[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for atum0:AAK87989.1

[Show Plain Result]


## Summary of Sequence Search
    1::303
    1::303     e-177 100%  303 aa  HEM6_AGRT5 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    1::303     e-144  82%  303 aa  HEM6_AGRRK RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    1::303     e-143  81%  303 aa  HEM6_RHILW RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    1::303     e-143  81%  303 aa  HEM6_RHIL3 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    1::303     e-142  81%  303 aa  HEM6_RHIE6 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    1::303     e-142  81%  303 aa  HEM6_RHIEC RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    1::303     e-142  80%  303 aa  HEM6_SINMW RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    1::303     e-140  79%  303 aa  HEM6_RHIME RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    1::304     e-133  71%  304 aa  HEM6_OCHA4 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    1::303     e-133  72%  303 aa  HEM6_BRUSU RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    1::303     e-133  72%  303 aa  HEM6_BRUME RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    1::303     e-133  72%  303 aa  HEM6_BRUMB RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    1::303     e-133  72%  303 aa  HEM6_BRUC2 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    1::303     e-133  72%  303 aa  HEM6_BRUAB RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    1::303     e-133  72%  303 aa  HEM6_BRUA2 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    1::303     e-133  72%  303 aa  HEM6_BRUA1 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    1::304     e-131  71%  304 aa  HEM6_MESSB RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    1::304     e-131  77%  304 aa  HEM6_AGRVS RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   27::316     e-106  70%  316 aa  HEM6_BRAJA RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    5::290     e-100  63%  290 aa  HEM6_CAUCR RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    5::290     e-100  63%  290 aa  HEM6_CAUCN RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    6::290     e-100  59%  290 aa  HEM6_CAUSK RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    6::278     1e-80  54%  279 aa  HEM6_RICB8 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    6::278     7e-80  57%  279 aa  HEM6_RICBR RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    4::278     2e-79  54%  279 aa  HEM6_RICFE RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    4::278     3e-78  53%  279 aa  HEM6_RICAH RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    4::278     7e-78  52%  279 aa  HEM6_RICCN RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    4::278     2e-77  52%  279 aa  HEM6_RICRS RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    4::278     2e-77  52%  279 aa  HEM6_RICRO RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    4::278     2e-77  52%  279 aa  HEM6_RICPU RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    4::278     6e-77  52%  279 aa  HEM6_RICAE RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    4::278     2e-76  49%  279 aa  HEM6_RICPR RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    4::278     2e-76  49%  279 aa  HEM6_RICTY RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    2::258     5e-59  51%  289 aa  HEM6_GLOVI RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    6::276     2e-55  46%  303 aa  HEM6_SACD2 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   32::277     5e-54  48%  304 aa  HEM6_THISH RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   19::311     7e-54  46%  342 aa  HEM6_SYNP6 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   28::320     2e-53  48%  362 aa  HEM6_SYNSC RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    4::285     2e-53  46%  317 aa  HEM61_ANASP RecName: Full=Coproporphyrinogen-III oxidase, aerobic
   15::274     3e-53  46%  299 aa  HEM6_ECOSM RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   15::274     3e-53  45%  299 aa  HEM6_SALSV RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   14::274     3e-53  45%  299 aa  HEM6_CITK8 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   60::281     3e-53  50%  307 aa  HEM6_BURCJ RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   60::281     4e-53  50%  307 aa  HEM6_BURS3 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   15::274     6e-53  45%  299 aa  HEM6_SALTY RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   15::274     6e-53  45%  299 aa  HEM6_SALHS RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   15::274     6e-53  45%  299 aa  HEM6_SALEP RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   15::274     8e-53  45%  308 aa  HEM6_SALPK RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   15::274     8e-53  45%  299 aa  HEM6_SALPC RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   15::274     8e-53  45%  299 aa  HEM6_SALPB RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   15::274     8e-53  45%  308 aa  HEM6_SALPA RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   15::274     8e-53  45%  299 aa  HEM6_SALNS RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   15::274     8e-53  45%  299 aa  HEM6_SALG2 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   15::274     8e-53  45%  299 aa  HEM6_SALDC RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   15::274     8e-53  45%  299 aa  HEM6_SALCH RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   15::274     8e-53  45%  299 aa  HEM6_SALA4 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   10::276     8e-53  43%  302 aa  HEM6_PROMH RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   60::281     8e-53  50%  307 aa  HEM6_BURM1 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   15::274     1e-52  45%  299 aa  HEM6_SALTI RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    6::275     1e-52  49%  303 aa  HEM6_PSEPK RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   16::276     1e-52  47%  302 aa  HEM6_ERWT9 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   26::320     1e-52  48%  362 aa  HEM6_SYNS9 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    6::275     1e-52  48%  303 aa  HEM6_PSEPW RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   60::281     1e-52  50%  307 aa  HEM6_BURCC RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    6::275     2e-52  48%  303 aa  HEM6_PSEP1 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   15::274     2e-52  46%  299 aa  HEM6_ECOLU RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   16::308     3e-52  44%  338 aa  HEM6_THEEB RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   19::312     3e-52  46%  340 aa  HEM6_SYNY3 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   15::274     3e-52  45%  299 aa  HEM6_ENT38 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   28::321     4e-52  47%  363 aa  HEM6_SYNPX RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   56::276     5e-52  50%  302 aa  HEM6_SHEON RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    6::275     5e-52  48%  303 aa  HEM6_PSEPG RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    6::275     5e-52  48%  303 aa  HEM6_PSEE4 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    7::276     6e-52  45%  302 aa  HEM6_SHEB2 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    6::274     6e-52  43%  299 aa  HEM6_SALAR RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   56::276     8e-52  51%  304 aa  HEM6_IDILO RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   15::274     8e-52  46%  299 aa  HEM6_ECOL6 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   15::274     8e-52  46%  299 aa  HEM6_ECOL5 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   15::274     8e-52  46%  299 aa  HEM6_ECOK1 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   15::274     8e-52  46%  299 aa  HEM6_ECO81 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   15::274     8e-52  46%  299 aa  HEM6_ECO45 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   15::274     8e-52  46%  299 aa  HEM6_ECO27 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   15::274     1e-51  45%  299 aa  HEM6_SHIDS RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    7::276     1e-51  44%  302 aa  HEM6_SHEB8 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    7::276     1e-51  44%  302 aa  HEM6_SHEB5 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   15::274     1e-51  46%  299 aa  HEM6_ESCF3 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   15::274     1e-51  46%  301 aa  HEM6_ENTS8 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   53::272     1e-51  54%  298 aa  HEM6_DECAR RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   60::281     1e-51  49%  306 aa  HEM6_BURCM RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   60::281     1e-51  49%  306 aa  HEM6_BURA4 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   54::278     1e-51  52%  303 aa  HEM6_BORPA RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   54::278     1e-51  52%  303 aa  HEM6_BORBR RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    7::276     1e-51  45%  302 aa  HEM6_SHESW RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    7::276     1e-51  45%  302 aa  HEM6_SHEPC RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   15::274     1e-51  46%  299 aa  HEM6_ECOLI RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   15::274     1e-51  46%  299 aa  HEM6_ECOLC RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   15::274     1e-51  46%  299 aa  HEM6_ECOHS RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   15::274     1e-51  46%  299 aa  HEM6_ECODH RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   15::274     1e-51  46%  299 aa  HEM6_ECOBW RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   60::281     1e-51  50%  307 aa  HEM6_BURPP RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   15::274     2e-51  45%  299 aa  HEM6_SHIFL RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   15::274     2e-51  45%  299 aa  HEM6_SHIF8 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   55::276     2e-51  50%  304 aa  HEM6_SHEPW RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   15::274     2e-51  45%  299 aa  HEM6_ECO7I RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   54::278     2e-51  52%  303 aa  HEM6_BORPE RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   55::276     2e-51  48%  306 aa  HEM6_SHESH RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    8::276     2e-51  45%  302 aa  HEM6_SHESA RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   15::274     2e-51  45%  299 aa  HEM6_ECO5E RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   15::274     2e-51  45%  299 aa  HEM6_ECO57 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   15::274     4e-51  45%  299 aa  HEM6_SHISS RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   15::274     4e-51  45%  299 aa  HEM6_SHIBS RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   15::274     4e-51  45%  299 aa  HEM6_SHIB3 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   15::274     4e-51  45%  299 aa  HEM6_ECO8A RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   15::274     4e-51  45%  299 aa  HEM6_ECO24 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   62::281     4e-51  48%  307 aa  HEM6_BURXL RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   56::276     5e-51  50%  304 aa  HEM6_SHEHH RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    3::276     5e-51  47%  302 aa  HEM6_CHRVO RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   28::321     5e-51  45%  347 aa  HEM62_ANASP RecName: Full=Coproporphyrinogen-III oxidase, aerobic
