAKIFGIESNGMILAAGD---NASLLRPETPVPSGTKI-
SYM_SHESR       ANLAPRKMRFGMSEGMVLAAGPGGSDL----------------
SYM_SHEON       ANLAPRKMRFGMSEGMVLAAGPGGSDL----------------
SYM_DEIRA       ANLKPAKLRGIESQGMILAAEDDAGNLDLVGTELDLPSGTKV-
SYM_VIBVY       ANLKPRKMKFGMSEGMILAAGPGGKDL----------------
SYM_VIBVU       ANLKPRKMKFGMSEGMILAAGPGGKDL----------------
SYM_NEIM0       ANFAPRKMAKFGSEGMILSAATADGKLKLLDVDAGAQPGDKV-
SYM_SHEFN       ANLAPR----------TMKFGDSEG-MVLAA------------
SYM_METB6       TNLAPAKIFGVESNGMILAAGDAAS---LLTPLKPVEPGTKI-
SYM_HELPY       ANLKPAKLMGEMSEGMILAVRDSD-------------------
SYM_SHEHH       ANLAPRQMRFGVSEGMVLAAGPGGKDL----------------
SYM_NEIMB       ANFAPRKMAKFGSEGMILSAATADGKLKLLDVDTGAQPGDKV-
SYM_NEIMA       ANFAPRKMAKFGSEGMILSAATADGKLKLLDVDAGAQPGDKV-
SYM_MANSM       ANLAPRKMKFGVSEGMILSAGTGGEDLYLLDVDAGVKAGSRV-
SYM_SHESA       ANLAPRKMRFGMSEGMVLAAGPGGSDL----------------
SYM_PARUW       ANLKPANLMGVTSQGMLLA-AKGEGNLKLISIEDVAP------
SYM_NEIMF       ANFAPRKMAKFGSEGMILSAATAEGKLKLLDVDAGAQPGDKV-
SYM_SHESM       ANLAPRKMRFGMSEGMVLAAGPGGSDL----------------
SYM_ALISL       ANLKPRKMKFGMSEGMILAAGPGGKDL----------------
SYM_UNCMA       ANLKPTKIMGVESNGMILA-ADSNG-ATLLTVEKPSEPGTKV-
SYM_SHESW       ANLAPRKMRFGMSEGMVLAAGPGGSDL----------------
SYM_SHEPC       ANLAPRKMRFGMSEGMVLAAGPGGSDL----------------
SYM_THIDA       ANLAPRKMKFGMSEGMVLAASNPDG------------------
SYM_THEON       ANLEPKKLRGIESQGMLLA-ADDGENVALLMPDKEVKLGARI-
SYM_PSYIN       ANLAPRQMKFGLSEGMVLATGPGGKEI----------------
SYM_NEIG1       ANFAPRKMAKFGSEGMILSAATADGKLKLLDVDAGAQPGDKV-
SYM_ACTPJ       ANLAPRKMKFGVSEGMILSAGTGGADLFLLSADEGIRPG----
SYM_ACTP7       ANLAPRKMKFGVSEGMILSAGTGGADLFLLSADEGIRPG----
SYM_ACTP2       ANLAPRKMKFGVSEGMILSAGTGGADLFLLSADEGIRPG----
SYM_METLZ       VNLKPAK---FRGEESNGMLFAAGEEASLLVPLKDVPEGTKV-
SYM_METS3       VNLQPAKLFGTLSEGMILATGES--------------------
SYM_SACD2       ANLKPRKMKFGMSEGMVL-------------------------
SYM_NITEU       ANLAPRKMKFGLSEGMVLAASGENG------------------
SYM_HAHCH       ANLEPRKMKFGMSEGMVLAAGPGGKDIWL--------------
SYM_AZOSB       ANLAPRKMKFGMSEGMVLAASDPDG------------------
SYM_HAES1       ANLAPRKMKFGMSEGMILSAGNGGADLYLLDVDAGAKAGQRV-
SYM_HAEDU       ANLAPRKMKFGLSEGMILSAGTGGADLFL--------------
SYM_ENTFA       ANLKPRKMRGQISQGMILSAESPEGKLQIVEAPKEMPNG----
