[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for atum0:AAK87977.1

[Show Plain Result]


## Summary of Sequence Search
    1::155
    1::115     4e-10  34%  141 aa  YDEM_BACSU RecName: Full=Uncharacterized protein ydeM;
    1::155

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRLAELSPIGERVTLDTLHFSAEDIIRFARDFDPQPFHLDAEAARNSVFGGLCASGWHTGAGWMKSFLSH
YDEM_BACSU      MKLDEFT-IGQVFKTKSLKVSKDDIMRFAGEFDPQYMHVDEEKASKGRFNGIIASGIQTLAISFKLWIE-


                         .         .         *         .         .         .         .:140
query           WAKEVKRLKLQGLEPPKLGPSPGFRELKWKKPVFAGDDVTYFVTLLDARPLESRPGIxxxxxxxxxxxxx
YDEM_BACSU      ----------EGFYGDDIIAGTEMNHMTFIKPVYPDDELFTIVEVLDKQPKRNELGI-------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxx
YDEM_BACSU      ---------------