    8::276     7e-51  44%  302 aa  HEM6_SHESR RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    8::276     7e-51  44%  302 aa  HEM6_SHESM RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   54::278     7e-51  50%  303 aa  HEM6_BORPD RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   16::276     7e-51  46%  302 aa  HEM6_AERS4 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    7::276     9e-51  44%  306 aa  HEM6_SHEWM RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   56::276     1e-50  49%  304 aa  HEM6_SHEPA RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   12::301     2e-50  44%  328 aa  HEM6_YEAST RecName: Full=Coproporphyrinogen-III oxidase;       
   14::306     3e-50  43%  348 aa  HEM6_PROM1 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   15::274     3e-50  45%  299 aa  HEM6_ECO55 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   15::274     4e-50  45%  299 aa  HEM6_ECOSE RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    1::275     5e-50  45%  306 aa  HEM6_PSEU5 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   16::282     6e-50  45%  308 aa  HEM6_POLSJ RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   53::274     6e-50  50%  299 aa  HEM6_KLEP7 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   19::300     1e-49  43%  342 aa  HEM6_PROM9 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   16::276     1e-49  43%  304 aa  HEM6_SODGM RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   14::306     1e-49  43%  348 aa  HEM6_PROMT RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   16::281     1e-49  45%  307 aa  HEM6_POLNA RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   19::300     2e-49  43%  342 aa  HEM6_PROMS RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   14::301     2e-49  44%  343 aa  HEM6_PROMA RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   62::281     2e-49  50%  307 aa  HEM6_BURPS RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   62::281     2e-49  50%  307 aa  HEM6_BURP6 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   62::281     2e-49  50%  307 aa  HEM6_BURP0 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   62::281     2e-49  50%  307 aa  HEM6_BURMS RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   62::281     2e-49  50%  307 aa  HEM6_BURMA RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   62::281     2e-49  50%  307 aa  HEM6_BURM9 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   62::281     2e-49  50%  307 aa  HEM6_BURM7 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   59::279     2e-49  51%  305 aa  HEM6_VARPS RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   54::274     2e-49  50%  299 aa  HEM6_KLEP3 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    3::279     2e-49  48%  310 aa  HEM6_COXBU RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   56::276     3e-49  49%  304 aa  HEM6_SHEAM RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   19::300     3e-49  43%  342 aa  HEM6_PROM0 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   62::282     3e-49  49%  308 aa  HEM6_FRATF RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    3::279     3e-49  48%  310 aa  HEM6_COXBR RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    3::279     3e-49  48%  310 aa  HEM6_COXBN RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   54::274     4e-49  47%  310 aa  HEM6_ERWCT RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   15::276     5e-49  46%  309 aa  HEM6_YERP3 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   55::276     5e-49  48%  305 aa  HEM6_SHEDO RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    3::272     7e-49  41%  301 aa  HEM6_NITEC RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    9::276     9e-49  41%  302 aa  HEM6_PHOLL RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   52::272     9e-49  47%  301 aa  HEM6_NITEU RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   56::276     1e-48  49%  306 aa  HEM6_SERP5 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    6::275     1e-48  42%  304 aa  HEM6_PSEPF RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   33::300     1e-48  42%  342 aa  HEM6_PROM2 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   62::282     1e-48  48%  308 aa  HEM6_FRATT RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   62::282     1e-48  48%  308 aa  HEM6_FRAT1 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   56::276     2e-48  49%  309 aa  HEM6_YERPY RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   56::276     2e-48  49%  309 aa  HEM6_YERPS RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   56::276     2e-48  49%  309 aa  HEM6_YERPP RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   56::276     2e-48  49%  309 aa  HEM6_YERPN RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   56::276     2e-48  49%  309 aa  HEM6_YERPG RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   56::276     2e-48  49%  309 aa  HEM6_YERPE RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   56::276     2e-48  49%  309 aa  HEM6_YERPB RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   56::276     2e-48  49%  309 aa  HEM6_YERPA RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   60::280     2e-48  48%  305 aa  HEM6_VIBSL RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    2::281     2e-48  43%  305 aa  HEM6_VIBCH RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    2::281     2e-48  43%  305 aa  HEM6_VIBC3 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    3::275     2e-48  46%  305 aa  HEM6_PSEAE RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    3::275     2e-48  46%  305 aa  HEM6_PSEAB RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    6::275     2e-48  44%  304 aa  HEM6_PSE14 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   20::300     2e-48  43%  342 aa  HEM6_PROMP RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   62::282     2e-48  48%  308 aa  HEM6_FRATM RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
  131::360     2e-48  47%  386 aa  HEM6_ARATH RecName: Full=Coproporphyrinogen-III oxidase,
   55::274     3e-48  46%  310 aa  HEM6_PECCP RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   62::282     3e-48  48%  308 aa  HEM6_FRATW RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   62::282     3e-48  48%  308 aa  HEM6_FRATH RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    8::273     3e-48  45%  298 aa  HEM6_STRM5 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    3::275     3e-48  46%  305 aa  HEM6_PSEA7 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   52::272     3e-48  50%  302 aa  HEM6_METFK RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    3::275     4e-48  46%  305 aa  HEM6_PSEA8 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    5::276     4e-48  44%  301 aa  HEM6_PHOPR RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    6::275     6e-48  43%  304 aa  HEM6_PSEU2 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   16::276     6e-48  49%  304 aa  HEM6_METCA RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
  137::364     6e-48  49%  390 aa  HEM6_DROME RecName: Full=Coproporphyrinogen-III oxidase;       
   56::276     7e-48  49%  302 aa  HEM6_AERHH RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    8::273     1e-47  45%  298 aa  HEM6_STRMK RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    6::275     1e-47  43%  304 aa  HEM6_PSESM RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   62::282     1e-47  48%  308 aa  HEM6_FRATO RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   16::276     1e-47  44%  307 aa  HEM6_CHRSD RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   33::281     1e-47  45%  305 aa  HEM6_VIBCM RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   27::307     1e-47  43%  349 aa  HEM6_PROMM RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   62::282     1e-47  48%  308 aa  HEM6_FRATN RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   54::275     2e-47  46%  303 aa  HEM6_WIGBR RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    6::275     2e-47  46%  305 aa  HEM6_PSEF5 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   14::273     3e-47  46%  299 aa  HEM6_XANOR RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   14::273     3e-47  46%  299 aa  HEM6_XANOP RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   14::273     3e-47  46%  299 aa  HEM6_XANOM RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   14::273     3e-47  46%  299 aa  HEM6_XANC5 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    7::276     6e-47  44%  308 aa  HEM6_YERE8 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   14::273     6e-47  46%  299 aa  HEM6_XANAC RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   62::282     6e-47  48%  308 aa  HEM6_FRAP2 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   16::280     8e-47  44%  305 aa  HEM6_VIBVU RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   83::371     8e-47  42%  399 aa  HEM6_ORYSJ RecName: Full=Coproporphyrinogen-III oxidase,
   20::300     1e-46  43%  342 aa  HEM6_PROM5 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   16::280     1e-46  44%  305 aa  HEM6_VIBVY RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   60::280     1e-46  48%  305 aa  HEM6_VIBHB RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   55::275     1e-46  46%  304 aa  HEM6_PSEMY RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   16::282     1e-46  42%  311 aa  HEM6_LEGPH RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   16::282     1e-46  42%  311 aa  HEM6_LEGPC RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   56::276     1e-46  47%  302 aa  HEM6_ALCBS RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   16::282     2e-46  42%  309 aa  HEM6_LEGPL RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   13::276     3e-46  42%  302 aa  HEM6_RALPJ RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   15::280     4e-46  49%  305 aa  HEM6_VIBPA RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   54::273     5e-46  50%  299 aa  HEM6_XANCB RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   15::275     7e-46  45%  301 aa  HEM6_LEIMA RecName: Full=Coproporphyrinogen-III oxidase;       
   62::282     9e-46  47%  311 aa  HEM6_LEGPA RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
  130::359     2e-45  44%  385 aa  HEM6_SOYBN RecName: Full=Coproporphyrinogen-III oxidase,
   54::273     2e-45  49%  299 aa  HEM6_XANCP RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   54::273     2e-45  49%  299 aa  HEM6_XANC8 RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
  141::371     6e-45  45%  397 aa  HEM6_TOBAC RecName: Full=Coproporphyrinogen-III oxidase,
   20::287     6e-45  41%  312 aa  HEM6_SCHPO RecName: Full=Probable coproporphyrinogen-III oxidase;  
    9::275     6e-45  41%  310 aa  HEM6_PSEFS RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   13::276     8e-45  43%  302 aa  HEM6_RALSO RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   79::365     1e-43  39%  391 aa  HEM6_HORVU RecName: Full=Coproporphyrinogen-III oxidase,
   11::286     6e-42  42%  311 aa  HEM6_AZOSE RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
  187::416     2e-41  46%  443 aa  HEM6_MOUSE RecName: Full=Coproporphyrinogen-III oxidase,
  187::416     7e-41  45%  443 aa  HEM6_RAT RecName: Full=Coproporphyrinogen-III oxidase,