SYM_RHOBA       ANLKPRKMGPGGEEVFVLG------------------------
SYM_PSEA6       ANLAPRKMRFGMSEGMVLAAGPGGKDL----------------
SYM_NITEC       ANLAPRKMKFGLSEGMVLAASGESGGPFLLAPDSGAQPGMRV-
SYM_MARAV       ANLKPRKMKFGMSEGMVLAAGPGGKEIFILSPDSGATPGMRV-
SYM_HAES2       ANLAPRKMKFGMSEGMILSAGNGGADLYLLDVDAGAKAGQRV-
SYM_XANAC       ANLAPRKM-----------------------------------
SYM_VIBCH       ANLKPRKMKFGMSEGMILAAGPGGSDLWL--------------
SYM_VIBC3       ANLKPRKMKFGMSEGMILAAGPGGSDLWL--------------
SYM_METFK       ANLAPRKMKFGLSEGMVLAASDERG------------------
SYM_BACST       ANLKPAKLRGEWSEGMILA-XXXXXXFSLATVDQHVPNGTKI-
SYM_XYLFT       ANLAPRKMGISQGMILSAGF--DNGTLAL--------------
SYM_XYLF2       ANLAPRKMGISQGMILSAGF--DNGTLAL--------------
SYM_METVS       CNLKPAKLCGVESEGMLLA-AESDGIVSLLNIDREISLGSKI-
SYM_LEGPL       ANLEPRTMRFGVSEGMVLAAGDGQGIYLL--------------
SYM_LEGPC       ANLEPRTMRFGVSEGMVLAAGDGQGIYLL--------------
SYM_HAEPS       ANLAPRKMSFGMSEGMILSAGTGGADLYLLSADSGVTAG----
SYM_SALSV       ANLAPRKMRFGVSEGMVMAAGPGGKDIFLLSPDDGAKPGQQV-
SYM_SALRD       ANMAPKEMFGFESQGMVLMAEEPDGTFVPVTTE----------
SYM_SALPC       ANLAPRKMRFGVSEGMVMAAGPGGKDIFLLSPDDGAKPGQQV-
SYM_METM5       CNLKPAKLCGVESQGMLLA-AEDDSIVSLLALDRDLPVGSKI-
SYM_LEGPH       ANLEPRTMRFGVSEGMVLAAGDGQGIYLL--------------
SYM_LEGPA       ANLEPRTMRFGVSEGMVLAAGDGQGIYLL--------------
SYM_XYLFM       ANLAPRKMGISQGMILSAGF-----------------------
SYM_XYLFA       ANLAPRKMGISQGMILSAGF-----------------------
SYM_SALPK       ANLAPRKMRFGVSEGMVMAAGPGGKDIFLLSPDDGAKPGQQV-
SYM_SALPA       ANLAPRKMRFGVSEGMVMAAGPGGKDIFLLSPDDGAKPGQQV-
SYM_SALG2       ANLAPRKMRFGVSEGMVMAAGPGGKDIFLLSPDDGAKPGQQV-
SYM_SALEP       ANLAPRKMRFGVSEGMVMAAGPGGKDIFLLSPDDGAKPGQQV-
SYM_SALCH       ANLAPRKMRFGVSEGMVMAAGPGGKDIFLLSPDDGAKPGQQV-
SYM_NITMU       ANLAPRKMKFGISEGMVLAAGDGEGPYLLSPDEGARP------
SYM_METM7       CNLKPAKLCGVESQGMLLA-AEDDSIVSLLALDRDLPVGSKI-
SYM_ENT38       ANLAPRKMRFGISEGMVMAAGPGGKDIFLLSPDEGAKPGQQV-
SYM_CYTH3       ANLAPREIKGIVSQGMILMAEDADGSL----------------
YGJH_ECOLI      CNLQKAKMRGETSECMLLAETDDGSESVLLTPERMMPAGVRV-
SYM_METMJ       ANLAPAKIFGVESRGMILAAGD---EASLLVPLRPVKPGTKI-
SYM_XANCP       ANLAPRKMGISEGMILSAGF-----------------------
SYM_XANC8       ANLAPRKMGISEGMILSAGF-----------------------
SYM_VIBPA       ANLKPRKMKFGMSEGMILAAGPGGSDL----------------