  199::427     1e-40  44%  454 aa  HEM6_HUMAN RecName: Full=Coproporphyrinogen-III oxidase,
   83::299     2e-40  43%  332 aa  HEM6_DICDI RecName: Full=Coproporphyrinogen-III oxidase;       
   54::273     2e-38  45%  305 aa  HEM6_XYLFA RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   54::273     3e-38  45%  305 aa  HEM6_XYLFM RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
   54::273     2e-37  45%  305 aa  HEM6_XYLFT RecName: Full=Coproporphyrinogen-III oxidase, aerobic;  
    1::303

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MERPILPKGLPEDIEDKKAVAQAWFQHLRDTIVASFETLEDELTGPLSDQEPGRFVQKDWLRDNXXXXXX
HEM6_AGRT5      MERPILPKGLPEDIEDKKAVAQAWFQHLRDTIVASFETLEDELTGPLSDQEPGRFVQKDWLRDNXXXXXX
HEM6_AGRRK      MERPNLPKELPEDIEDKKEAAQGWFQSLRDALCAEFEQLEDELAGPLSDQTPGRFVAKDWQXXXXXXXXX
HEM6_RHILW      MERPELPIGLPEDIEEKKAAARSWFEGLRDTICASFEALEDELEGPLSDQEPGRFVAKDWXXXXXXXXXX
HEM6_RHIL3      MERPELPIGLPDDIEEKKAAARNWFEGLRDTICASFEAIEDDLEGPLSDQEPGRFVAKDWXXXXXXXXXX
HEM6_RHIE6      MERPELPIGLPDDIEEKKEAARKWFEGLRDTICASFEALEDGLEGPLSDQEPGRFVAKDWXXXXXXXXXX
HEM6_RHIEC      MERPELPIGLPEDIEEKKTAARNWFEGLRDTICASFEALEDELQGPLSDQEPGRFVAKDWXXXXXXXXXX
HEM6_SINMW      MERPQLPQGLPADIERKKAEAKAWFESLRDTICADFEAIEDDLAGPLSDRPAGRFVAKDWLRDXXXXXXX
HEM6_RHIME      MERPQLPQGLPADIEDXXXXXXXWFESLRDTICAAFEAIEDELTGPLSDRPAGRFVAKDWLXXXXXXXXX
HEM6_OCHA4      MQRDEIPAIIPTDIEEKKQAAQRWFEELRDRICASYEQLEDELQGPLSDREPGRFVRTPWQKDEGRGGGG
HEM6_BRUSU      MKREDIPAIIPADIEEKKKAAQSWFEELRDRICASYEQLEDELQGPLSDREPGRFVRTPWQKDDGNGGGV
HEM6_BRUME      MKREDIPAIIPADIEEKKKAAQSWFEELRDRICASYEQLEDELQGPLSDREPGRFVRTPWQKDDGNGGGV
HEM6_BRUMB      MKREDIPAIIPADIEEKKKAAQSWFEELRDRICASYEQLEDELQGPLSDREPGRFVRTPWQKDDGNGGGV
HEM6_BRUC2      MKREDIPAIIPADIEEKKKAAQSWFEELRDRICASYEQLEDELQGPLSDREPGRFVRTPWQKDDGNGGGV
HEM6_BRUAB      MKREDIPAIIPADIEEKKKAAQSWFEELRDRICASYEQLEDELQGPLSDREPGRFVRTPWQKDDGNGGGV
HEM6_BRUA2      MKREDIPAIIPADIEEKKKAAQSWFEELRDRICASYEQLEDELQGPLSDREPGRFVRTPWQKDDGNGGGV
HEM6_BRUA1      MKREDIPAIIPADIEEKKKAAQSWFEELRDRICASYEQLEDELQGPLSDREPGRFVRTPWQKDDGNGGGV
HEM6_MESSB      MEQPHIPAGLPEDVENKKEAARAWFETLRDKICAALEGLEDELSGPHSSYAPGRFEQTPWLRQEGAGGGG
HEM6_AGRVS      MQRPILPKGLPDDIEVKKATARAWFESLRDQICRSFEALEDELTGPLSDRAPGRFTPKDWQXXXXXXXXX
HEM6_BRAJA      -------------IEDRKTRARAWFEALRDDICASFERLEDDAPQGLYPGEAGRFTRTPWQRTDHXXXXX
HEM6_CAUCR      -----------QDLDTKKAAARAWFESLRDQICAAFEQLEDEAPADLYPGAPGRFAKKAW--DRPAXXXX
HEM6_CAUCN      -----------QDLDTKKAAARAWFESLRDQICAAFEQLEDEAPADLYPGAPGRFAKKAW--DRPAXXXX
HEM6_CAUSK      ------------DLDGKKATARAWFESLRDQICAEFERLEDEAPTDLYAGEPGRFVRKPW--DREAGGGG
HEM6_RICB8      -----------------REVTSSWFTNLRDLVCAEFEKIEEEYA-KAKGLKPGKFVRSSWERDXXXXXVM
HEM6_RICBR      -----------------REVTSSWFTNLRDLVCAEFEKIEEEYA-KAKGLKPGKFVRSSWERDXXXXXXX
HEM6_RICFE      ---------------ENKEIASNWFTDLRDLLCKEFEKIEEEYA-QTKGLKPAKFVRTSWQRNXXXXXIM
HEM6_RICAH      ---------------ENKEITSNWFTNLRDLLCKEFEKIEEEYA-QTKCLKPAKFVRTSWQRNXXXXXIM
HEM6_RICCN      ---------------ENKEITSSWFTNLRDLLCKEFEKIEEEYA-QTKGLKPAKFVRSSWQRNXXXXXVM
HEM6_RICRS      ---------------ENKEITSSWFTNLRDLLCKEFEKIEEEYA-QTKGLKPAKFVRSSWQRNXXXXXVM
HEM6_RICRO      ---------------ENKEITSSWFTNLRDLLCKEFEKIEEEYA-QTKGLKPAKFVRSSWQRNXXXXXVM
HEM6_RICPU      ---------------ENKEITSSWFTNLRDLLCKEFEKIEEEYA-QTKGLKPAKFVRSSWQRNXXXXXVM
HEM6_RICAE      ---------------ENKEITSSWFTNLRDLLCKEFEKIEEEYA-QTKGLKPAKFVRSSWQRNXXXXXVM
HEM6_RICPR      ---------------ENKEITSNWFTNLRDLLCKEFEKIEEKYA-QIKGLKPAKFVRTSWKRNGGGCGIM
HEM6_RICTY      ---------------ENKEITSNWFTNLRDLLCKEFEKIEEKYA-QIKGLKPAKFVRTSWKRNGGGCGIM
HEM6_GLOVI      -------------------------QSLQDNITSRLEAVDGE----------GRFVEDLWXXXXXXXXXX
HEM6_SACD2      -----------------KQAVKAYLLNLQDKICQVLAAVDGKET----------FVEDSWQRPEGGGGRS
HEM6_THISH      ----------------------------------------------------GEFKEDSWTREEGGGGRS
HEM6_SYNP6      ----------------------------RERVKQFMQTLQDEICAGLEALDGGQFREDSWERPEGGGGRS
HEM6_SYNSC      ---------------DSRERARAMVMGLQDQICAGLEALDGE----------GRFVEESWVR-HEGGGGR
HEM61_ANASP     --------------------------------------LQDEITQALTKLDGGSEFHEDSWERPEGGGGR
HEM6_ECOSM      --------------------------------------LQDTICQQLSAVDGAEFVEDSWLREAGGGGRS
HEM6_SALSV      --------------------------------------LQDDICQKLSAADGANFVEDSWRREAGGGGRS
HEM6_CITK8      -------------------------------------SLQDDICQQLAAVDGADFVEDSWQRDAGGGGRS
HEM6_BURCJ      ----------------------------------------------------------------------
HEM6_BURS3      ----------------------------------------------------------------------
HEM6_SALTY      --------------------------------------LQDDICQTLSAVDGANFVEDSWRREAGGGGRS
HEM6_SALHS      --------------------------------------LQDDICQTLSAVDGANFVEDSWRREAGGGGRS
HEM6_SALEP      --------------------------------------LQDDICQKLSAVDGANFVEDSWRREAGGGGRS
HEM6_SALPK      --------------------------------------LQDDICQTLSAVDGANFVEDSWRREAGGGGRS
HEM6_SALPC      --------------------------------------LQDDICQKLSAVDGANFVEDSWRREAGGGGRS
HEM6_SALPB      --------------------------------------LQDDICQTLSAVDGANFVEDSWRREAGGGGRS
HEM6_SALPA      --------------------------------------LQDDICQTLSAVDGANFVEDSWRREAGGGGRS
HEM6_SALNS      --------------------------------------LQDDICQTLSAVDGANFVEDSWRREAGGGGRS
HEM6_SALG2      --------------------------------------LQDDICQKLSAVDGANFVEDSWRREAGGGGRS
HEM6_SALDC      --------------------------------------LQDDICQKLSAVDGANFVEDSWRREAGGGGRS
HEM6_SALCH      --------------------------------------LQDDICQKLSAVDGANFVEDSWRREAGGGGRS
HEM6_SALA4      --------------------------------------LQDDICQTLSAVDGANFVEDSWRREAGGGGRS
HEM6_PROMH      ---------------------QSFFLSLQDSICHAIENIDQKAT----------FQQDNWQRE-AGGGGR
HEM6_BURM1      ----------------------------------------------------------------------
HEM6_SALTI      --------------------------------------LQDDICQTLSAVDGANFIEDSWRREAGGGGRS
HEM6_PSEPK      -----------------------------EAVKAYLLDLQDRICSALETEDGGRFVEDAWVRE-AXXXXX
HEM6_ERWT9      --------------------------------------LQDEICQKLEQADAARFAEDSWQRPGGGGGRS
HEM6_SYNS9      ----------PTDSRDR---ARSMVMGLQDEICAGLEALDGE----------GRFQEESWVRPEGGGGRS
HEM6_PSEPW      -----------------------------EAVKAYLLDLQDRICSALETEDGGRFVEDAWVRE-AXXXXX
HEM6_BURCC      ----------------------------------------------------------------------
HEM6_PSEP1      -----------------------------EAVKAYLLDLQDRICSALETEDGGRFVEDAWVRE-AXXXXX
HEM6_ECOLU      --------------------------------------LQDTICQQLSAVDGAEFVEDSWQREAGGGGRS
HEM6_THEEB      ----------------------------RQRVATFLKDLQDQICQGLEAADGGAQFQEDTWQRPEGGGGR
HEM6_SYNY3      ---------------DAKQRVSQFMQTLQDEICQGLEALDGK----------GKFQEDSWQREEGGGGRS
HEM6_ENT38      --------------------------------------LQDDICQKLSAVDGGEFHEDSWQREAGGGGRS
HEM6_SYNPX      --------------EDSRARARAMVMGLQDEICAGLESLDGE----------GTFVEESWERPEGGGGRS
HEM6_SHEON      ----------------------------------------------------------------------
HEM6_PSEPG      -----------------------------EAVKAYLLDLQDRICSALETEDGGRFVEDAWVRE-AXXXXX
HEM6_PSEE4      -----------------------------EAVKAYLLDLQDRICSALETEDGGRFVEDAWVRD-AXXXXX
HEM6_SHEB2      ------------------AVVKAFLLDLQNRICAGLQALDGQ----------ARFAADSWTRAEGGGGTS
HEM6_SALAR      -------------------------QHVKQFLLR----LQDDICQTLSAVDGANFIEDSWRREAGGGGRS
HEM6_IDILO      ----------------------------------------------------------------------
HEM6_ECOL6      --------------------------------------LQDTICQQLSAVDGAEFVEDSWQREAGGGGRS
HEM6_ECOL5      --------------------------------------LQDTICQQLSAVDGAEFVEDSWQREAGGGGRS
HEM6_ECOK1      --------------------------------------LQDTICQQLSAVDGAEFVEDSWQREAGGGGRS
HEM6_ECO81      --------------------------------------LQDTICQQLSAVDGAEFVEDSWQREAGGGGRS
HEM6_ECO45      --------------------------------------LQDTICQQLSAVDGAEFVEDSWQREAGGGGRS
HEM6_ECO27      --------------------------------------LQDTICQQLSAVDGAEFVEDSWQREAGGGGRS
HEM6_SHIDS      --------------------------------------LQDTICQQLTAVDGAEFVEDSWQRESGGGGRS
HEM6_SHEB8      ------------------AVVKAFLLDLQNRICAGLQALDGQ----------ARFAADSWTRAEGGGGTS
HEM6_SHEB5      ------------------AVVKAFLLDLQNRICAGLQALDGQ----------ARFAADSWTRAEGGGGTS
HEM6_ESCF3      --------------------------------------LQDTICQQLTAVDGAEFVEDSWQREAGGGGRS
HEM6_ENTS8      --------------------------------------LQDRICQQLSAVDGDDFVEDAWQREGGGGGRS
HEM6_DECAR      ----------------------------------------------------------------------
HEM6_BURCM      ----------------------------------------------------------------------
HEM6_BURA4      ----------------------------------------------------------------------
HEM6_BORPA      ----------------------------------------------------------------------
HEM6_BORBR      ----------------------------------------------------------------------
HEM6_SHESW      ------------------AVVKAFLIDLQNRICAGLQALDGQAT----------FAADSWTRAEGGGGTS
HEM6_SHEPC      ------------------AVVKAFLIDLQNRICAGLQALDGQAT----------FAADSWTRAEGGGGTS
HEM6_ECOLI      --------------------------------------LQDTICQQLTAVDGAEFVEDSWQREAGGGGRS
HEM6_ECOLC      --------------------------------------LQDTICQQLTAVDGAEFVEDSWQREAGGGGRS
HEM6_ECOHS      --------------------------------------LQDTICQQLTAVDGAEFVEDSWQREAGGGGRS
HEM6_ECODH      --------------------------------------LQDTICQQLTAVDGAEFVEDSWQREAGGGGRS
HEM6_ECOBW      --------------------------------------LQDTICQQLTAVDGAEFVEDSWQREAGGGGRS
HEM6_BURPP      ----------------------------------------------------------------------
HEM6_SHIFL      --------------------------------------LQDTICQQLTAVDGAEFVEDSWQREAGGGGRS
HEM6_SHIF8      --------------------------------------LQDTICQQLTAVDGAEFVEDSWQREAGGGGRS
HEM6_SHEPW      ----------------------------------------------------------------------
HEM6_ECO7I      --------------------------------------LQDTICQQLTAVDGAEFVEDSWQREAGGGGRS
HEM6_BORPE      ----------------------------------------------------------------------
HEM6_SHESH      ----------------------------------------------------------------------
HEM6_SHESA      -------------------VVKAFLLDLQNRICAGLEQLDGQAS----------FAADSWTRTEGGGGTS
HEM6_ECO5E      --------------------------------------LQDTICQQLTAVDGAEFVEDSWQREGGGGGRS
HEM6_ECO57      --------------------------------------LQDTICQQLTAVDGAEFVEDSWQREGGGGGRS
HEM6_SHISS      --------------------------------------LQDTICQQLTAVDGAEFVEDSWQREAGGGGRS
HEM6_SHIBS      --------------------------------------LQDTICQQLTAVDGAEFVEDSWQREAGGGGRS
HEM6_SHIB3      --------------------------------------LQDTICQQLTAVDGAEFVEDSWQREAGGGGRS
HEM6_ECO8A      --------------------------------------LQDTICQQLTAVDGAEFVEDSWQREAGGGGRS
HEM6_ECO24      --------------------------------------LQDTICQQLTAVDGAEFVEDSWQREAGGGGRS
HEM6_BURXL      ----------------------------------------------------------------------
HEM6_SHEHH      ----------------------------------------------------------------------
HEM6_CHRVO      --------------------------HPHSNAVKSFLLLQDRICAALEQADKAQFAEDAWSRE-AXXXXX
HEM62_ANASP     --------------KDSRQRSQQFMQNLQDEICTALEQLDGKAS----------FHQDHWERAEGGEGRT
HEM6_SHESR      -------------------VVKAFLLDLQNRICAGLEQLDGQAS----------FAADSWTRTEGGGGTS
HEM6_SHESM      -------------------VVKAFLLDLQNRICAGLEQLDGQAS----------FAADSWTRTEGGGGTS
HEM6_BORPD      ----------------------------------------------------------------------
HEM6_AERS4      --------------------------------------LQDEICRSLEQADGGRFVEDAWAREGGGGGRT
HEM6_SHEWM      ------------------SVVKAFLLDLQQRICDGLEQLDGE----------AKFKADSWKREEGGGGTS
HEM6_SHEPA      ----------------------------------------------------------------------
HEM6_YEAST      ---------------------------IRQQMEALIRRKQAEITQGLESIDTVKFHADTWTRGNDGGGGT
HEM6_PROM1      ---------------NSRARAKKLVLELQDEICAGLETIDGE----------GKFLEESWERPEGGGGRS
HEM6_ECO55      --------------------------------------LQDTICQQLTAVDGAEFVEDSWQREAGGGGRS
HEM6_ECOSE      --------------------------------------LQDTICQQLTAVDGAEFVEDSWQREGGGGGRS
HEM6_PSEU5      -------------MNDRTEAVKAYLLDLQDRICAALEV----------EDGGARFVEDAWTRPXXXXXRT
HEM6_POLSJ      --------------------------------------LQERVTAAVAEVDGGDFITDAWQKEPGEPLQG
HEM6_KLEP7      ----------------------------------------------------------------------
HEM6_PROM9      -------------------------------------TLQDKICSGLENIDKGKFTEESWLRDEGGGGRS
HEM6_SODGM      --------------------------------------LQETICAALTAADGGAVFHEDWQRDEGGGGRT
HEM6_PROMT      ---------------NSRARAKKLVLELQDEICAGLETIDGE----------GKFLEESWERPEGGGGRS
HEM6_POLNA      --------------------------------------LQERITHAIAEVDGQPFMTDHWQKETLQGNGI
HEM6_PROMS      -------------------------------------TLQDKICSGLENVDKGKFTEESWLRDEGGGGRS
HEM6_PROMA      --------------------------------VKSFLTLQDDICKGLENIDEGTFQEESWERPEGGGGRS
HEM6_BURPS      ----------------------------------------------------------------------
HEM6_BURP6      ----------------------------------------------------------------------
HEM6_BURP0      ----------------------------------------------------------------------
HEM6_BURMS      ----------------------------------------------------------------------
HEM6_BURMA      ----------------------------------------------------------------------
HEM6_BURM9      ----------------------------------------------------------------------
HEM6_BURM7      ----------------------------------------------------------------------
HEM6_VARPS      ----------------------------------------------------------------------
HEM6_KLEP3      ----------------------------------------------------------------------
HEM6_COXBU      -----------KDRQNKITEVGIYLKDLQNRLCRAFEKEEGE----------SRFQETLWEKPNXXXXXX
HEM6_SHEAM      ----------------------------------------------------------------------
HEM6_PROM0      -------------------------------------TLQDKICSGLENVDKGKFTEESWLRDEGGGGRS
HEM6_FRATF      ----------------------------------------------------------------------
HEM6_COXBR      -----------KDRQNKITEVGIYLKGLQNRLCRAFEKEEGE----------SRFQETLWEKPNXXXXXX
HEM6_COXBN      -----------KDRQNKITEVGIYLKDLQNRLCRAFEKEEGE----------SRFQETLWEKPNXXXXXX
HEM6_ERWCT      ----------------------------------------------------------------------
HEM6_YERP3      -------------------------------------TLQDNICGALAQADGAEFTEECWVXXXXXXXXS
HEM6_SHEDO      ----------------------------------------------------------------------
HEM6_NITEC      ------------------------FAQVKDYLV----NLQNNIVAGLEQADGGSFRRDSWDRPEGGGGTS
HEM6_PHOLL      -------------------------------IKSFFLSLQDEICQQLEQIDKEKFTEQCWQREEGGGGRS
HEM6_NITEU      ----------------------------------------------------------------------
HEM6_SERP5      ----------------------------------------------------------------------
HEM6_PSEPF      -----------------------------DAVKAYLLDLQDRICAALETEDGGRFVEDAWTRP-AGGGGR
HEM6_PROM2      --------------------------------------------------EKGKFIEESWIRDEGGGGRS
HEM6_FRATT      ----------------------------------------------------------------------
HEM6_FRAT1      ----------------------------------------------------------------------
HEM6_YERPY      ----------------------------------------------------------------------
HEM6_YERPS      ----------------------------------------------------------------------
HEM6_YERPP      ----------------------------------------------------------------------
HEM6_YERPN      ----------------------------------------------------------------------
HEM6_YERPG      ----------------------------------------------------------------------
HEM6_YERPE      ----------------------------------------------------------------------
HEM6_YERPB      ----------------------------------------------------------------------
HEM6_YERPA      ----------------------------------------------------------------------
HEM6_VIBSL      ----------------------------------------------------------------------
HEM6_VIBCH      -----------ESIVDKQAVKHFLLQ-LQDKICQQLEATDGQ----------AQFIEDAWQREPGEKLGG
HEM6_VIBC3      -----------ESIVDKQAVKHFLLQ-LQDKICQQLEATDGQ----------AQFIEDAWQREPGEKLGG
HEM6_PSEAE      ---------------DRIAAVKTYLLDLQDRICAALE----------AEDGKARFAEDAWERP-AXXXXX
HEM6_PSEAB      ---------------DRIAAVKTYLLDLQDRICAALE----------AEDGKARFAEDAWERP-AXXXXX
HEM6_PSE14      -----------------------------EAVKAYLLDLQDRICTAL-EQEDGNFVEDAWTRP-AGGGGR
HEM6_PROMP      ---------------------------LQDNICKGLENIDGK----------AKFTEESWLREEGGGGKS
HEM6_FRATM      ----------------------------------------------------------------------
HEM6_ARATH      ----------------------------------------------------------------------
HEM6_PECCP      ----------------------------------------------------------------------
HEM6_FRATW      ----------------------------------------------------------------------
HEM6_FRATH      ----------------------------------------------------------------------
HEM6_STRM5      ---------------------RAYLTDLQDRICAAIEAADGQ----------ARFQEDLWQRAEGGGGRT
HEM6_PSEA7      ---------------DRIAAVKTYLLDLQDRICAALE----------AEDGKARFAEDAWERP-AXXXXX
HEM6_METFK      ----------------------------------------------------------------------
HEM6_PSEA8      ---------------DHIAAVKTYLLDLQDRICAALE----------AEDGKARFAEDAWERP-AXXXXX
HEM6_PHOPR      ---------------DKHAV-KAFLLSLQDQICQSLE----------SQDKSAAFEQDEWQREQGGGGRS
HEM6_PSEU2      -----------------------------EAVKAYLLDLQDRICTAL-EQEDGHFMEDAWTRP-AGGGGR
HEM6_METCA      --------------------------------------LQESICNALETEEPARFVEDRW-EHAAXXXXX
HEM6_DROME      ----------------------------------------------------------------------
HEM6_AERHH      ----------------------------------------------------------------------
HEM6_STRMK      ---------------------RAYLTDLQDRICAAIEAVDGR----------ARFQEDLWQRAEGGGGRT
HEM6_PSESM      -----------------------------EAVKAYLLDLQDRICTAL-EQEDGNFVEDAWTRP-AGGGGR
HEM6_FRATO      ----------------------------------------------------------------------
HEM6_CHRSD      --------------------------------------LQDRLCDGLAAEEGDTAFREDWTRE-AGGGGR
HEM6_VIBCM      -----------------------------------------------------QFIEDAWQREPGEKLGG
HEM6_PROMM      --------------------------------------LQDEICNELESLDGGQSFRTDSWERPEGGGGR
HEM6_FRATN      ----------------------------------------------------------------------
HEM6_WIGBR      ----------------------------------------------------------------------
HEM6_PSEF5      -----------------------------EAVKAYLLDLQDRICAALETEDGGRFIEDAWTRP-AXXXXX
HEM6_XANOR      ---------------------------LQDRICAAVEAADGK----------ARFAEDLWKREEGGGGRT
HEM6_XANOP      ---------------------------LQDRICAAVEAADGK----------ARFAEDLWKREEGGGGRT
HEM6_XANOM      ---------------------------LQDRICAAVEAADGK----------ARFAEDLWKREEGGGGRT
HEM6_XANC5      ---------------------------LQDRICAAVEAADGK----------ARFAEDLWKREEGGGGRT
HEM6_YERE8      -----------------------------DQIKTYLLDLQDKICAALAQADSAKFTEENWVXXXXXXXXS
HEM6_XANAC      ---------------------------LQDRICAAVEAADGK----------ARFAEDLWKREEGGGGRT
HEM6_FRAP2      ----------------------------------------------------------------------
HEM6_VIBVU      --------------------------------------LQDQICQRL-EQEDGKFIEDAWYRDRLGGGGR
HEM6_ORYSJ      ---------------------------VRERFEAMIRRVQGEVCAALADGSGARFVEDVWSRPGGGGGIS
HEM6_PROM5      ---------------------------LQDNICKNLENIDGK----------AKFTEESWLREEGGGGRS
HEM6_VIBVY      --------------------------------------LQDQICQRL-EQEDGKFIEDAWHRDRLGGGGR
HEM6_VIBHB      ----------------------------------------------------------------------
HEM6_PSEMY      ----------------------------------------------------------------------
HEM6_LEGPH      ---------------------KSYLLQLQNTICVSLESIDGKT----------RFHEDSWQRA-AGGGGK
HEM6_LEGPC      ---------------------KSYLLQLQNTICVSLESIDGKT----------RFHEDSWQRA-AGGGGK
HEM6_ALCBS      ----------------------------------------------------------------------
HEM6_LEGPL      ---------------------KSYLLQLQNTICVSLESIDGQT----------KFHEDSWQRA-AGGGGK
HEM6_RALPJ      --------------------------------------LQDRITTAASALDGGTFVTDAWEKERLRGSGR
HEM6_VIBPA      -------------------------------------SLQDSICQQL-EQEDGKFVEDAWHREXXXXXXX
HEM6_XANCB      ----------------------------------------------------------------------
HEM6_LEIMA      --------------------------------------LQDDICEALEAEDQATFVEDKWTREXXXXXRT
HEM6_LEGPA      ----------------------------------------------------------------------
HEM6_SOYBN      ----------------------------------------------------------------------
HEM6_XANCP      ----------------------------------------------------------------------
HEM6_XANC8      ----------------------------------------------------------------------
HEM6_TOBAC      ----------------------------------------------------------------------
HEM6_SCHPO      --------------------------------------VQQEIVAGLEAVDGQKFFQDKWTKGEGGYGIS
HEM6_PSEFS      ---------------------KAYLLDLQDRICSALETFETDT----------RFIEDAWTRP-AGGGGR
HEM6_RALSO      --------------------------------------LQDRITTAVGTLDGGTFVTDTWDKERLRGSGR
HEM6_HORVU      ---------------------------VRERFEGMIRRVQGEICAALEEADGSRFVEDVWSRPGGVCVHS
HEM6_AZOSE      -------------------------QHLLD--------LQSGIVAVLERFDGGRFREDAWQRP-AGGGGI
HEM6_MOUSE      ----------------------------------------------------------------------
HEM6_RAT        ----------------------------------------------------------------------
HEM6_HUMAN      ----------------------------------------------------------------------
HEM6_DICDI      ----------------------------------------------------------------------
HEM6_XYLFA      ----------------------------------------------------------------------
HEM6_XYLFM      ----------------------------------------------------------------------
HEM6_XYLFT      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           XXXXXXXRVFEKVGVHTSTVYGEFSPEFRKQIPGAEEDPRFWASGLSLIAHPVNPNVPAVHMNTRMVVTT
HEM6_AGRT5      XXXXXXXRVFEKVGVHTSTVYGEFSPEFRKQIPGAEEDPRFWASGLSLIAHPVNPNVPAVHMNTRMVVTT
HEM6_AGRRK      XXXXXXXXVFEKVGIHTSTVYGEFSPDFRSQIPGAEEDPRFWASGLSLIAHPVNPNVPTVHMNTRMVVTT
HEM6_RHILW      XXXXXXXXVFEKVGVHTSTVHGEFSPDFRAQIPGAKDDPRFWASGISLIAHPVNPNVPAVHMNTRMVVTS
HEM6_RHIL3      XXXXXXXXVFEKVGVHTSTVYGEFAPDFRAQIPGAKDDPRFWASGISLIAHPVNPNVPAVHMNTRMVVTT
HEM6_RHIE6      XXXXXXXXVFEKVGVHTSTVYGEFSPEFRAQIPGAKDDPRFWASGISLIAHPVNPNVPAVHMNTRMVVTT
HEM6_RHIEC      XXXXXXXXVFEKVGVHTSTVHGEFSPDFSAQIPGAKEDPRFWASGISLIAHPVNPNVPAVHMNTRMVVTS
HEM6_SINMW      XXXXXXXXVFEKVGVHTSTVFGEFSPEFRDQIPGASEDPRFWASGISLIAHPVNPNVPAVHMNTRMVVTT
HEM6_RHIME      XXXXXXXXVFEKVGVHTSTVFGEFSPEFREQIPGASEDPRFWASGISLIAHPVNPNVPAVHMNTRMVVTT
HEM6_OCHA4      VMSIMHGRVFEKVGVHVSTVYGEFSPEFRKQIPGAEEDPRYWASGISLIAHPQNPNVPAVHMNTRMVVTT
HEM6_BRUSU      MSIMHG-RVFEKVGVHVSTVHGEFSPEFRKQIPGAEEDPRYWASGISLIAHPQNPNVPAVHMNTRMIVTT
HEM6_BRUME      MSIMHG-RVFEKVGVHVSTVHGEFSPEFRKQIPGAEEDPRYWASGISLIAHPQNPNVPAVHMNTRMIVTT
HEM6_BRUMB      MSIMHG-RVFEKVGVHVSTVHGEFSPEFRKQIPGAEEDPRYWASGISLIAHPQNPNVPAVHMNTRMIVTT
HEM6_BRUC2      MSIMHG-RVFEKVGVHVSTVHGEFSPEFRKQIPGAEEDPRYWASGISLIAHPQNPNVPAVHMNTRMIVTT
HEM6_BRUAB      MSIMHG-RVFEKVGVHVSTVHGEFSPEFRKQIPGAEEDPRYWASGISLIAHPQNPNVPAVHMNTRMIVTT
HEM6_BRUA2      MSIMHG-RVFEKVGVHVSTVHGEFSPEFRKQIPGAEEDPRYWASGISLIAHPQNPNVPAVHMNTRMIVTT
HEM6_BRUA1      MSIMHG-RVFEKVGVHVSTVHGEFSPEFRKQIPGAEEDPRYWASGISLIAHPQNPNVPAVHMNTRMIVTT
HEM6_MESSB      VMSIMHGRVFEKVGVHTSTVHGEFSPEFRRQIPGAEEDPRFWASGISVIAHPQNPHVPTVHMNTRMVVTT
HEM6_AGRVS      XXXXXXXXVFEKVGVHTSTVHGEFSPEFRKQMPGAEEDPRFWASGISLIAHSCNPHVPAVHMNTRMVVTT
HEM6_BRAJA      XXXXXXXRLFEKVGVHCSTVHGEFAPEFRAQIPGAADDPRFWASGISLIAHLRNPHVPAVHMNTRFVVTT
HEM6_CAUCR      XXXXXXXRLFEKVGVHVSTVFGTFTPEMAKTMPGAAEDPRFFATGISLIAHMTNPRVPAVHMNTRFIATT
HEM6_CAUCN      XXXXXXXRLFEKVGVHVSTVFGTFTPEMAKTMPGAAEDPRFFATGISLIAHMTNPRVPAVHMNTRFIATT
HEM6_CAUSK      VMSMMHGRLFEKVGVHVSTVFGTFTPEMAKNMPGADEDPRFFATGISLIAHMRSPRVPAVHMNTRFIATT
HEM6_RICB8      SVMKG--EVFEKVGVNISTVFGEFSKAFRAEIPGAELDGKFFATGISLVAHLKSPLIPAMHFNTRYIETS