SYM_VIBFM       ANLKPRKMKFGMSEGMILAAGPGGKDL----------------
SYM_THET8       ANLKPAKLRGIESQGMILA-AQEGEALALVTVEGEVPPG----
SYM_SALAR       ANLAPRKMRFGVSEGMVMAAGPGGKDIFLLSPDDGAKPGQQV-
SYM_HAEIE       ANLAPRKMKFGVSEGMILSAGTGGSDLFLLSADSGVTAG----
SYM_ARCFU       ANLKPAKFMGVESRGMILA-AEKDGKAVLLTPEKEVEPGTRVC
SYM_STRR6       ANLKPRKMKKYVSQGMILS-AEHDGKLTLLTVDPAVPNG----
SYM_STRPN       ANLKPRKMKKYVSQGMILS-AEHDGKLTLLTVDPAVPNG----
SYM_SALTY       ANLAPRKMRFGVSEGMVMAAGPGGKDIFLLSPDDGAKPGQQV-
SYM_SALTI       ANLAPRKMRFGVSEGMVMAAGPGGKDIFLLSPDDGAKPGQQV-
SYM_SALPB       ANLAPRKMRFGVSEGMVMAAGPGGKDIFLLSPDDGAKPGQQV-
SYM_SALNS       ANLAPRKMRFGVSEGMVMAAGPGGKDIFLLSPDDGAKPGQQV-
SYM_SALHS       ANLAPRKMRFGVSEGMVMAAGPGGKDIFLLSPDDGAKPGQQV-
SYM_SALDC       ANLAPRKMRFGVSEGMVMAAGPGGKDIFLLSPDDGAKPGQQV-
SYM_SALA4       ANLAPRKMRFGVSEGMVMAAGPGGKDIFLLSPDDGAKPGQQV-
SYM_CHRVO       ANLAERKMGVSQGMIVCASGVDDSEGLFLLDVDAGVKPGMRV-
SYM_SHISS       ANLAPRKMRFGISEGMVMAAGPGGKDIFLLSPDAGAKPGHQV-
SYM_SHIFL       ANLAPRKMRFGISEGMVMAAGPGGKDIFLLSPDAGAKPGHQV-
SYM_SHIF8       ANLAPRKMRFGISEGMVMAAGPGGKDIFLLSPDAGAKPGHQV-
SYM_SHIDS       ANLAPRKMRFGISEGMVMAAGPGGKDIFLLSPDAGAKPGHQV-
SYM_SHIBS       ANLAPRKMRFGISEGMVMAAGPGGKDIFLLSPDAGAKPGHQV-
SYM_SHIB3       ANLAPRKMRFGISEGMVMAAGPGGKDIFLLSPDAGAKPGHQV-
SYM_METMP       CNLKPAKLCGVESQGMLLA-AEDDSIVSLLSLDRDLPVGSKI-
SYM_ESCF3       ANLAPRKMRFGISEGMVMAAGPGGKDIFLLSPDAGAKPGHQV-
SYM_ECOUT       ANLAPRKMRFGISEGMVMAAGPGGKDIFLLSPDAGAKPGHQV-
SYM_ECOSM       ANLAPRKMRFGISEGMVMAAGPGGKDIFLLSPDAGAKPGHQV-
SYM_ECOSE       ANLAPRKMRFGISEGMVMAAGPGGKDIFLLSPDAGAKPGHQV-
SYM_ECOLU       ANLAPRKMRFGISEGMVMAAGPGGKDIFLLSPDAGAKPGHQV-
SYM_ECOLI       ANLAPRKMRFGISEGMVMAAGPGGKDIFLLSPDAGAKPGHQV-
SYM_ECOLC       ANLAPRKMRFGISEGMVMAAGPGGKDIFLLSPDAGAKPGHQV-
SYM_ECOL6       ANLAPRKMRFGISEGMVMAAGPGGKDIFLLSPDAGAKPGHQV-
SYM_ECOL5       ANLAPRKMRFGISEGMVMAAGPGGKDIFLLSPDAGAKPGHQV-
SYM_ECOK1       ANLAPRKMRFGISEGMVMAAGPGGKDIFLLSPDAGAKPGHQV-
SYM_ECOHS       ANLAPRKMRFGISEGMVMAAGPGGKDIFLLSPDAGAKPGHQV-
SYM_ECODH       ANLAPRKMRFGISEGMVMAAGPGGKDIFLLSPDAGAKPGHQV-
SYM_ECOBW       ANLAPRKMRFGISEGMVMAAGPGGKDIFLLSPDAGAKPGHQV-
SYM_ECO8A       ANLAPRKMRFGISEGMVMAAGPGGKDIFLLSPDAGAKPGHQV-
SYM_ECO81       ANLAPRKMRFGISEGMVMAAGPGGKDIFLLSPDAGAKPGHQV-
SYM_ECO7I       ANLAPRKMRFGISEGMVMAAGPGGKDIFLLSPDAGAKPGHQV-