HEM6_RICBR      XXXXXXX--FEKVGVNISTVFGEFSKAFRAEIPGAELDGKFFATGISLVAHLKSPLIPAMHFNTRYIETS
HEM6_RICFE      SLMKG--EVFEKVGVNISTVFGEFSPEFRSEIPGAELDGKFFATGISLVAHLKSPLIPAMHFNTRYIETS
HEM6_RICAH      SLMKG--EVFEKVGVNISTVFGEFSPEFRSEIPGAELDGKFSATGISLVAHLKSPLIPAMHFNTRYIETS
HEM6_RICCN      SLMKGA--VFEKVGVNISTVFGKISPEFRNEIPGAELDGKFFATGISLVAHLKSPLIPAMHFNTRYIETS
HEM6_RICRS      SLMKGA--VFEKVGVNISTVFGKISPEFRNEIPGAELDGKFFATGISLVAHLKSPLIPAMHFNTRYIETS
HEM6_RICRO      SLMKGA--VFEKVGVNISTVFGKISPEFRNEIPGAELDGKFFATGISLVAHLKSPLIPAMHFNTRYIETS
HEM6_RICPU      SLMKGA--VFEKVGVNISTVFGKISPEFRNEIPGVELDGKFFATGISLVAHLKSPLIPAMHFNTRYIETS
HEM6_RICAE      SLMKGA--VFEKVGVNISTVFGKISSEFRNEIPGAELDGKFFATGISLVAHLKSPLIPAMHFNTRYIETS
HEM6_RICPR      SLMKG--EVFEKVGVNISTVFGEFSQEFRSEILGAELDGKFFATGISVVAHLKSPLIPAMHFNTRYIETS
HEM6_RICTY      SLMKG--EVFEKVGVNISTVFGEFSQEFRSEILGAELDGKFFATGISVVAHLKSPLIPAMHFNTRYIETS
HEM6_GLOVI      XILTEG-RVFERAGIGFSEVHGSLPPSILQQRPEAEGHP-FYVTGTSMVLHPRNPYVPTVHLNYRYFEAG
HEM6_SACD2      RVLTNGA-VIEKGGVNFSHVHGSSMPAHRPELAGRS----FEAMGVSLVIHPNNPHVPTSHANVRFFIAE
HEM6_THISH      RVLTEGA-VFEQAGINFSHVTGASLPPHRPELAGR----RFQATGVSLVIHPRNPYVPTSHANVRFFIAE
HEM6_SYNP6      RVIREG-NVFEQGGVNFSEVWGELPPSILAQYPEAAGHGYF-ATGTSMVLHPRNPYIPTVHLNYRYFEAG
HEM6_SYNSC      SRVMREGRVFEQGGVNFSEVQGELPPSILKQRPEAKGHPWF-ATGTSMVLHPRNPYIPTVHLNYRYFEAG
HEM61_ANASP     SRVLRDGAIFEQAGVNFSEVWGSLPPSILAQRPEAEGHG-FYATGTSLVLHPRNPYVPTVHLNYRYFEAG
HEM6_ECOSM      RVLRNGG-VFEQAGVNFSHVHGEVMPAHRPELAGRS----FEAMGVSLVVHPHNPYVPTSHANVRFFIAE
HEM6_SALSV      RVLRNGG-IFEQAGVNFSHVHGDAMPAHRPELAGRS----FEAMGVSLVVHPHNPYIPTSHANVRFFIAE
HEM6_CITK8      RVLRNGG-VFEQAGVNFSHVHGDAMPAHRPELAGRS----FEAMGVSLVVHPLNPYIPTSHANVRFFIAE
HEM6_BURCJ      -------RVFERAGIGFSDVAGDALPPSASAARPQLAGRGFEALGVSLVLHPRNPYCPTVHMNVRMLIAT
HEM6_BURS3      -------RVFERAGIGFSDVAGDALPPSASAARPQLAGRGFEALGVSLVLHPRNPYCPTVHMNVRMLIAT
HEM6_SALTY      RVLRNGG-IFEQAGVNFSHVHGDAMPAHRPELAGRS----FEAMGVSLVVHPHNPYIPTSHANVRFFIAE
HEM6_SALHS      RVLRNGG-IFEQAGVNFSHVHGDAMPAHRPELAGRS----FEAMGVSLVVHPHNPYIPTSHANVRFFIAE
HEM6_SALEP      RVLRNGG-IFEQAGVNFSHVHGDAMPAHRPELAGRS----FEAMGVSLVVHPHNPYIPTSHANVRFFIAE
HEM6_SALPK      RVLRNGG-IFEQAGVNFSHVHGDAMPAHRPELAGRS----FEAMGVSLVVHPHNPYIPTSHANVRFFIAE
HEM6_SALPC      RVLRNGG-IFEQAGVNFSHVHGDAMPAHRPELAGRS----FEAMGVSLVVHPHNPYIPTSHANVRFFIAE
HEM6_SALPB      RVLRNGG-IFEQAGVNFSHVHGDAMPAHRPELAGRS----FEAMGVSLVVHPHNPYIPTSHANVRFFIAE
HEM6_SALPA      RVLRNGG-IFEQAGVNFSHVHGDAMPAHRPELAGRS----FEAMGVSLVVHPHNPYIPTSHANVRFFIAE
HEM6_SALNS      RVLRNGG-IFEQAGVNFSHVHGDAMPAHRPELAGRS----FEAMGVSLVVHPHNPYIPTSHANVRFFIAE
HEM6_SALG2      RVLRNGG-IFEQAGVNFSHVHGDAMPAHRPELAGRS----FEAMGVSLVVHPHNPYIPTSHANVRFFIAE
HEM6_SALDC      RVLRNGG-IFEQAGVNFSHVHGDAMPAHRPELAGRS----FEAMGVSLVVHPHNPYIPTSHANVRFFIAE
HEM6_SALCH      RVLRNGG-IFEQAGVNFSHVHGDAMPAHRPELAGRS----FEAMGVSLVVHPHNPYIPTSHANVRFFIAE
HEM6_SALA4      RVLRNGG-IFEQAGVNFSHVHGDAMPAHRPELAGRS----FEAMGVSLVVHPHNPYIPTSHANVRFFIAE
HEM6_PROMH      TRMLTQGAIFEQAGVNFSHVYGDALPASATAHRPELSGRRFQAMGVSLVIHPLNPYIPTSHANVRFFIAE
HEM6_BURM1      -------RVFERAGIGFSDVAGDALPPSASAARPQLAGRGFEALGVSLVLHPRNPYCPTVHMNVRMLIAT
HEM6_SALTI      RVLRNGG-IFEQAGVNFSHVHGDAMPAHRPELAGRS----FEAMGVSLVVHPHNPYIPTSHANVRFFIAE
HEM6_PSEPK      XXXXXXXNVIEKGGVNFSHVFGSGLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVPTSHANVRFFIAE
HEM6_ERWT9      RVLRQG-RVFEQAGVNFSHVHGDEMPAHRPELAGRS----FEALGVSLVIHPENPYIPTSHANVRFFIAE
HEM6_SYNS9      RVMREG-RVFEQGGVNFSEVQGELPPSILKQRPEAKGHPWF-ATGTSMVLHPRNPYIPTVHLNYRYFEAG
HEM6_PSEPW      XXXXXXXKLIEKGGVNFSHVFGSGLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVPTSHANVRFFIAE
HEM6_BURCC      -------RVFERAGIGFSDVAGDALPPSASAARPQLAGRGFEALGVSLVLHPRNPYCPTVHMNVRMLIAT
HEM6_PSEP1      XXXXXXXKVIEKGGVNFSHVFGAGLPPSASAHRPELAGRGFEALGVSLVIHPYNPHVPTSHANVRFFIAE
HEM6_ECOLU      RVLRNGG-VFEQAGVNFSHVHGEAMPAHRPELAGRS----FEAMGISLVVHPHNPYVPTSHANVRFFIAE
HEM6_THEEB      SRVMKNGQLLEQGGVNFSEVWGELPPSILAQRPEAA-GYGFYATGTSMVLHPRNPYVPTVHLNYRYFEAG
HEM6_SYNY3      RVLADGD-FLEQGGVNFSEVWGKLPPSILKQRPEAEGH-EFYATGTSMVLHPKNPYIPTVHLNYRYFEAG
HEM6_ENT38      RVLRNGG-VFEQAGVNFSHVHGDAMPAHRPELAGRS----FEAMGVSLVVHPQSPFVPTSHANVRFFIAE
HEM6_SYNPX      RVMREGL-VFEQGGVNFSEVQGELPPSILKQRPEAKGHPWF-ATGTSMVLHPHNPYIPTVHLNYRYFEAG
HEM6_SHEON      --------VFEQAGVNFSHVTGAAMPAHRPELAGRS----FEAMGVSLVIHPKNPYIPTTHANVRFFIAH
HEM6_PSEPG      XXXXXXXKVIEKGGVNFSHVFGAGLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVPTSHANVRFFIAE
HEM6_PSEE4      XXXXXXXKVIEKGGVNFSHVFGAGLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVPTSHANVRFFIAE
HEM6_SHEB2      RVLTQGA-VFEQAGVNFSHVTGAAMPAHRPELAGRS----FEAMGVSLVIHPNNPYIPTTHANVRFFIAQ
HEM6_SALAR      RVLRNGG-IFEQAGVNFSHVNGDAMPAHRPELVGRS----FEAMGVSLVVHPRNPYIPTSHANVRFFIAE
HEM6_IDILO      --------VFEQGGVGFSHVYGEKMPASATAHRPELEGRDFNACGVSLVMHPENPMVPTVHMNVRFFIAQ
HEM6_ECOL6      RVLRNGG-VFEQAGVNFSHVHGEAMPAHRPELAGRS----FEAMGVSLVVHPHNPYVPTSHANVRFFIAE
HEM6_ECOL5      RVLRNGG-VFEQAGVNFSHVHGEAMPAHRPELAGRS----FEAMGVSLVVHPHNPYVPTSHANVRFFIAE
HEM6_ECOK1      RVLRNGG-VFEQAGVNFSHVHGEAMPAHRPELAGRS----FEAMGVSLVVHPHNPYVPTSHANVRFFIAE
HEM6_ECO81      RVLRNGG-VFEQAGVNFSHVHGEAMPAHRPELAGRS----FEAMGVSLVVHPHNPYVPTSHANVRFFIAE
HEM6_ECO45      RVLRNGG-VFEQAGVNFSHVHGEAMPAHRPELAGRS----FEAMGVSLVVHPHNPYVPTSHANVRFFIAE
HEM6_ECO27      RVLRNGG-VFEQAGVNFSHVHGEAMPAHRPELAGRS----FEAMGVSLVVHPHNPYVPTSHANVRFFIAE
HEM6_SHIDS      RVLRNGG-VFEQAGVNFSHVHGEAMPAHRPELAGRS----FEAMGVSLVVHPHNPYVPTSHANVRFFIAE
HEM6_SHEB8      RVLTQGA-VFEQAGVNFSHVTGAAMPAHRPELAGRS----FEAMGVSLVIHPNNPYIPTTHANVRFFIAQ
HEM6_SHEB5      RVLTQGA-VFEQAGVNFSHVTGAAMPAHRPELAGRS----FEAMGVSLVIHPNNPYIPTTHANVRFFIAQ
HEM6_ESCF3      RVLRNGG-VFEQAGVNFSHVHGEAMPAHRPELAGRS----FEAMGVSLVVHPHNPYVPTSHANVRFFIAE
HEM6_ENTS8      RVLRDGV-VFEQAGVNFSHVHGDAMPAHRPELAGRS----FEAMGVSLVVHPRNPYVPTSHANVRFFIAE
HEM6_DECAR      ---------FERGGVNFSHVTGKSLPAVRPQLAG-----RSWAMGVSLVLHPRNPYCPTAHMNVRCFVAS
HEM6_BURCM      -------RVFERAGIGFSDVAGDALPPSASAARPQLAGRGFEALGVSLVLHPRNPYCPTVHMNVRMLIAT
HEM6_BURA4      -------RVFERAGIGFSDVAGDALPPSASAARPQLAGRGFEALGVSLVLHPRNPYCPTVHMNVRMLIAT
HEM6_BORPA      -------QLFERAGVLFSHVKGTRLPPHRPELAG-----RGWAMGVSMVLHPRNPYVPTTHMNVRMFVAA
HEM6_BORBR      -------QLFERAGVLFSHVKGTRLPPHRPELAG-----RGWAMGVSMVLHPRNPYVPTTHMNVRMFVAA
HEM6_SHESW      RVLTQGA-VFEQAGVNFSHVTGAAMPAHRPELAGRS----FEAMGVSLVIHPNNPYIPTTHANVRFFIAQ
HEM6_SHEPC      RVLTQGA-VFEQAGVNFSHVTGAAMPAHRPELAGRS----FEAMGVSLVIHPNNPYIPTTHANVRFFIAQ
HEM6_ECOLI      RVLRNGG-VFEQAGVNFSHVHGEAMPAHRPELAGRS----FEAMGVSLVVHPHNPYVPTSHANVRFFIAE
HEM6_ECOLC      RVLRNGG-VFEQAGVNFSHVHGEAMPAHRPELAGRS----FEAMGVSLVVHPHNPYVPTSHANVRFFIAE
HEM6_ECOHS      RVLRNGG-VFEQAGVNFSHVHGEAMPAHRPELAGRS----FEAMGVSLVVHPHNPYVPTSHANVRFFIAE
HEM6_ECODH      RVLRNGG-VFEQAGVNFSHVHGEAMPAHRPELAGRS----FEAMGVSLVVHPHNPYVPTSHANVRFFIAE
HEM6_ECOBW      RVLRNGG-VFEQAGVNFSHVHGEAMPAHRPELAGRS----FEAMGVSLVVHPHNPYVPTSHANVRFFIAE
HEM6_BURPP      -------KFFERAGIGFSDVAGDALPAARPQLAGRG----FEAMGVSLVLHPHNPHCPTVHMNVRLLIAT
HEM6_SHIFL      RVLRNGG-VFEQAGVNFSHVHGEAMPAHRPELAGRS----FEAMGVSLVVHPHNPYVPTSHANVRFFIAE
HEM6_SHIF8      RVLRNGG-VFEQAGVNFSHVHGEAMPAHRPELAGRS----FEAMGVSLVVHPHNPYVPTSHANVRFFIAE
HEM6_SHEPW      -------KVFEQAGVNFSHVMGASMPAHRPELAGRN----FEAMGVSLVIHPNNPHIPTTHANVRFFIAH
HEM6_ECO7I      RVLRNGG-VFEQAGVNFSHVHGDAMPAHRPELAGRS----FEAMGVSLVVHPHNPYVPTSHANVRFFIAE
HEM6_BORPE      -------QLFERAGVLFSHVKGTRLPPHRPELAG-----RGWAMGVSMVLHPRNPYVPTTHMNVRMFVAA
HEM6_SHESH      -------KVFEQAGVNFSHVTGAAMPASATANRSELEGRSFEAMGVSLVIHPKNPFLPTTHANVRFFIAK
HEM6_SHESA      RVLTQGA-VFEQAGVNFSHVTGAAMPAHRPELAGRS----FEAMGVSLVIHPKNPYIPTTHANVRFFIAH
HEM6_ECO5E      RVLRNGG-VFEQAGVNFSHVHGEAMPAHRPELAGRS----FEAMGVSLVVHPHNPYVPTSHANVRFFIAE
HEM6_ECO57      RVLRNGG-VFEQAGVNFSHVHGEAMPAHRPELAGRS----FEAMGVSLVVHPHNPYVPTSHANVRFFIAE
HEM6_SHISS      RVLRNGG-VFEQAGVNFSHVHGEAMPAHRPELAGRS----FEAMGVSLVVHPHNPYVPTSHANVRFFIAE
HEM6_SHIBS      RVLRNGG-VFEQAGVNFSHVHGEAMPAHRPELAGRS----FEAMGVSLVVHPHNPYVPTSHANVRFFIAE
HEM6_SHIB3      RVLRNDG-VFEQAGVNFSHVHGEAMPAHRPELAGRS----FEAMGVSLVVHPHNPYVPTSHANVRFFIAE
HEM6_ECO8A      RVLRNGG-VFEQAGVNFSHVHGEAMPAHRPELAGRS----FEAMGVSLVVHPHNPYVPTSHANVRFFIAE
HEM6_ECO24      RVLRNGG-VFEQAGVNFSHVHGEAMPAHRPELAGRS----FEAMGVSLVVHPHNPYVPTSHANVRFFIAE
HEM6_BURXL      ---------FERAGIGFSDVXXXXXXXXXXXXXXXXXXRGFEAMGVSLVLHPHNPHCPTVHMNVRLLIAT
HEM6_SHEHH      --------VFEQAGVNFSHVMGASMPAHRPELAGRS----FEAMGVSLVIHPNNPHIPTTHANVRFFIAH
HEM6_CHRVO      XXXXXXXEVFEQAGVNFSHVHGDALPPSASAHRPELAGRRFEAMGVSLVIHPSNPHVPTSHANVRFFIAE
HEM62_ANASP     RVIREG-RVFEQGGVNFSAVWGNSLPASRPEAAGHE----FFATGTSMVLHPRNPYVPTVHLNYRYFEAG
HEM6_SHESR      RVLTQGA-VFEQAGVNFSHVTGAAMPAHRPELAGRS----FEAMGVSLVIHPKNPYIPTTHANVRFFIAH
HEM6_SHESM      RVLTQGA-VFEQAGVNFSHVTGAAMPAHRPELAGRS----FEAMGVSLVIHPKNPYIPTTHANVRFFIAH
HEM6_BORPD      -------QLLERAGVLFSHVHGTRLPPHRPELAG-----RSWAMGVSLVLHPRNPYVPTTHMNVRMFVAA
HEM6_AERS4      RVMRHGDMI-EQGGVNFSHVYGDAMPAHRPELAGR----KFEAMGVSLVIHPHNPYVPTSHANVRFFIAE
HEM6_SHEWM      RVLTQG-KVFEQAGVNFSHVTGAAMPAHRPELAGRS----FEAMGVSLVIHPNNPYIPTTHANVRFFIAK
HEM6_SHEPA      --------VFEQAGVNFSHVMGASMPAHRPELAGRS----FEAMGVSLVIHPKNPHIPTTHANVRFFIAH
HEM6_YEAST      SMVIQDGTTFEKGGVNVSVVYGQLSPAAVSAMKADHEDPKFFACGLSMVIHPVNPHAPTTHLNYRYFETW
HEM6_PROM1      RVLKDG-KIFEQGGVNFSEVHGELPPSIISQRPEAKGHSWF-ATGTSMVLHPKNPYIPTVHLNYRYFEAG
HEM6_ECO55      RVLRNGG-VFEQAGVNFSHVHGEAMPAHRPELAGRS----FEAMGVSLVVHPHNPYVPTSHANVRFFIAE
HEM6_ECOSE      RVLRNGG-VFEQAGVNFSHVHGEAMPAHRPELAGRS----FEAMGVSLVVHPHNPYVPTSHANVRFFIAE
HEM6_PSEU5      RVIENGALI-EKGGVNFSHVHGDSLPPHRPELAGRS----FEALGVSLVIHPHNPYVPTSHANVRFFIAE
HEM6_POLSJ      NGITKILEVFERAGCGFSHVQGSRLPQHRPELAGAP----FEAMGVSLVFHPRNPYVPTVHMNVRMLAAT
HEM6_KLEP7      -------RVFEQAGVNFSHVHGDAMPAHRPELAGRS----FEAMGVSLVVHPLNPYVPTSHANVRFFIAE
HEM6_PROM9      RVLKNGS-IFEQAGVNFSEVQGKELPQIISQRPEAKGHEWF-ATGTSMVLHPKNPFIPTVHLNYRYFEAG
HEM6_SODGM      RVLRQG-RVFEQAGVNFSRVYGGALPAHRPELAGRS----YQAMGVSLVVHPENPYIPTSHANVRFFIAE
HEM6_PROMT      RVLKDG-QIFEQGGVNFSEVHGELPPSIISQRPEAKGHSWF-ATGTSMVLHPKSPYIPTVHLNYRYFEAG
HEM6_POLNA      TKILEQGRVFERAGCGFSHVRGPRLPQHRPELAGAA----FEAMGVSLVFHPRNPYVPTVHMNVRMLAAT
HEM6_PROMS      RVLKNGS-IFEQAGVNFSEVQGKELPQIISQRPEAKGHEWF-ATGTSMVLHPKNPYIPTVHLNYRYFEAG
HEM6_PROMA      RVMREG-RIFEQGGVNFSEVHGELPPSILNQRPEAKGH-KWFATGTSMVLHPRNPYIPTVHLNYRYFEAG
HEM6_BURPS      ---------FERAGIGFSDVAGDALPPSRPQLAGRG----FEALGVSLVLHPRNPYCPTVHMNVRMLIAT
HEM6_BURP6      ---------FERAGIGFSDVAGDALPPSRPQLAGRG----FEALGVSLVLHPRNPYCPTVHMNVRMLIAT
HEM6_BURP0      ---------FERAGIGFSDVAGDALPPSRPQLAGRG----FEALGVSLVLHPRNPYCPTVHMNVRMLIAT
HEM6_BURMS      ---------FERAGIGFSDVAGDALPPSRPQLAGRG----FEALGVSLVLHPRNPYCPTVHMNVRMLIAT
HEM6_BURMA      ---------FERAGIGFSDVAGDALPPSRPQLAGRG----FEALGVSLVLHPRNPYCPTVHMNVRMLIAT
HEM6_BURM9      ---------FERAGIGFSDVAGDALPPSRPQLAGRG----FEALGVSLVLHPRNPYCPTVHMNVRMLIAT
HEM6_BURM7      ---------FERAGIGFSDVAGDALPPSRPQLAGRG----FEALGVSLVLHPRNPYCPTVHMNVRMLIAT
HEM6_VARPS      --------LFERAGCGFSQVRGPRLPQNRPELAGAP----FEAMGVSLVFHPRNPYVPIVHMNVRMLAAL
HEM6_KLEP3      --------VFEQAGVNFSHVHGDAMPAHRPELAGRS----FEAMGVSLVVHPLNPYVPTSHANVRFFIAE
HEM6_COXBU      XXXXEG-HVIEQGGVNFSCVYGNQLPPAATQKHPEISGFAFQAEGLSLVIHPRNPYVPTVHANFRFFIAG
HEM6_SHEAM      --------VFEQAGVNFSHVMGASMPAHRPELAGRS----FEAMGVSLVIHPKNPYIPTTHANVRFFIAR
HEM6_PROM0      RVLKNGS-IFEQAGVNFSEVQGKELPQIISQRPEAKGHEWF-ATGTSMVLHPKNPYIPTVHLNYRYFEAG
HEM6_FRATF      --------IFEKGVVAFSRVHGSELPPFRQELAGKS----FIATGLSLVIHPRNPFVPTSHANFRIFIAG
HEM6_COXBR      XXXXEG-HVIEQGGVNFSCVYGNQLPPAATQKHPEISGFAFQAEGLSLVIHPRNPYVPTVHANFRFFIAG
HEM6_COXBN      XXXXEG-HVIEQGGVNFSCVYGNQLPPAATQKHPEISGFDFQAEGLSLVIHPRNPYVPTVHANFRFFIAG
HEM6_ERWCT      --------IFERTGVNFSHVTGKSLPPSASTHRPDLAGRSFQAMGVSLVIHPLSPYIPTSHANVRLFVAE
HEM6_YERP3      RVLVNGA-VFEQAGVNFSHVSGAMLPAHRPELAGRS----FQALGVSLVIHPLNPYLPTSHANVRFFIAE
HEM6_SHEDO      -------KLFEQAGVNFSHVKGAAMPAHRPELAGRS----FEAMGVSLVIHPNNPYIPTTHANVRFFIAS
HEM6_NITEC      CVIEEG-NVLERGGVNFSHVHGKGLPASATAARPELAGRAFEAAGVSLVLHPRNPYAPTVHMNVRFFAAI
HEM6_PHOLL      RIMKEGT-IFEQAGANFSHVSGDMLPAHRPELVGRH----YQAMGVSLVIHPLNPYIPTSHANVRFFIAE