SYM_ECO5E       ANLAPRKMRFGISEGMVMAAGPGGKDIFLLSPDAGAKPGHQV-
SYM_ECO57       ANLAPRKMRFGISEGMVMAAGPGGKDIFLLSPDAGAKPGHQV-
SYM_ECO55       ANLAPRKMRFGISEGMVMAAGPGGKDIFLLSPDAGAKPGHQV-
SYM_ECO45       ANLAPRKMRFGISEGMVMAAGPGGKDIFLLSPDAGAKPGHQV-
SYM_ECO27       ANLAPRKMRFGISEGMVMAAGPGGKDIFLLSPDAGAKPGHQV-
SYM_ECO24       ANLAPRKMRFGISEGMVMAAGPGGKDIFLLSPDAGAKPGHQV-
SYM_CITK8       ANLAPRKMRFGISEGMVMAAGPGGKDIFLLSPDDGAKPGQQV-
SYM_VIBSL       ANLKPRKMKFGMSEGMILAAGPGGSDL----------------
SYM_VIBF1       ANLKPRKMKFGMSEGMIL-------------------------
SYM_HAEIG       ANLAPRKMKFGVSEGMILSAGTGGSDLFLLSADNGVTAG----
SYM_AZOSE       ANLAPRKMKFGVSEGMVLAASSAD-------------------
SYM_ACIF5       ANLAPRKMRFGLSEGMVLAASGPEG------------------
SYM_ACIF2       ANLAPRKMRFGLSEGMVLAASGPEG------------------
SYM_XANC5       ANLAPRKM-----------------------------------
SYM_RALEH       ANLAPRKMGVSEGMVLAASAADEKGLYILEPHEGAVP------
SYM_POLSJ       ANLAPRKMGVSEGMVLAASHADEKAQPGIYVLE-PLP------
SYM_PELPB       ANLADRTIRDDVSEGMILAVEGADGKLFVIEPEGEEINGRQI-
SYM_OCEIH       ANLKPRKMRGEISQGMILS-AEYDGKLQIVEAPSEAPNGSSI-
SYM_NITOC       ANLAPRKMRFGISEGMVLAAGPGGKEIYL--------------
SYM_HAEIN       ANLAPRKMKFGVSEGMILSAGTGGSDLFLLSADSGVTAG----
SYM_COLP3       ANLAPRKMRFGMSEGMVLAAGPGDKDL----------------
SYM_XANCB       ANLAPRKM-----------------------------------
SYM_STRMK       ANLAPRKM-----------------------------------
SYM_RALEJ       ANLAPRKMGVSEGMVLAASAADEKANPGLYILE----------
SYM_PASMU       ANLAPRKMRFGVSEGMILSAGTGGADLFLLNADQGVKPG----
SYM_HAEI8       ANLAPRQMKFGVSEGMILSAGTGGSDLFLLSADNGVTAG----
SYM_FRATW       ANLAPRKMKFGMSEGMVLAAGDGKGIYILEPHEGAQP------
SYM_FRATT       ANLAPRKMKFGMSEGMVLAAGDGKGIYILEPHEGAQP------
SYM_FRATO       ANLAPRKMKFGMSEGMVLAAGDGKGIYILEPHEGAQP------
SYM_FRATH       ANLAPRKMKFGMSEGMVLAAGDGKGIYILEPHEGAQP------
SYM_FRATF       ANLAPRKMKFGMSEGMVLAAGDGKGIYILEPHEGAQP------
SYM_FRAT1       ANLAPRKMKFGMSEGMVLAAGDGKGIYILEPHEGAQP------
SYM_ALHEH       ANLKPRKMKFGVSEGMVLAAGPGGSDLYL--------------
SYM_KLEP7       ANLAPRKMRFGISEGMVMAAGPGGKDIFLLSPDDGAKPGQQV-
SYM_KLEP3       ANLAPRKMRFGISEGMVMAAGPGGKDIFLLSPDDGAKPGQQV-
SYM_FRATN       ANLAPRKMKFGMSEGMVLAAGDGKGIYILEPHEGAQP------
SYM_BORRA       DNLKPAKFRGIRSEGMLIATKDENKNFKIIIVENPIP-GERV-