HEM6_NITEU      --------VLERGGVNFSHVFGKGLPASATAARPELAGRAFEAAGVSLVLHPRNPYAPTVHMNVRFFAAT
HEM6_SERP5      --------VFEQAGVNFSHVSGATLPAHRPELAGRS----FQAMGVSLVIHPRSPYIPTSHANVRFFIAE
HEM6_PSEPF      TRVIENGTVIEKGGVNFSHVFGSGLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVPTSHANVRFFIAE
HEM6_PROM2      RVLKNGS-IFEQAGVNFSEVQGKELPQSIVSQRPEAKGHEWFATGTSMVLHPKNPYIPTVHLNYRYFEAG
HEM6_FRATT      --------IFEKGVVAFSRVHGSELPPSRQELAGKS----FIATGLSLVIHPRNPFVPTSHANFRIFIAG
HEM6_FRAT1      --------IFEKGVVAFSRVHGSELPPSRQELAGKS----FIATGLSLVIHPRNPFVPTSHANFRIFIAG
HEM6_YERPY      --------VFEQAGVNFSHVSGAMLPAHRPELAGRS----FQALGVSLVIHPLNPYLPTSHANVRFFIAE
HEM6_YERPS      --------VFEQAGVNFSHVSGAMLPAHRPELAGRS----FQALGVSLVIHPLNPYLPTSHANVRFFIAE
HEM6_YERPP      --------VFEQAGVNFSHVSGAMLPAHRPELAGRS----FQALGVSLVIHPLNPYLPTSHANVRFFIAE
HEM6_YERPN      --------VFEQAGVNFSHVSGAMLPAHRPELAGRS----FQALGVSLVIHPLNPYLPTSHANVRFFIAE
HEM6_YERPG      --------VFEQAGVNFSHVSGAMLPAHRPELAGRS----FQALGVSLVIHPLNPYLPTSHANVRFFIAE
HEM6_YERPE      --------VFEQAGVNFSHVSGAMLPAHRPELAGRS----FQALGVSLVIHPLNPYLPTSHANVRFFIAE
HEM6_YERPB      --------VFEQAGVNFSHVSGAMLPAHRPELAGRS----FQALGVSLVIHPLNPYLPTSHANVRFFIAE
HEM6_YERPA      --------VFEQAGVNFSHVSGAMLPAHRPELAGRS----FQALGVSLVIHPLNPYLPTSHANVRFFIAE
HEM6_VIBSL      --------VFEQGGVNFSHVAGKAMPAHRPELAGR----KFEAMGVSLVIHPKNPYIPTSHANVRFFIAE
HEM6_VIBCH      GGRTRVMRVFEQGGVNFSHVFGEQMPAHRPELAGR----RFEAMGVSLVMHPKNPYVPTSHANVRFFIAE
HEM6_VIBC3      GGRTRVMRVFEQGGVNFSHVFGEQMPAHRPELAGR----RFEAMGVSLVMHPKNPYVPTSHANVRFFIAE
HEM6_PSEAE      XXXXXXXALIEKGGVNFSHVFGDSLPPSASAHRPELAGRGFQALGVSLVIHPENPHVPTSHANVRFFCAE
HEM6_PSEAB      XXXXXXXALIEKGGVNFSHVFGDSLPPSASAHRPELAGRGFQALGVSLVIHPENPHVPTSHANVRFFCAE
HEM6_PSE14      TRVIENGAVIEKGGVNFSHVFGSNLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVPTSHANVRFFIAE
HEM6_PROMP      RVLKNGS-IFEQAGVNFSEVHGKELPQIISQRPEAKGH-KWFATGTSMVLHPKNPFIPTVHLNYRYFEAG
HEM6_FRATM      --------IFEKGVVAFSRVHGSELPPSRQELAGKS----FIATGLSLVIHPRNPFVPTSHANFRIFIAD
HEM6_ARATH      --------VFEKAGVNVSVVYGVMPPEAYRAAKGSASDQKFFAAGVSSVLHPKNPFAPTLHFNYRYFETD
HEM6_PECCP      ---------FERAGVNFSHVTGKSLPPSASTHRPDLAGRSFQAMGVSLVIHPLSPYIPTSHANVRLFIAE
HEM6_FRATW      --------IFEKGVVAFSRVHGSELPPSRQELAGKS----FIATGLSLVIHPRNPFVPTSHANFRIFIAG
HEM6_FRATH      --------IFEKGVVAFSRVHGSELPPSRQELAGKS----FIATGLSLVIHPRNPFVPTSHANFRIFIAG
HEM6_STRM5      RVLRDGA-VFEQAGIGFSDVAGSRLPPSRPELAGAS-----WATGVSLVFHPLNPYVPTTHANVRFFQAV
HEM6_PSEA7      XXXXXXXALIEKGGVNFSHVFGDSLPPSASAHRPELAGRGFQALGVSLVIHPENPHVPTSHANVRFFCAE
HEM6_METFK      --------VFERAGIGFSHVIGNKLPP-SASVAHPEAAGRSWAMGVSLVFHPRNPYVPTVHMNVRFFVAE
HEM6_PSEA8      XXXXXXXALIEKGGVNFSHVFGDSLPPSASAHRPELAGRGFQALGVSLVIHPENPHVPTSHANVRFFCAE
HEM6_PHOPR      RVLRQGS-VFEQAGVNFSHVFGTKMPAHRPELAGRS----FEAMGVSLVIHPNNPYIPTSHANVRFFIAE
HEM6_PSEU2      TRVIENGTVIEKGGVNFSHVFGSNLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVPTSHANVRFFIAE
HEM6_METCA      XXXXXXXETFEQGGVNFSHVRGASLPAHRPELAGRG----FQATGVSLVIHPLNPYVPTSHANVRFFLTP
HEM6_DROME      --------VFEKAGVNISVVTGSLPPAAVQQMRARGKNLKFFASGVSAVIHPRNPHVPTIHFNYRYFVET
HEM6_AERHH      --------VIEQGGVNFSHVHGDAMPAHRPELAGR----RFEAMGVSLVIHPHNPYVPTSHANVRFFIAE
HEM6_STRMK      RVLRDGA-VFEQAGIGFSDVSGSRLPPSRPELAGAS-----WATGVSLVFHPLNPYVPTTHANVRFFQAV
HEM6_PSESM      TRVVENGAVIEKGGVNFSHVFGSNLPPSASAHRPELAGRGFEALGVSLVIHPHSPHVPTSHANVRFFIAE
HEM6_FRATO      --------IFEKGVVAFSRVHGSELPPSRQELAGKS----FIATGLSLVIHPRNPFVPTSHANFRIFIAG
HEM6_CHRSD      SRVIENGEVFEKGGVNFSHVFGERLPASASAARPELAGRSFHAVGVSWVLHPRNPHVPTAHGNVRFFIAE
HEM6_VIBCM      GGRTRVMRVFEQGGVNFSHVFGEQMPAHRPELAGR----RFEAMGVSLVMHPKNPYVPTSHANVRYFIAE
HEM6_PROMM      SKVMREGRVFEQGGVNFSEVHGELPPSILNQRPEAKGHPWF-ATGTSMVLHPRNPYVPTIHLNYRYFEAG
HEM6_FRATN      --------IFEKGVVAFSRVHGSELPPSRQELAGKS----FIATGLSLVIHPRNPFVPTSHANFRIFITP
HEM6_WIGBR      -------KVFEQVSVNFSHVFGKSLPKSSSNKKRDLENCSYQASGISVVSHPKNPYVPTSHLNIRFFLAT
HEM6_PSEF5      XXXXXXXAVIEKGGVNFSHVFGSGLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVPTSHANVRFFIAE
HEM6_XANOR      RILRDGA-VFEQAGIGFSDVSGTRLPPHRPELAGAT-----WACGVSLVFHPHNPYIPTTHMNVRYFEVV
HEM6_XANOP      RILRDGA-VFEQAGIGFSDVSGTRLPPHRPELAGAT-----WACGVSLVFHPHNPYIPTTHMNVRYFEVV
HEM6_XANOM      RILRDGA-VFEQAGIGFSDVSGTRLPPHRPELAGAT-----WACGVSLVFHPHNPYIPTTHMNVRYFEVV
HEM6_XANC5      RILRDGA-VFEQAGIGFSDVSGTRLPPHRPELAGAT-----WACGVSLVFHPHNPYIPTTHMNVRYFEVV
HEM6_YERE8      RVMVKGA-VFEQAGVNFSHVSGAALPAHRPELAGRS----FQALGVSLVIHPNSPYLPTSHANVRFFIAE
HEM6_XANAC      RILRDGA-VFEQAGIGFSDVSGTRLPPHRPELAGAT-----WACGVSLVFHPHNPYIPTTHMNVRYFEVV
HEM6_FRAP2      --------IFEKGVVAFSRVHGDALPPSRQELAGKS----FIATGVSLVIHPRNPFVPTSHANFRIFVAG
HEM6_VIBVU      TRVMRDGNVFEQGGVNFSHVQGNAMPAHRPELAGR----RFEAMGVSLVMHPHNPYVPTSHANVRFFIAE
HEM6_ORYSJ      RVLQDG-RVFEKAGVNVSVVYGVMPPDAYRXXPKAGPVP-FFAAGISSVLHPKNPFAPTLHFNYRYFETD
HEM6_PROM5      RVLKNGS-IFEQAGVNFSEVYGKELPQIISQRPEAKGHEWF-ATGTSMVLHPKNPFIPTVHLNYRYFEAG
HEM6_VIBVY      TRVMRNGNVFEQGGVNFSHVQGNAMPAHRPELAGR----RFEAMGVSLVMHPHNPYVPTSHANVRFFIAE
HEM6_VIBHB      --------IFEQGGVNFSHVEGNEMPAHRPELAGR----RFEAMGVSLVIHPKNPYVPTSHANVRFFIAE
HEM6_PSEMY      --------LIEKGGVNFSHVFGDSLPPSASAHRPELAGRGFQALGVSLVIHPENPYVPTSHANVRFFSAE
HEM6_LEGPH      TRIMANGNVFEKAGVNFSHVSGEQLPAHREELAGRH----FSALGVSLVIHPQNPYVPTTHANVRFFVAE
HEM6_LEGPC      TRIMANGNVFEKAGVNFSHVSGEQLPAHREELAGRH----FSALGVSLVIHPQNPYVPTTHANVRFFVAE
HEM6_ALCBS      --------VIEKGGVNFSHVFGEQLPEARPELAGRS----FQAMGVSLVIHPKNPYVPTSHANVRFFVAE
HEM6_LEGPL      TRIMANGNVFEKAGVNFSHVSGEQLPAHREELAGRH----FSALGVSLVIHPQNPYVPTTHANVRFFVAE
HEM6_RALPJ      TRILEGGALLERGGVGFSHVMGDTLPPSATANRPELAGRGFEAMGVSLVFHPRNPYVPTVHMNVRCFVAV
HEM6_VIBPA      XXXXXXXXVFEQGGVNFSHVEGKEMPAHRPELAGR----RFEAMGVSLVIHPKNPYVPTSHANVRFFIAE
HEM6_XANCB      --------VFEQAGIGFSDVSGARLPPHRPELAGAT-----WACGVSLVFHPHNPHIPTTHANVRYFRAV
HEM6_LEIMA      RVMVDGA-VIEKGGVNFSHVYGKGLPERHPDIAGCN----FEAMGVSLVIHPKNPHVPTSHANVRLFVAE
HEM6_LEGPA      --------VFEKAGVNFSHVSGEQLPAHREELAGRH----FSALGVSLVIHPQNPYVPTTHANVRFFVAE
HEM6_SOYBN      --------VWEKAGVNVSVVYGVMPPDAYRAAKGVPTDQKFFAAGISSVLHPKNPFAPTLHFNYRYFETD
HEM6_XANCP      --------VFEQAGIGFSDVSGARLPPHRPELAGAT-----WACGVSLVFHPHNPHIPTTHANVRYFRAV
HEM6_XANC8      --------VFEQAGIGFSDVSGARLPPHRPELAGAT-----WACGVSLVFHPHNPHIPTTHANVRYFRAV
HEM6_TOBAC      --------VFEKAGVNVSVVYGVMPPEYRAARPTDNGNVKFFAAGVSSVLHPKNPFAPTLHFNYRYFETD
HEM6_SCHPO      CVIQDG-NVFEKGGVNTSIVQGKLNQDAVQRMRANHEELPFFAAGISMVIHPRNPMAPTTHLNYRYFELV
HEM6_PSEFS      TRVIENGSVIEKGGVNFSHVFGSGLPPSASAHRPELAGRGFEALGVSLVIHPHNPHVPTSHANVRFFIAE
HEM6_RALSO      TCILENGAVLERGGVGFSHVMGDTLPPSATANRPELAGRGFEAMGVSLVFHPRNPYAPTVHMNVRCFVAQ
HEM6_HORVU      RVLQDG-NVFEKAGVNVSAVIGVCPRSXXXXXXXXXXXXXFFSAGISSVLHPKNPFAPTLHFNYRYFETD
HEM6_AZOSE      TRVIEEGRFFERGGVNFSHVIGGAMPASATAHRPDLAGRTFEAMGVSLVLHPRNPYCPTVHMNVRFFIAS
HEM6_MOUSE      -------RVFEKAGVSISVVHGNLSEEAANQMRGRGKTLKFTAMGVSSVIHPKNPYAPTMHFNYRYFEVT
HEM6_RAT        -------RVFEKAGVNISVVHGNLSEEAANQMRSRKKDGKFTAMGISSVIHPKNPYAPTMHFNYRYFEVE
HEM6_HUMAN      --------VFEKAGVSISVVHGNLSEEAAKQMRSRGKVLKFCAMGVSSVIHPKNPHAPTIHFNYRYFEVE
HEM6_DICDI      ----------EKGGVNFSYIVGSNLPSAAATQFKIAPDTKYIATGVSLVIHPYNPNVPTIHMNVRYFEAG
HEM6_XYLFA      --------VFEQAGIGFSDVCGTHLPPSRPELAGAN-----WACGVSLVFHPKNPFVPTTHLNVRYFRAV
HEM6_XYLFM      --------VFEQAAIGFSDVCGTHLPPSRPELAGAN-----WACGVSLVFHPKNPFVPTTHLNVRYFRAV
HEM6_XYLFT      --------VFEQAAIGFSDVCGTHLPPSRPELAGAN-----WACGVSLVFHPKNPFVPTTHLNVRYFRAV


                         +         .         .         .         .         *         .:210
query           SHWFGGGADLTPVLGRRRTQQDPDTQLFHRAFEITCNRHPIADYPRYKSWCDEYFFLKHRDEPRGTGGIF
HEM6_AGRT5      SHWFGGGADLTPVLGRRRTQQDPDTQLFHRAFEITCNRHPIADYPRYKSWCDEYFFLKHRDEPRGTGGIF
HEM6_AGRRK      SQWFGGGCDLTPMLNRRRTQEDTDSVLFHRAMQIVCDRHKVADYQRYKAWCDEYFYLKHRNESRGIGGIF
HEM6_RHILW      SRWFGGGADLTPVLSRRRTQEDEDSQLFHKAMEIACRNHAVADYDAYKAWCDDYFFLKHRNEARGIGGIF
HEM6_RHIL3      SRWFGGGADLTPVLSRRRTQEDEDSQLFHKAMEIACRNHAVADYDAYKTWCDEYFFLKHRNEARGIGGIF
HEM6_RHIE6      SRWFGGGADLTPVLSRRRTQEDEDSQLFHKAMEIACRNHAVADYDAYKAWCDDYFFLKHRNEPRGIGGIF
HEM6_RHIEC      SRWFGGGADLTPVLSRRRTQEDEDSQLFHKAMEIACRNHAVADYDAYKAWCDDYFFLKHRNEPRGIGGIF
HEM6_SINMW      SNWFGGGADLTPVLDRRRIPTDADTVLFHRAMEIACNRHKVADYPKFKQWCDEYFYLKHRNEPRGTGGIF
HEM6_RHIME      SNWFGGGADLTPVLDRRRIMTDPDTVLFHRAMEIACNRHPVADHAKFKQWCDEYFYLKHRNEPRGTGGIF
HEM6_OCHA4      RQWFGGGADLTPVLDNRRTQDDPDTLAFHKAFRFICEKHDIVDYQRVKDWCDEYFFLPHRNEARGTGGIF
HEM6_BRUSU      RQWFAGGADLTPVLDRRRTQEDPDTLAFHKAFRFICEKHKIVDYQRLKEWCDEYFFLPHRDEPRGIGGIF
HEM6_BRUME      RQWFAGGADLTPVLDRRRTQEDPDTLAFHKAFRFICEKHKIVDYQRLKEWCDEYFFLPHRDEPRGIGGIF
HEM6_BRUMB      RQWFAGGADLTPVLDRRRTQEDPDTLAFHKAFRFICEKHKIVDYQRLKEWCDEYFFLPHRDEPRGIGGIF
HEM6_BRUC2      RQWFAGGADLTPVLDRRRTQEDPDTLAFHKAFRFICEKHKIVDYQRLKEWCDEYFFLPHRDEPRGIGGIF
HEM6_BRUAB      RQWFAGGADLTPVLDRRRTQEDPDTLAFHKAFRFICEKHKIVDYQRLKEWCDEYFFLPHRDEPRGIGGIF
HEM6_BRUA2      RQWFAGGADLTPVLDRRRTQEDPDTLAFHKAFRFICEKHKIVDYQRLKEWCDEYFFLPHRDEPRGIGGIF
HEM6_BRUA1      RQWFAGGADLTPVLDRRRTQEDPDTLAFHKAFRFICEKHKIVDYQRLKEWCDEYFFLPHRDEPRGIGGIF
HEM6_MESSB      RQWFGGGADLTPMLNRRRSQEDPDAIAFHKAMRFVCERHAVADYEKFKNWCEEYFFLPHRNEPRGIGGIF
HEM6_AGRVS      SQWFGGGADLTPVLDRRRTQDDADTVXXXXXXXXXXXXHPVADYPHYKAWCEEYFFLPHRQEPRGIGGIF
HEM6_BRAJA      KAWFGGGADLTPVLDRRRTQDDADSIAFHAAMKEACQPNGVADYDKYKKWCDEYFYLPHRKEARGIGGIF
HEM6_CAUCR      KSWFGGGGDLTPLLGYQRQQDFPDAIDFHAAYKRACDKYDPEWHPKYKAWCDEYFFLPHRNEPRGIGGIF
HEM6_CAUCN      KSWFGGGGDLTPLLGYQRQQDFPDAIDFHAAYKRACDKYDPEWHPKYKAWCDEYFFLPHRNEPRGIGGIF
HEM6_CAUSK      KSWFGGGGDLTPLLGYQRQQDFPDAIDFHAAYQRACDAHDPTWHAKYKAWCDEYFFLPHRNEPRGIGGIF
HEM6_RICB8      KNWFGGGGDLTPFY-----PEEDETAKFHAAFKEACDKYDSGYYPKFKKQCDEYFYLKHRKEPRGVGGIF
HEM6_RICBR      KNWFGGGGDLTPFY-----PEEDETAKFHAAFKEACDKYDSGYYPKFKKQCDEYFYLKHRKEPRGVGGIF
HEM6_RICFE      KSWFGGGGDLTPFY-----PKENETAKFHAAFKEACDKYDSSYYPKFKKQCDEYFYLKHRKEPRGVGGIF
HEM6_RICAH      KSWFGGGGDLTPFY-----PEENETEKFHAAFKEACDKYDSGYYPKFKKQCDEYFYLKHRKEPRGVGGIF
HEM6_RICCN      KSWFGGGGDLTPFYPEKN-----ETVKFHAAFKEACDKYDSSYYPKFKKQCDEYFYLKHRKEPRGVGGIF
HEM6_RICRS      KSWFGGGGDLTPFYPEKN-----ETVKFHAAFKEVCDKYDSSYYPKFKKQCDEYFYLKHRKEPRGVGGIF
HEM6_RICRO      KSWFGGGGDLTPFYPEKN-----ETVKFHAAFKEVCDKYDSSYYPKFKKQCDEYFYLKHRKEPRGVGGIF
HEM6_RICPU      KSWFGGGGDLTPFYPEKN-----ETVKFHAAFKEACDKYDSSYYPKFKKQCDEYFYLKHRKEPRGVGGIF
HEM6_RICAE      KSWFGGGGDLTPFYPEKN-----ETVKFHAAFKEACDKYDSSYYPKFKKQCDEYFYLKHRKEPRGVGGIF
HEM6_RICPR      KNWFGGGGDLTPFY-----PEENETAKFHTAFKEACDKYDSSYYPKFKKQCDEYFYLRHRKEPRGVGGIF
HEM6_RICTY      KNWFGGGSDLTPFY-----PEENETAKFHTAFKEACDKYDSSYYPKFKRQCDEYFYLRHRKEPRGVGGIF
HEM6_GLOVI      PWWFGGGADLTPYYGFVE-----DAAHFHATLKAACDAHDPEYYPRFKKWCDEYFYLKHRQEPRGVGGIF
HEM6_SACD2      KEWFGGGYDLTPYYGN-----DEDCRHWHNTAKAACAPFGEDKYPRYKKWCDEYFYLKHRDEPRGVGGLF
HEM6_THISH      KEWFGGGFDLTPYYG-----EDEDCVHWHRVAKAACEPFGPEVYPRYKQWCDEYFFLRHRNEPRGVGGLF
HEM6_SYNP6      PWWFGGGADLTPYYPFAE-----DAKHFHSSFKAACDRHYPQFYDVFKLWCDEYFFLKHRGETRGIGGIF
HEM6_SYNSC      PWWFGGGADLTPYYPFL-----DDARHFHRTHQAACDSHPDL-HKVFKPWCDEYFYLKHRGETRGVGGIF
HEM61_ANASP     PWWFGGGADLTPYYPFAE-----DAAHFHQTLKLACDEHHPEYYPVFKRWCDEYFYLKHRDETRGVGGLF
HEM6_ECOSM      KPWFGGGFDLTPFYGF-----EEDAIHWHRTARDLCQPFGEDVYPRYKKWCDEYFYLKHRNEQRGIGGLF
HEM6_SALSV      KPWFGGGFDLTPYYGF-----EEDAVHWHRTARDLCQPFGDDVYPRYKKWCDDYFFLKHRNEQRGVGGLF
HEM6_CITK8      KPWFGGGFDLTPYYAF-----EEDAIHWHRTARDLCQPYGEDVYPRYKKWCDDYFFLKHRDEQRGIGGLF
HEM6_BURCJ      KFWFGGGMDLTPVYGF-----EDDARHFHQTCKDALDPFGIELYPRFKQWCDEYFFLKHRNETRGIGGIF
HEM6_BURS3      KFWFGGGMDLTPVYGF-----EDDARHFHQTCKDALDPFGVELYPRFKKWCDEYFFLKHRNEMRGIGGIF
HEM6_SALTY      KPWFGGGFDLTPYYGF-----EEDAVHWHRTARDLCQPFGDDVYPRYKKWCDDYFFLKHRNEQRGVGGLF
HEM6_SALHS      KPWFGGGFDLTPYYGF-----EEDAVHWHRTARDLCQPFGDDVYPRYKKWCDDYFFLKHRNEQRGVGGLF
HEM6_SALEP      KPWFGGGLDLTPYYGF-----EEDAVHWHRTARDLCQPFGDNVYPRYKKWCDDYFFLKHRNEQRGIGGLF
HEM6_SALPK      KPWFGGGFDLTPYYGF-----EEDAVHWHRTARDLCQPFGDDVYPRYKKWCDDYFFLKHRNEQRGIGGLF
HEM6_SALPC      KPWFGGGFDLTPYYGF-----EEDAVHWHRTARDLCQPFGDDVYPRYKKWCDDYFFLKHRNEQRGIGGLF
HEM6_SALPB      KPWFGGGFDLTPYYGF-----EEDAVHWHRTARDLCQPFGDDVYPRYKKWCDDYFFLKHRNEQRGIGGLF
HEM6_SALPA      KPWFGGGFDLTPYYGF-----EEDAVHWHRTARDLCQPFGDDVYPRYKKWCDDYFFLKHRNEQRGIGGLF
HEM6_SALNS      KPWFGGGFDLTPYYGF-----EEDAVHWHRTARDLCQPFGDDVYPRYKKWCDDYFFLKHRNEQRGIGGLF
HEM6_SALG2      KPWFGGGFDLTPYYGF-----EEDAVHWHRTARDLCQPFGDDVYPRYKKWCDDYFFLKHRNEQRGIGGLF
HEM6_SALDC      KPWFGGGFDLTPYYGF-----EEDAVHWHRTARDLCQPFGDDVYPRYKKWCDDYFFLKHRNEQRGIGGLF
HEM6_SALCH      KPWFGGGFDLTPYYGF-----EEDAVHWHRTARDLCQPFGDDVYPRYKKWCDDYFFLKHRNEQRGIGGLF
HEM6_SALA4      KPWFGGGFDLTPYYGF-----EEDAVHWHRTARDLCQPFGDDVYPRYKKWCDDYFFLKHRNEQRGIGGLF
HEM6_PROMH      KEWFGGGFDLTPYYGF-----EEDVIHWHKVAKSVCDPFSQDYYARYKKWCDDYFYLKHRNEPRGVGGLF
HEM6_BURM1      KFWFGGGMDLTPVYGF-----EDDARHFHRTCKDALDPFGAELYPRFKKWCDEYFFLKHRNEMRGVGGIF
HEM6_SALTI      KPWFGGGFDLTPYYGF-----EEDAVHWHRTARDLCQPFGDDVYPRYKKWCDDYFFLKHRNEQRGIGGLF
HEM6_PSEPK      KEWFGGGFDLTPYYGN-----EEDCIHWHRVAEQACAPFGADVYPRYKAWCDRYFHLKHRGEPRGIGGLF
HEM6_ERWT9      KPWFGGGFDLTPFYGFTE-----DAVHWHQTAFDLCLPFGAEVYPRYKKWCDDYFHLKHRNEQRGIGGLF
HEM6_SYNS9      PWWFGGGADLTPYYPFL-----DDARHFHRTHQQACNSHPNL-HKVFKPWCDEYFYLKHRNETRGVGGIF
HEM6_PSEPW      KEWFGGGFDLTPYYGN-----EEDCIHWHRVAEQACAPFGADVYPRYKAWCDRYFHIKHRGEPRGIGGLF
HEM6_BURCC      KFWFGGGMDLTPVYGF-----EDDARHFHQTCKDALDPFGAELYPRFKQWCDEYFFLKHRNETRGIGGIF
HEM6_PSEP1      KEWFGGGFDLTPYYGN-----EEDCVHWHRVAEQACAPFGADVYPRYKAWCDRYFHLKHRGEPRGIGGLF
HEM6_ECOLU      KPWFGGGFDLTPFYGF-----EEDAIHWHRTARDLCQPFGEDVYPRYKKWCDEYFYLKHRNEQRGIGGLF
HEM6_THEEB      PWWFGGGADLTPYYPFAE-----DAKHFHQVHQAACDRHHREYYPVFKRWCDEYFYLKHRGETRGVGGIF
HEM6_SYNY3      PWWFGGGADLTPYYPFAE-----DAAHFHHTLKNACDQTHGEFYPVFKRWCDEYFYLKHRQEMRGIGGIF
HEM6_ENT38      KPWFGGGFDLTPYYGF-----EEDAVHWHRTARDICQPFGEEVYPKYKKWCDDYFYLKHRDEQRGIGGLF
HEM6_SYNPX      PWWFGGGADLTPYYPFLE-----DARHFHRTHQAACDSHPDL-HKVFKPWCDEYFFLKHRGETRGVGGIF
HEM6_SHEON      KDWFGGGFDLTPYY-----PFEEDVREWHQSAKNLCQPFGDDVYPKYKKWCDEYFFLPHRNETRGVGGLF
HEM6_PSEPG      KEWFGGGFDLTPYYGN-----EEDCIHWHRVAEQACAPFGADVYPRYKAWCDRYFHLKHRGEPRGIGGLF
HEM6_PSEE4      KEWFGGGFDLTPYYGN-----EEDCVHWHRVAEQACAPFGADVYPRYKAWCDRYFHLKHRGEPRGIGGLF
HEM6_SHEB2      KEWFGGGFDLTPYY-----PFEEDVREWHQTSKDICAPFGDEVYPKYKKWCDEYFFLPHRNETRGVGGLF
HEM6_SALAR      KPWFGGGFDLTPYYGF-----EEDAVHWHRTARDLCQPFGEDVYPRYKKWCDDYFFIKHRNEQRGIGGLF
HEM6_IDILO      KEWFGGGFDLTPFY-----PFDQDIIEWHQQAKNALDSVDEKLYPEYKAWCDDYFFLKHRDEARGVGGIF
HEM6_ECOL6      KPWFGGGFDLTPFYGF-----EEDAIHWHRTARDLCLPFGEDVYPRYKKWCDEYFYLKHRNEQRGIGGLF
HEM6_ECOL5      KPWFGGGFDLTPFYGF-----EEDAIHWHRTARDLCLPFGEDVYPRYKKWCDEYFYLKHRNEQRGIGGLF
HEM6_ECOK1      KPWFGGGFDLTPFYGF-----EEDAIHWHRTARDLCLPFGEDVYPRYKKWCDEYFYLKHRNEQRGIGGLF
HEM6_ECO81      KPWFGGGFDLTPFYGF-----EEDAIHWHRTARDLCLPFGEDVYPRYKKWCDEYFYLKHRNEQRGIGGLF
HEM6_ECO45      KPWFGGGFDLTPFYGF-----EEDAIHWHRTARDLCLPFGEDVYPRYKKWCDEYFYLKHRNEQRGIGGLF
HEM6_ECO27      KPWFGGGFDLTPFYGF-----EEDAIHWHRTARDLCLPFGEDVYPRYKKWCDEYFYLKHRNEQRGIGGLF
HEM6_SHIDS      KPWFGGGFDLTPFYGF-----EEDAIHWHRTARDLCLPFGEDVYPRYKKWCDDYFYLKHRNEQRGIGGLF
HEM6_SHEB8      KEWFGGGFDLTPYY-----PFEEDVREWHQTSKDICAPFGDEVYPKYKKWCDEYFFLPHRNETRGVGGLF
HEM6_SHEB5      KEWFGGGFDLTPYY-----PFEEDVREWHQTSKDICAPFGDEVYPKYKKWCDEYFFLPHRNETRGVGGLF
HEM6_ESCF3      KPWFGGGFDLTPFYGF-----EEDAIHWHRTARDLCLPFGEDVYPRYKKWCDEYFYLKHRNEQRGIGGLF
HEM6_ENTS8      KPWFGGGFDLTPFYGF-----EEDAVHWHRTARDLCAPFGDDVYPRYKKWCDDYFYLKHRQEARGIGGLF
HEM6_DECAR      KEWFGGGMDMTPYYGQRE-----DVVHFHQ----TCKDAPFGDYPKYKHWCDEYFFLKHRNEPRGVGGVF
HEM6_BURCM      KFWFGGGMDLTPVY-----PFEDDARHFHQVCKDALDPFGAELYPRFKTWCDEYFFLKHRNETRGIGGIF
HEM6_BURA4      KFWFGGGMDLTPVY-----PFEDDARHFHQVCKDALDPFGAELYPRFKTWCDEYFFLKHRNETRGIGGIF
HEM6_BORPA      ARWFGGGLDLTPYY-----PFEDDARHFHRACRDALDPHGADYYPRYKQWCDEYFFLKHRNETRGIGGIF
HEM6_BORBR      ARWFGGGLDLTPYY-----PFEDDARHFHRACRDALDPHGADYYPRYKQWCDEYFFLKHRNETRGIGGIF
HEM6_SHESW      KEWFGGGFDLTPYY-----PFEEDVREWHQTSKDICAPFGDEVYPKYKKWCDEYFFLPHRNETRGVGGLF
HEM6_SHEPC      KEWFGGGFDLTPYY-----PFEEDVREWHQTSKDICAPFGDEVYPKYKKWCDEYFFLPHRNETRGVGGLF
HEM6_ECOLI      KPWFGGGFDLTPFYGF-----EEDAIHWHRTARDLCLPFGEDVYPRYKKWCDEYFYLKHRNEQRGIGGLF
HEM6_ECOLC      KPWFGGGFDLTPFYGF-----EEDAIHWHRTARDLCLPFGEDVYPRYKKWCDEYFYLKHRNEQRGIGGLF
HEM6_ECOHS      KPWFGGGFDLTPFYGF-----EEDAIHWHRTARDLCLPFGEDVYPRYKKWCDEYFYLKHRNEQRGIGGLF
HEM6_ECODH      KPWFGGGFDLTPFYGF-----EEDAIHWHRTARDLCLPFGEDVYPRYKKWCDEYFYLKHRNEQRGIGGLF
HEM6_ECOBW      KPWFGGGFDLTPFYGF-----EEDAIHWHRTARDLCLPFGEDVYPRYKKWCDEYFYLKHRNEQRGIGGLF
HEM6_BURPP      KFWFGGGMDLTPYYG-----YEEDARHFHRTCRDALQPYGADLYPSFKRWCDEYFFLKHRNEARGIGGIF
HEM6_SHIFL      KPWFGGGFDLTPFYGF-----EEDAIHWHRTARDLCQPFGEDVYPRYKKWCDDYFYLKHRNEQRGIGGLF
HEM6_SHIF8      KPWFGGGFDLTPFYGF-----EEDAIHWHRTARDLCQPFGEDVYPRYKKWCDDYFYLKHRNEQRGIGGLF
HEM6_SHEPW      KEWFGGGFDLTPYYPYLE-----DVVSWHQSAKALCEPFGDETYPKYKKWCDEYFWLPHRNETRGVGGLF
HEM6_ECO7I      KPWFGGGFDLTPFYGF-----EEDAIHWHRTARDLCLPFGEDVYPRYKKWCDEYFYLKHRNEQRGIGGLF
HEM6_BORPE      ARWFGGGLDLTPYY-----PFEDDARHFHRACRDALDPHGADYYPRYKQWCDEYFFLKHRNETRGIGGIF
HEM6_SHESH      KEWFGGGFDLTPYY-----PFEEDVIEWHQNAHDLCQPFGESVYPKYKKWCDEYFFLPHRNETRGVGGLF
HEM6_SHESA      KDWFGGGFDLTPYY-----PFEEDVREWHQTAKNLCLPFGDDVYPKYKKWCDEYFFLPHRNETRGVGGLF
HEM6_ECO5E      KPWFGGGFDLTPFYGF-----EEDAIHWHRTARDLCLPFGKDVYPRYKKWCDDYFYLKHRNEQRGIGGLF
HEM6_ECO57      KPWFGGGFDLTPFYGF-----EEDAIHWHRTARDLCLPFGKDVYPRYKKWCDDYFYLKHRNEQRGIGGLF
HEM6_SHISS      KPWFGGGFDLTPFYGF-----EEDAIHWHRTARDLCLPFGEDVYPRYKKWCDDYFYLKHRNEQRGIGGLF
HEM6_SHIBS      KPWFGGGFDLTPFYGF-----EEDAIHWHRTARDLCLPFGEDVYPRYKKWCDDYFYLKHRNEQRGIGGLF
HEM6_SHIB3      KPWFGGGFDLTPFYGF-----EEDAIHWHRTARDLCLPFGEDVYPRYKKWCDDYFYLKHRNEQRGIGGLF
HEM6_ECO8A      KPWFGGGFDLTPFYGF-----EEDAIHWHRTARDLCLPFGEDVYPRYKKWCDDYFYLKHRNEQRGIGGLF
HEM6_ECO24      KPWFGGGFDLTPFYGF-----EEDAIHWHRTARDLCLPFGEDVYPRYKKWCDDYFYLKHRNEQRGIGGLF
HEM6_BURXL      KFWFGGGMDLTPFYG-----YEEDAQHFHRTCRDALQPYGADLYPSFKRWCDEYFFLRHRNEPRGIGGIF
HEM6_SHEHH      KDWFGGGFDLTPYYPYLE-----DVVEWHQSAKSLCEPFGDEIYPEYKQWCDEYFFLPHRNETRGVGGLF
HEM6_CHRVO      KDWFGGGFDLTPFY-----PQEEDAVHWHTVARDLCAPFGGDVYPRYKKWCDEYFHLKHRNEARGIGGLF
HEM62_ANASP     PWWFGGGADLTPYYAFKE-----DAVHFHQTLKNACDVHNPEYYPTFKRWCDEYFYLRHREEQRGIGGIF
HEM6_SHESR      KDWFGGGFDLTPYY-----PFEEDVREWHQTAKNLCLPFGDDIYPKYKKWCDEYFFLPHRNETRGVGGLF
HEM6_SHESM      KDWFGGGFDLTPYY-----PFEEDVREWHQTAKNLCLPFGDDIYPKYKKWCDEYFFLPHRNETRGVGGLF
HEM6_BORPD      ARWFGGGLDLTPYYAF-----EDDARHFHQVCRAALDPHGAAYYPQYKRWCDEYFYLKHRQEMRGVGGVF
HEM6_AERS4      KEWFGGGFDLTPFYPFAE-----DVQHWHRVSRDLCQPFGEDIYPEFKSWCDRYFFLKHRNETRGVGGLF
HEM6_SHEWM      KEWFGGGFDLTPYYPFKE-----DVIEWHQNAHDLCLPFGEEVYPKYKKWCDDYFYLPHRDETRGVGGLF
HEM6_SHEPA      KEWFGGGFDLTPYYPYLE-----DVVEWHQSAKSLCEPFGEEVYPKYKQWCDEYFWLPHRNETRGVGGLF
HEM6_YEAST      NQWFGGGADLTPSY-----LYEEDGQLFHQLHKDALDKHDTALYPRFKKWCDEYFYITHRKETRGIGGIF
HEM6_PROM1      PWWFGGGADLTPFYPYLS-----DTRHFHSCHKNACDTIDKDLHKVFKPWCDEYFFLKHRNETRGVGGIF
HEM6_ECO55      KPWFGGGFDLTPFYGF-----EEDAIHWHRTARDLCLPFGEDVYPRYKKWCDDYFYLKHRNEQRGIGGLF
HEM6_ECOSE      KPWFGGGFDLTPFYGF-----EEDAIHWHRTARDLCLPFGEDVYLRYKKWCDDYFYLKHRNEQRGIGGLF
HEM6_PSEU5      KDWFGGGFDLTPYYGA-----EEDCVHWHRVARDACAPFGAEVYPRYKEWCDRYFHIKHRNEPRGVGGLF
HEM6_POLSJ      PVWFGGGMDLTPYYGF-----DEDAVHFHQTCKDALAPFGGDKYPRFKQWCDEYFYLKHRQEQRGIGGIF
HEM6_KLEP7      KPWFGGGFDLTPYYGF-----EEDAVHWHRTARDLCLPFGEEVYPRYKKWCDDYFYLKHRQEQRGIGGLF
HEM6_PROM9      PWWFGGGADLTPFYPYLS-----DVRNFHKEHKKACEKVDKDLHKVFKPWCDEYFFLKHRNESRGIGGIF
HEM6_SODGM      KPWFGGGFDLTPFYGFHE-----DAVHWHRTAQALCQPFGDTVYPRYKRWCDDYFFLKHRNEARGIGGLF
HEM6_PROMT      PWWFGGGADLTPFYPYLS-----DTRHFHSCHKNACDTIDKDLHKVFKPWCDEYFFLKHRNETRGVGGIF
HEM6_POLNA      PVWFGGGMDLTPFYGF-----DEDAVHFHQVCKDSLKPFGDDKYPRFKQWCDEYFYLKHRQEQRGIGGVF
HEM6_PROMS      PWWFGGGADLTPFYPYLS-----DVRNFHNEHKKACEKVDQDLHKVFKPWCDEYFFLKHRNESRGIGGIF
HEM6_PROMA      PWWFGGGADLTPYYPYLK-----DTRHFHKIHQEACDSINPKLHKVFKPWCDEYFFLKHRNESRGVGGIF
HEM6_BURPS      KFWFGGGMDLTPIYGF-----EEDARHFHRTCRAALEPFGAELYPRFKKWCDDYFFLKHRNEARGIGGIF
HEM6_BURP6      KFWFGGGMDLTPIYGF-----EEDARHFHRTCRAALEPFGAELYPRFKKWCDDYFFLKHRNEARGIGGIF
HEM6_BURP0      KFWFGGGMDLTPIYGF-----EEDARHFHRTCRAALEPFGAELYPRFKKWCDDYFFLKHRNEARGIGGIF
HEM6_BURMS      KFWFGGGMDLTPIYGF-----EEDARHFHRTCRAALEPFGAELYPRFKKWCDDYFFLKHRNEARGIGGIF
HEM6_BURMA      KFWFGGGMDLTPIYGF-----EEDARHFHRTCRAALEPFGAELYPRFKKWCDDYFFLKHRNEARGIGGIF
HEM6_BURM9      KFWFGGGMDLTPIYGF-----EEDARHFHRTCRAALEPFGAELYPRFKKWCDDYFFLKHRNEARGIGGIF
HEM6_BURM7      KFWFGGGMDLTPIYGF-----EEDARHFHRTCRAALEPFGAELYPRFKKWCDDYFFLKHRNEARGIGGIF
HEM6_VARPS      PEWFGGGMDLTPCYGF-----EDDAVHFHTVCRDALAPFGDDKYPRFKTWCDEYFFLKHRNEQRGIGGIF
HEM6_KLEP3      KPWFGGGFDLTPYYGF-----EEDAIHWHRTARDLCLPFGEEVYPRYKKWCDDYFYLKHRQEQRGIGGLF
HEM6_COXBU      KDWFGGGYDLTPYYGF-----EEDCRHWHRVAKKACDRFGEAIYPRFKAACDDYFYLKHRNEPRGIGGLF
HEM6_SHEAM      KEWFGGGFDLTPYY-----PFESDVKEWHQSAKDLCAPFGNEVYPKYKEWCDKYFFLPHRGETRGVGGLF
HEM6_PROM0      PWWFGGGADLTPFYPYLS-----DVRNFHNEHKKACEKVDQDLHKVFKPWCDEYFFLKHRNESRGIGGIF
HEM6_FRATF      ADWFGGGFDLTPYY-----PFEEDAIHWHQTAKNICDKHDKTYYPKFKKWCDEYFYLKHRDEYRGVGGLF
HEM6_COXBR      KDWFGGGYDLTPYYGF-----EEDCRHWHRVAKKACDRFGEAIYPRFKAACDDYFYLKHRNEPRGIGGLF
HEM6_COXBN      KDWFGGGYDLTPYYGF-----EEDCRHWHRVAKKACDRFGEAIYPRFKAACDDYFYLKHRNEPRGIGGLF
HEM6_ERWCT      KPWFGGGFDLTPYYGFKE-----DAVHWHQTAHDLCQPFGDDVYPRYKKWCDDYFFLKHRNEARGIGGLF
HEM6_YERP3      KPWFGGGFDLTPYYGF-----EEDAIHWHQVAHSLCQPFGEQIYPRYKKWCDDYFYIKHRQEARGIGGLF
HEM6_SHEDO      KEWFGGGFDLTPYYPFKE-----DVLSWHQTAADLCAPFGEEVYPKYKKWCDDYFFLPHRNETRGVGGLF
HEM6_NITEC      KEWFGGGMDLTPYYGF-----EEDAIHFHQICKHALQPSGSEYYPRFKKWCDEYFYLKHRKEPRGIGGVF
HEM6_PHOLL      KEWFGGGFDLTPYYGFKE-----DAIHWHTTARNICRPYGEDVYPKYKEWCDNYFYIKHRNEARGIGGLF
HEM6_NITEU      KEWFGGGMDLTPYYGF-----EEDAVHFHQACKDALQPSGEEYYPRFKKWCDEYFYLKHRKEPRGIGGVF
HEM6_SERP5      KPWFGGGFDLTPFYGF-----EEDAVHWHRTAERLCAPFGEQVYPKYKKWCDDYFFIKHRNEARGIGGLF
HEM6_PSEPF      KEWFGGGFDLTPYYGN-----EEDCIHWHRVAEKACAPFGPDVYPRYKAWCDTYFHIKHRHEPRGIGGLF
HEM6_PROM2      PWWFGGGADLTPFYPYLS-----DVRNFHNEHKKACEKVDNDLHKVFKPWCDEYFFLKHRNESRGIGGIF
HEM6_FRATT      ADWFGGGFDLTPYY-----PFEEDAIHWHQTAKNICDKHDKTYYPKFKKWCDEYFYLKHRDECRGVGGLF
HEM6_FRAT1      ADWFGGGFDLTPYY-----PFEEDAIHWHQTAKNICDKHDKTYYPKFKKWCDEYFYLKHRDECRGVGGLF
HEM6_YERPY      KPWFGGGFDLTPYYGF-----EEDAIHWHQVAHSLCQPFGEQIYPRYKKWCDDYFYIKHRQEARGIGGLF
HEM6_YERPS      KPWFGGGFDLTPYYGF-----EEDAIHWHQVAHSLCQPFGEQIYPRYKKWCDDYFYIKHRQEARGIGGLF
HEM6_YERPP      KPWFGGGFDLTPYYGF-----EEDAIHWHQVAHSLCQPFGEQIYPRYKKWCDDYFYIKHRQEARGIGGLF
HEM6_YERPN      KPWFGGGFDLTPYYGF-----EEDAIHWHQVAHSLCQPFGEQIYPRYKKWCDDYFYIKHRQEARGIGGLF
HEM6_YERPG      KPWFGGGFDLTPYYGF-----EEDAIHWHQVAHSLCQPFGEQIYPRYKKWCDDYFYIKHRQEARGIGGLF
HEM6_YERPE      KPWFGGGFDLTPYYGF-----EEDAIHWHQVAHSLCQPFGEQIYPRYKKWCDDYFYIKHRQEARGIGGLF
HEM6_YERPB      KPWFGGGFDLTPYYGF-----EEDAIHWHQVAHSLCQPFGEQIYPRYKKWCDDYFYIKHRQEARGIGGLF
HEM6_YERPA      KPWFGGGFDLTPYYGF-----EEDAIHWHQVAHSLCQPFGEQIYPRYKKWCDDYFYIKHRQEARGIGGLF
HEM6_VIBSL      KEWFGGGFDLTPFY-----PVDEDCQSWHQTAKDLCAPFGDDVYQEHKEWCDKYFYLPHRDETRGVGGLF
HEM6_VIBCH      KEWFGGGFDLTPFYPFVE-----DGQHWHQTAKNICAPFGSEIYNEHKAWCDRYFYLPHRNETRGIGGLF
HEM6_VIBC3      KEWFGGGFDLTPFYPFVE-----DGQHWHQTAKNICAPFGSEIYNEHKAWCDRYFYLPHRNETRGIGGLF
HEM6_PSEAE      KEWFGGGFDLTPYYAH-----EEDCVHWHRVARDACAPFGADVYPRYKEWCDRYFHLKHRNEPRGIGGLF
HEM6_PSEAB      KEWFGGGFDLTPYYAH-----EEDCVHWHRVARDACAPFGADVYPRYKEWCDRYFHLKHRNEPRGIGGLF
HEM6_PSE14      KEWFGGGFDLTPYYG-----VEEDCVHWHRVAERACAPFGDDVYPRYKAWCDSYFHLKHRDEPRGIGGLF
HEM6_PROMP      PWWFGGGADLTPYYPYLT-----DVRNFHKEHCNACEKVNKNLHKVFKPWCDEYFFLKHRNESRGIGGIF
HEM6_FRATM      ADWFGGGFDLTPYY-----PFEEDAIHWHQTAKNICDKHDKTYYPKFKKWCDEYFYLKHRDECRGVGGLF
HEM6_ARATH      APWFGGGTDFTPAY-----IFEEDVKHFHSIQKQACDKFDPSFYPRFKKWCDDYFYIKHRDERRGLGGIF
HEM6_PECCP      KPWFGGGFDLTPYYGFKE-----DAVHWHQTAHDLCQPFGDEVYPRYKKWCDDYFFLKHRNEARGIGGLF
HEM6_FRATW      ADWFGGGFDLTPYY-----PFEEDAIHWHQTAKNICDKHDKTYYPKFKKWCDEYFYLKHRDECRGVGGLF
HEM6_FRATH      ADWFGGGFDLTPYY-----PFEEDAIHWHQTAKNICDKHDKTYYPKFKKWCDEYFYLKHRDEYRGVGGLF
HEM6_STRM5      ASWFGGGFDLTPFY-----PFDEDVQHWHRVARDLCAPFGDERYAAHKRWCDEYFFLRHRNETRGVGGLF