SYM_BORDL       DNLKPAKFRGIRSEGMLIATEDENKNFKIIIVENPIP-GERV-
SYM_CHRSD       ANLAPRKMRFGVSEGMVLAAGDKEGGIYLLSPDNGAEPGQRV-
SYM_STRM5       ANLAPRKM-----------------------------------
SYM_RALME       ANLAPRKMKFGMSEGMVLAASAAD-------------------
SYM_MYXXD       ANLKPRKLKGIESRGMLL-------------------------
SYM_RHOFD       ANLAPRKM-----------------------------------
SYM_PSYWF       TNLAPRKMKFGVSEGMILSSGDPKTGLVVITLPDECKVGDKL-
SYM_METCA       ANLAPRKMKFGLSEGMVLAAGPGGGDIFLLSPDEGAQPGMKV-
SYM_DICNV       ANLKPRKMRFGVSEGMILSASD---------------------
SYM_CLOTE       ANLKPAKLGELSQGMILAAATDDDSKLFTVSIPGELPTGSQV-
SYM_CHLPD       ANLAERTILNEISQGMILAVEGTDGKLFLVEPSGKEINGKKI-
SYM_BURCM       ANLAPRKMKFGLSEGMVLAASAAD-------------------
SYM_BURA4       ANLAPRKMKFGLSEGMVLAASAAD-------------------
SYM_PROVI       ANLAPRTIRGEVSEGMLLAVEGDAGKLYMVE-----PQGEKI-
SYM_BURXL       ANLAPRKMKFGLSEGMVL-------------------------
SYM_RALSO       ANLAPRKMKFGMSEGMVLAASAAD-------------------
SYM_LEPCP       ANLAPRKMKFGISEGMVLAASHAD-------------------
SYM_HALMA       ANMEKAELFGIESNGMVLAAGD-EADLLTTHEDAPL-------
SYM_CHLTE       ANLADRTMRGELSQGMILTVEGADGRLFLLEPQGEGINGNSV-
SYM_BURVG       ANLAPRKMKFGLSEGMVLAASAAD-------------------
SYM_BURTA       ANLAPRKMKFGLSEGMVLAASAAD-------------------
SYM_BURPS       ANLAPRKMKFGLSEGMVLAASAAD-------------------
SYM_BURP6       ANLAPRKMKFGLSEGMVLAASAAD-------------------
SYM_BURP1       ANLAPRKMKFGLSEGMVLAASAAD-------------------
SYM_BURP0       ANLAPRKMKFGLSEGMVLAASAAD-------------------
SYM_BURMS       ANLAPRKMKFGLSEGMVLAASAAD-------------------
SYM_BURMA       ANLAPRKMKFGLSEGMVLAASAAD-------------------
SYM_BURM9       ANLAPRKMKFGLSEGMVLAASAAD-------------------
SYM_BURM7       ANLAPRKMKFGLSEGMVLAASAAD-------------------
SYM_ACIAC       ANLAPRKMKFGVSEGMVL--AASHGD-----------------
SYM_XANOR       ANLAPRKM-----------------------------------
SYM_XANOP       ANLAPRKM-----------------------------------
SYM_XANOM       ANLAPRKM-----------------------------------
SYM_HERAR       ANLAPRKMKFGISEGMVLAASAAD-------------------
SYM_CLOPE       ANLKPVKLRGELSQGMILAAAPSDDSELL--------------
SYM_BURS3       ANLAPRKMKFGLSEGMVL-------------------------
SYM_BURM1       ANLAPRKMKFGLSEGMVL-------------------------
SYM_BURCJ       ANLAPRKMKFGLSEGMVL-------------------------
SYM_BURCH       ANLAPRKMKFGLSEGMVL-------------------------
SYM_BURCC       ANLAPRKMKFGLSEGMVL-------------------------
SYM_BURCA       ANLAPRKMKFGLSEGMVL-------------------------
SYM_JANMA       ANLAPRKMKFGISEGMVLAASAAD-------------------
SYM_ENTS8       ANLAPRKMRFGISEGMVMAAGPGGKDIFLLSPDSGAKPGQQV-
SYM_DECAR       ANLAPRKMKFGLSEGMVLAASDGEG------------------
SYM_CUPTR       ANLAPRKMGVSEGMVLAASAAD---------------------
SYM_LACPL       GNLKPRKLRGEMSQGMLLS-AEHDGQVQLITVPDNMVNG----
SYM_POLNA       ANLAPRKMGISEGMVLAASHADEKSNPGIYVLE-PLP------
SYM_LISMO       SNLKPVKLRGLMSEGMILS-GEKDGKLSVIEASSALPNGAKV-
SYM_LISMF       SNLKPVKLRGLMSEGMILS-GEKDGKLSVIEASSALPNGAKV-
SYM_LISIN       SNLKPVKLRGLMSEGMILS-GEKDGKLSVIEANSALPNGAKV-
SYM_ERWT9       ANLAPRKMRFGLSEGMVMAAGPGGKDIFLLSPDSGAQPGQQV-
SYM_BORT9       DNLKPAKFRGIKSEGMLIATEDENKNFKVIIVENPIP-GERI-
SYM_ACIAD       ANLAPRKMGISNGMVLAAGNGD---------------------
SYM_VIBHB       ANLKPRKMKFGMSEGMILAAGPGGSDL----------------
SYM_BORA1       ANLAPRKMGVSEGMVLAASHADEKVDAGIYVLE-PWPGAQ---
SYM_SHEDO       ANLAPRKMRFGMSEGMVLA-AGPGGD-----------------
SYM_PSYCK       TNLAPRKMKFGISEGMVLSSGDPKTGLVVITLPDEAVIGDSL-
SYM_DIAST       ANLAPRKMKFGLSEGMVLAASHAD-------------------
SYM_CHLL2       ANLAERTIRGEISQGMILAVEGADGRLCVVEPVGDEINGQQI-
SYM_NATPD       ANLEKAEL-----------------------------------
SYM_PSYA2       TNLAPRKMKFGISEGMILSSGDPKTQLTVVTL-----------
SYM_METPE       ANLQPVTIFGVESRGMILAAGD---------------------
SYM_HALWD       ANLEKAEI-----------------------------------
SYM_CAMJE       SNLKKAKIFGHESDGMILS-AKSGDKLVLIAPEQLVQNG----
SYM_BORPE       ANLAPRKMGVSEGMVLAASHADEKAEPGIYVLE-PWPGAQ---
SYM_BORPA       ANLAPRKMGVSEGMVLAASHADEKAEPGIYVLE-PWPGAQ---
SYM_BORBR       ANLAPRKMGVSEGMVLAASHADEKAEPGIYVLE-PWPGAQ---
SYM_ACISJ       ANLAPRKMKFGLSEGMVLAASHAD-------------------
SYM_SHEB9       ANLAPRKMRFGMSEGMVLAAGPGGSDL----------------
SYM_SHEB5       ANLAPRKMRFGMSEGMVLAAGPGGSDL----------------
SYM_SHEB2       ANLAPRKMRFGMSEGMVLAAGPGGSDL----------------
SYM_IDILO       ANLAPRKMRFGLSEGMVLAAGPGKDEIYI--------------
SYM_VEREI       ANLAPRRLKFGVSEGMVL--AASHGD-----------------
SYM_SHEB8       ANLAPRKMRFGMSEGMVLAAGPGGSDL----------------
G4P1_YEAST      CNLKPVNMRGIKSTAMVL-------------------------
SYM_METTH       VNLKPAKLFGVKSEGMVLATGES--------------------