HEM6_PSEA7      KAWFGGGFDLTPYYA-----SEEDCVHWHRVARDACAPFGADVYPRYKEWCDRYFHLKHRNEPRGIGGLF
HEM6_METFK      KPWFGGGMDLTPYYGF-----EEDAVHFHRTCRDAVAPFGEQYYPRFKKECDDYFYLKHRKEARGIGGIF
HEM6_PSEA8      KEWFGGGFDLTPYYAH-----EEDCVHWHRVARDACAPFGADVYPRYKEWCDRYFHLKHRNEPRGIGGLF
HEM6_PHOPR      KEWFGGGFDLTPFY-----PFEEDCQHWHNTAKYLCAPFGDDIYEQHKVWCDKYFFLPHRNETRGVGGLF
HEM6_PSEU2      KEWFGGGFDLTPYYG-----VEEDCVHWHRVAERACAPFGEDVYPRYKAWCDSYFHLKHRDEPRGIGGLF
HEM6_METCA      IWWFGGGFDLTPFY-----PFEEDVIHWHRTARNACLPFGEDVYPRFKRWCDEYFFLNHRNETRGVGGLF
HEM6_DROME      AKWFGGGTDLTPYY-----LCEKDASHFHQTLKSACDEHDPTYYPRFKKWCDDYFRIKHRNESRGIGGIF
HEM6_AERHH      KEWFGGGFDLTPFY-----PFEEDVRHWHQLSRDLCQPFGTDIYPEFKSWCDRYFFLKHRDETRGVGGLF
HEM6_STRMK      ASWFGGGFDLTPFY-----PFDEDVQHWHQVARDLCAPFGDERYAAHKRWCDEYFFLRHRNETRGVGGLF
HEM6_PSESM      KEWFGGGFDLTPYYG-----VEEDCVHWHRVAERACAPFGDDVYPRYKAWCDSYFHLKHRDEPRGIGGLF
HEM6_FRATO      ADWFGGGFDLTPYY-----PFEEDAIHWHQTAKNICDKHDKTYYPKFKKWCDEYFYLKHRNEYRGVGGLF
HEM6_CHRSD      KEWFGGGFDLTPFY-----PVFEDVVHWHRVAQETCAPFGDDVYPRFKRWCDEYFTLHHRDETRGVGGLF
HEM6_VIBCM      KEWFGGGFDLTPFYPFVE-----DCQLWHQTAKNLCAPFGAEIYNEHKAWCDRYFYLPHRNETRGIGGLF
HEM6_PROMM      PWWFGGGADLTPFYPYLE-----DARHFHRVHKQACDTVGPELHKVFKPWCDEYFYLKHRGETRGVGGIF
HEM6_FRATN      IWWFGGGFDLTPYY-----PFEEDAIHWHQTAKNICDKHDKTYYSKFKKWCDEYFYLKHRDECRGVGGLF
HEM6_WIGBR      IWWFGGGFDLTPYYGFYQ-----DVIHWHTIAKKICQPFGDDIYFKYKKWCDDYFFIKHRNESRGIGGLF
HEM6_PSEF5      KEWFGGGFDLTPYYGNI-----DDCVHWHRVAERACAPFGADVYPRYKAWCDSYFHIKHRNEPRGIGGLF
HEM6_XANOR      AAWFGGGFDLTPFY-----PFDEDVQHWHRVAQALCEPFGEERYAAHKRWCDEYFFLRHRNETRGVGGLF
HEM6_XANOP      AAWFGGGFDLTPFY-----PFDEDVQHWHRVAQALCEPFGEERYAAHKRWCDEYFFLRHRNETRGVGGLF
HEM6_XANOM      AAWFGGGFDLTPFY-----PFDEDVQHWHRVAQALCEPFGEERYAAHKRWCDEYFFLRHRNETRGVGGLF
HEM6_XANC5      AAWFGGGFDLTPFY-----PFDEDVQHWHRVAQALCEPFGQERYAAHKRWCDEYFFLRHRNETRGVGGLF
HEM6_YERE8      KPWFGGGFDLTPFYGF-----EEDAIHWHQTAYNLCQPFGEQLYSRYKKWCDDYFYIKHRNEARGIGGLF
HEM6_XANAC      AAWFGGGFDLTPFY-----PFDEDVQHWHRVAQALCVPFGQERYAAHKRWCDEYFFLRHRNETRGVGGLF
HEM6_FRAP2      ADWFGGGFDLTPYY-----PFEEDAIHWHQTAKNICDKHDASYYPSFKKLCDEYFYLKHRDECRGVGGLF
HEM6_VIBVU      KEWFGGGFDLTPFY-----PFEEDCQFWHNTAKEVCAPFGADVYAQHKAWCDDYFYLPHRGETRGIGGLF
HEM6_ORYSJ      APWFGGGTDLTPSY-----IIEEDVKHFHSVQKQACDKFDPSFYPRFKKWCDDYFYIKHRNERRGLGGIF
HEM6_PROM5      PWWFGGGADLTPYYPYLS-----DVRHFHKEHSNACEKVNKKLHLVFKPWCDEYFFLKHRNESRGIGGIF
HEM6_VIBVY      KEWFGGGFDLTPFY-----PFEEDCQFWHNTAKEVCAPFGADVYAQHKAWCDDYFYLPHRGETRGIGGLF
HEM6_VIBHB      KDWFGGGFDLTPFY-----PFDEDCQSWHDTAKQLCAPFGDEVYPEHKAWCDKYFFLPHRNETRGVGGLF
HEM6_PSEMY      KEWFGGGFDLTPYYAN-----EEDCRYWHQVAFDACAPFGAEVYPRFKAWCDRYFHLKHRGEPRGIGGLF
HEM6_LEGPH      KEWFGGGFDLTPYYGFVE-----DCEHWHQTALNACLPFGETIYPKFKRWCDDYFFIKHRNEARGIGGLF
HEM6_LEGPC      KEWFGGGFDLTPYYGFVE-----DCEHWHQTALNACLPFGETIYPKFKRWCDDYFFIKHRNEARGIGGLF
HEM6_ALCBS      KEWFGGGFDLTPYYGF-----EEDVVHWHQTAKVACQPFGKEIYPEFKTWCDDYFYLKHRNEPRGVGGXX
HEM6_LEGPL      KEWFGGGFDLTPYYGFIE-----DCEHWHQTALNACLPFGETIYPKFKRWCDDYFFIKHRNEARGIGGLF
HEM6_RALPJ      RSWFGGGMDLTPYYGFTE-----DASHFHRTCQGALAPYGDELYPRFKQWCDDYFYLKHRKEARGIGGIF
HEM6_VIBPA      KEWFGGGFDLTPFY-----PFEEDCQSWHDTAKAICAPFGEDVYAEHKAWCDKYFFLPHRNETRGVGGLF
HEM6_XANCB      AAWFGGGFDLTPFY-----PVDEDVMHWHRTAQALCAPFGEERYAAHKRWCDEYFFLRHRDETRGVGGLF
HEM6_LEIMA      REWFGGGFDLTPYYA-----VEEDCRDFHQVAQDLCKPFGADVYARFKGWCDEYFFIPYRNEARGIGGLF
HEM6_LEGPA      KEWFGGGFDLTPYYGFVE-----DCEHWHQTALNACLPFGETIYPKFKRWCDDYFFIKHRNEARGIGGLF
HEM6_SOYBN      APWFGGGTDLTPAY-----IFEEDVKHFHSIQKQACDKFEPTFYPRFKKWCDDYFYIKHRGERRGLGGIF
HEM6_XANCP      AAWFGGGFDLTPFY-----PVDEDVMHWHRTAQALCAPFGEERYAAHKRWCDEYFFLRHRNETRGVGGLF
HEM6_XANC8      AAWFGGGFDLTPFY-----PVDEDVMHWHRTAQALCAPFGEERYAAHKRWCDEYFFLRHRNETRGVGGLF
HEM6_TOBAC      APWFGGGTDFTPAY-----IFEEDVKHFHSVQKAACDKFDASFYPRFKKWCVDYFYIKHRDERRGLGGIF
HEM6_SCHPO      NSWFGGGADLTPSI-----LFEEDGKHFHKLHKEACDRHDPTFYPRFKKWADEYFLIKHRKETRGIGGIF
HEM6_PSEFS      KEWFGGGFDLTPYYGN-----EEDCIHWHRVAEQACAPFGPDVYSRYKAWCDTYFHIKHRNEPRGIGGLF
HEM6_RALSO      RPWFGGGMDLTPYYGFAE-----DAAHFHR----TCKQEPFGEYPRFKQWCDDYFYLKHRKEARGVGGIF
HEM6_HORVU      SWWFGGGTDLTPSY-----LIEEDVKHFHSVQKQTCDKFDPSFYPRFKKWCDDYFYIKHRNERRGLGGIF
HEM6_AZOSE      HXWFGGGMDLTPYY-----PYEEDVRNFHRACRLPWGGEP--EYRRLKEWCDRYFFLKHRNEPRXXXXXX
HEM6_MOUSE      HWWFGGGCDLTPTYLNQE-----DAVHFHRTLKEACDQHGPDIYPKFKKWCDDYFFIVHXXXXXXXXXXF
HEM6_RAT        EAWFGGGCDLTPTYLNRE-----DAVHFHRTLKEACDQHGPDIYPKFKKWCDDYFFIAHXXXXXXXXXXF
HEM6_HUMAN      EAWFGGGCDLTPTYLNQE-----DAVHFHRTLKEACDQHGPDLYPKFKKWCDDYFFIAHXXXXXXXXXXF
HEM6_DICDI      DWWFGGGVDLTPVYPKLDQVVE-----FHSTLKKVCDQYGQEEYALGKAECDSYFFLPHRGETRGVGGLF
HEM6_XYLFA      AAWFGGGFDLTPFY-----PFDEDVVHWHTVARDLCAPFGDERYAAHKRWCDEYFVLRHRNETRGVGG--
HEM6_XYLFM      AAWFGGGFDLTPFY-----PFDEDVVHWHRVARDLCAPFGDERYAAHKRWCDEYFVLRHRNETRGVGG--
HEM6_XYLFT      AAWFGGGFDLTPFY-----PFDEDVVHWHTVARDLCAPFGDERYAAHKRWCDEYFVLRHRNETRGVGG--


                         .         .         .         +         .         .         .:280
query           FDWLHPDEEKGGWDANFTFVQDVGRAFNLVYPKIVRANFNQNWTEEDRDEQLIRRGRYVEFNLLYDRGTI
HEM6_AGRT5      FDWLHPDEEKGGWDANFTFVQDVGRAFNLVYPKIVRANFNQNWTEEDRDEQLIRRGRYVEFNLLYDRGTI
HEM6_AGRRK      FDWLHSTEEAGGWDADFAFTRDVGRAFSMVYPRIVRSNFNETWTEEDRDEQLIRRGRYVEFNLLYDRGTI
HEM6_RHILW      YDWLHSNEDAGGWDADFAFTRDVGRAFSMVYPKIVRSNFNKLWTEADRDEQLIRRGRYVEFNLLYDRGTI
HEM6_RHIL3      YDWLHSSEEAGGWDADFAFTRDVGRAFAMVYPKIVRSNFNKLWTEADRDEQLIRRGRYVEFNLLYDRGTI
HEM6_RHIE6      YDWLHSSDETGGWNADFAFTRDVGRAFAMVYPKIVRSNFNKLWTEADRDEQLIRRGRYVEFNLLYDRGTI
HEM6_RHIEC      YDWLHSSEEAGGWNADFAFTRDVGRAFAMVYPKIVRSNFNKLWTEADRDEQLIRRGRYVEFNLLYDRGTI
HEM6_SINMW      YDWLRSDEEIGGWEADFAFTRDVGKAFAIVYPRIVRTNFNMPWTEQDRSEQLVRRGRYVEFNLLYDRGTI
HEM6_RHIME      YDWLRSAEELGGWDADFAFTRDVGKAFALVYPRIVRTNFNKPWTEQDRNEQLVRRGRYVEFNLLYDRGTI
HEM6_OCHA4      YDWLHSPDEKGGWDADFAYTRDVGRGFSVVYPHLVRQNFNKDWTDADRNEQLIRRGRYVEFNLLYDRGTI
HEM6_BRUSU      YDWLHSPEEKGGWDSDFAFTRDVGRGFSVVYPHLVRQNFNKDWTEADRDEQLIRRGRYVEFNLLYDRGTI
HEM6_BRUME      YDWLHSPEEKGGWDSDFAFTRDVGRGFSVVYPHLVRQNFNKDWTEADRDEQLIRRGRYVEFNLLYDRGTI
HEM6_BRUMB      YDWLHSPEEKGGWDSDFAFTRDVGRGFSVVYPHLVRQNFNKDWTEADRDEQLIRRGRYVEFNLLYDRGTI
HEM6_BRUC2      YDWLHSPEEKGGWDSDFAFTRDVGRGFSVVYPHLVRQNFNKDWTEADRDEQLIRRGRYVEFNLLYDRGTI
HEM6_BRUAB      YDWLHSPEEKGGWDSDFAFTRDVGRGFSVVYPHLVRQNFNKDWTEADRDEQLIRRGRYVEFNLLYDRGTI
HEM6_BRUA2      YDWLHSPEEKGGWDSDFAFTRDVGRGFSVVYPHLVRQNFNKDWTEADRDEQLIRRGRYVEFNLLYDRGTI
HEM6_BRUA1      YDWLHSPEEKGGWDSDFAFTRDVGRGFSVVYPHLVRQNFNKDWTEADRDEQLIRRGRYVEFNLLYDRGTI
HEM6_MESSB      YDWLKSPEENGGWDADFAFTQDVGRAFVMVYQHIVRKNFNTNWTEADREEQLIRRGRYVEFNLLYDRGTI
HEM6_AGRVS      FDWLHAGEKFDLWAANFAFVQDVGRQFAAVYPDLVRRNFNTPWTEEDREEQLVRRGRYVEFNLLYDRGTI
HEM6_BRAJA      YDW----HDSGDWDADLAFTQDVGRAFLKIYPDIVRRNFASAWTAADREEQLIRRGRYVEFNLLYDRGTI
HEM6_CAUCR      YD----HHDSGDWARDFAFTQDVGRAFLEIYPTLVRRRMGEAWTADEREQQLIQRGRYVEFNLLYDRGTM
HEM6_CAUCN      YD----HHDSGDWARDFAFTQDVGRAFLEIYPTLVRRRMGEAWTADEREQQLIQRGRYVEFNLLYDRGTM
HEM6_CAUSK      YD----HHDSGDWAKDFAFTQDVGRAFLEIYPTLVRRRMGETWSAEEREQQLVQRGRYVEFNLLYDRGTM
HEM6_RICB8      YDYLN----SGNFEQDFSFTQDVGKALLSVYPEIVRNKLFLPWTDEQKEYQLIRRGRYVEFNLLYDRGTK
HEM6_RICBR      YDYLN----SGNFEQDFSFTQDVGKALLSVYPEIVRNKLFLPWTDEQKEYQLIRRGRYVEFNLLYDRGTK
HEM6_RICFE      YDYLN----SGNFEQDFAFTQDVGRALLSVYPEIVRSKLFLPWTTEQKEYQLIRRGRYVEFNLLYDRGTK
HEM6_RICAH      YDYLN----SGNFEQDFSFTQDVGMALLSVYPEIVRSKLFLPWTAEQKEYQLIRRGRYVEFNLLYDRGTK
HEM6_RICCN      YDYLN----NGNFEQDFAFTQDVGKALLSVYPEIVRSKLFLPWTAEQKEYQLIRRGRYVEFNLLYDRGTK
HEM6_RICRS      YDYLN----NGNFEQDFAFTQDVGKTLLSVYPEIVRSKLFLPWTAEQKEYQLIRRGRYVEFNLLYDRGTK
HEM6_RICRO      YDYLN----NGNFEQDFAFTQDVGKTLLSVYPEIVRSKLFLPWTAEQKEYQLIRRGRYVEFNLLYDRGTK
HEM6_RICPU      YDYLN----NGNFEQDFAFTQDVGKALLSVYPEIVRSKLFLPWTAEQKEYQLIRRGRYVEFNLLYDRGTK
HEM6_RICAE      YDYLN----NGNFEQDFAFTQDVGKALLSVYPEIVRSKLFLPWTAEQKEYQLIRRGRYVEFNLLYDRGTK
HEM6_RICPR      YDYLN----SGNFEQDFAFTKDIGKALLSVYPEIVRSKLFLPWTAEQKEYQLIRRGRYVEFNLLYDRGTK
HEM6_RICTY      YDYLN----SGNFEQDFAFTRDIGKALLSVYPEIVRSKLFLPWTDEQKEYQLIKRGRYVEFNLLYDRGTK
HEM6_GLOVI      FDYV-----QGDWEKIFAFAQSCGNAFLPAYLPIVERRHTLPYAERERNFQLYRRGRYVEFNLVWDRGTI
HEM6_SACD2      FD----DLNELGFDQSFAFMQAVGDSYTQAYVPIVERRKDEPYNQAQRDFQLYRRGRYVEFNLVYDRGTL
HEM6_THISH      FD----DLNEWGFEKSFAFMRSVGDHYLDAYLPIVARRKDTPYGERERDFQLYRRGRYVEFNLVYDRGTL
HEM6_SYNP6      FDYQDPAGQKAAWEKLFAFAQDCGRTFLPAYSPIVERRKDTPWGDRERQFQLYRRGRYVEFNLVYDRGTI
HEM6_SYNSC      YDYLYKGQDPSGWEQLFSLGQANGRAFLPAYAPIVEKRHPMAYGDRERDFQLYRRGRYVEFNLVWDRGTI
HEM61_ANASP     FDYQNPKGEAANWEDLFSFIQGSGKAFLPAYVPIVERRHGMEYGDRQRNFQLYRRGRYVEFNLVYDRGTI
HEM6_ECOSM      FDDLNTPD----FDHCFAFMQAVGKGYTNAYLPIVERRKTMAYGERERNFQLYRRGRYVEFNLVWDRGTL
HEM6_SALSV      FDDLNTPD----FDHCFAFMQAVGNGYTQAYLPIVERRKAMVWGERERNFQLYRRGRYVEFNLVWDRGTL
HEM6_CITK8      FDDLNTPD----FDSCFRFMQAVGKGYTDAFLPIVERRKAMVWGERERHFQLYRRGRYVEFNLVWDRGTL
HEM6_BURCJ      FD----DFSEPGFERSFDLMQSVGDAFLHAYLPIVERRAELPYGERERDFQAYRRGRYVEFNLVFDRGTL
HEM6_BURS3      FD----DFSEPGFERSFDMMQSVGDAFLQAYLPIVERRAELPYGERERDFQAYRRGRYVEFNLVFDRGTL
HEM6_SALTY      FDDLNTPD----FDHCFDFMQAVGNGYTRAYLPIVERRKAMVWGERERNFQLYRRGRYVEFNLVWDRGTL
HEM6_SALHS      FDDLNTPD----FDHCFDFMQAVGNGYTRAYLPIVERRKAMVWGERERNFQLYRRGRYVEFNLVWDRGTL
HEM6_SALEP      FDDLNTPD----FDHCFAFMQAVGNGYTEAYLPIVERRKAMVWGERERNFQLYRRGRYVEFNLVWDRGTL
HEM6_SALPK      FDDLNTPD----FDHCFAFMQAVGNGYTEAYLPIVERRKAMVWGERERNFQLYRRGRYVEFNLVWDRGTL
HEM6_SALPC      FDDLNTPD----FDHCFDFMQAVGNGYTRAYLPIVERRKAMVWGERERNFQLYRRGRYVEFNLVWDRGTL
HEM6_SALPB      FDDLNTPD----FDHCFDFMQAVGNGYTRAYLPIVERRKAMVWGERERNFQLYRRGRYVEFNLVWDRGTL
HEM6_SALPA      FDDLNTPD----FDHCFAFMQAVGNGYTEAYLPIVERRKAMVWGERERNFQLYRRGRYVEFNLVWDRGTL
HEM6_SALNS      FDDLNTPD----FDHCFAFMQAVGNGYTEAYLPIVERRKAMVWGERERNFQLYRRGRYVEFNLVWDRGTL
HEM6_SALG2      FDDLNTPD----FDHCFAFMQAVGNGYTEAYLPIVERRKAMVWGERERNFQLYRRGRYVEFNLVWDRGTL
HEM6_SALDC      FDDLNTPD----FDHCFAFMQAVGNGYTEAYLPIVERRKAMVWGERERNFQLYRRGRYVEFNLVWDRGTL
HEM6_SALCH      FDDLNTPD----FDHCFDFMQAVGNGYTRAYLPIVERRKAMVWGERERNFQLYRRGRYVEFNLVWDRGTL
HEM6_SALA4      FDDLNTPD----FDHCFAFMQAVGNGYTEAYLPIVERRKAMVWGERERNFQLYRRGRYVEFNLVWDRGTL
HEM6_PROMH      FDDLNTPD----FDHCFEFVQHVGQGYLDAYLPIVEKRKSIPWGERERQFQLYRRGRYVEFNLVWDRGTL
HEM6_BURM1      FD----DFSEPGFERSFEMMQSVGDAFLPAYLPIVERRAALPYGERERDFQAYRRGRYVEFNLVFDRGTL
HEM6_SALTI      FDDLNTPD----FDHCFAFMQAVGNGYTEAYLPIVERRKAMVWGERERNFQLYRRGRYVEFNLVWDRGTL
HEM6_PSEPK      FD----DLNEWDFDTCFAFIRAIGDAFVDAYLPIVQRRKNTPYTPQQREFQEYRRGRYVEFNLVYDRGTL
HEM6_ERWT9      FD----DLNAHGFDQSFRFMQAVGRGFCDAYLPIVERRKALTWGERERDFQLYRRGRYVEFNLVWDRGTL
HEM6_SYNS9      YDYLYKGQDPTGWEQLFSLGQANGRAFLPSYAPIVEKRHATSYGDRERDFQLYRRGRYVEFNLVWDRGTI
HEM6_PSEPW      FD----DLNEWGFDTCFAFIRAIGDAYVDAYLPIVQRRKDTPYTAEQREFQEYRRGRYVEFNLVYDRGTL
HEM6_BURCC      FD----DFSEPGFERSFDLMQSVGDAFLHAYLPIVERRAELPYGERERDFQAYRRGRYVEFNLVFDRGTL
HEM6_PSEP1      FD----DLNEWDFDTCFAFIRAIGDAYINAYLPIVQRRKDTPYTPQQREFQEYRRGRYVEFNLVYDRGTL
HEM6_ECOLU      FDDLNTPD----FDHCFAFMQAVGKGYTNAYLPIVERRKAMAYGERERNFQLYRRGRYVEFNLVWDRGTL
HEM6_THEEB      FDYQNPDGEAASWEDLFAFIQSCGQAFLEAYLPIVERRRHLTYGDRERQFQLYRRGRYVEFNLVYDRGTI
HEM6_SYNY3      FDYQDPDPEPLGWEDLFSFAQRCGRAFLPAYSPIVEKRRNTEYGDRQRQFQLYRRGRYVEFNLVYDRGTI
HEM6_ENT38      FDDLNAPD----FDTAFNFMQAVGQGYTDAYLPIVERRRNTDYGVREREFQLYRRGRYVEFNLVWDRGTL
HEM6_SYNPX      YDYLYKGQDPSGWEQLFALGQANGRAFLPSYAPIVEKRHPMAYGDRERQFQLYRRGRYVEFNLVWDRGTI
HEM6_SHEON      FD----DLNQAGFDKSFDFMQAVGNGFLTAYAPIVERRKDTDYGERERDFQLYRRGRYVEFNLVYDRGTL
HEM6_PSEPG      FD----DLNEWDFDTCFAFIRAIGDAYVNAYLPIVQRRKDTPYTPQQREFQEYRRGRYVEFNLVYDRGTL
HEM6_PSEE4      FD----DLNEWDFDTCFAFMRAIGDAYVDAYLPIIQRRKDTPYTAKQREFQEYRRGRYVEFNLVYDRGTL
HEM6_SHEB2      FDDLNQE----GFDQSFSFMQAVGNGFLTAYAPIVERRKDTEFGERERQFQLYRRGRYVEFNLVYDRGTL
HEM6_SALAR      FDDLNTPD----FASCFAFMQAVGKGYTEAYLPIVERRKTMAWGERERSFQLYRRGRYVEFNLVWDRGTL
HEM6_IDILO      FD----DLNDRSFDECFSVIKAVGDAFTKAYLPIVERRKNLAYTQQQRDFQLYRRGRYVEFNLVWDRGTL
HEM6_ECOL6      FDDLNTPD----FDHCFAFMQAVGKGYTDAYLPIVERRKAMAYGERERNFQLYRRGRYVEFNLVWDRGTL
HEM6_ECOL5      FDDLNTPD----FDHCFAFMQAVGKGYTDAYLPIVERRKAMAYGERERNFQLYRRGRYVEFNLVWDRGTL
HEM6_ECOK1      FDDLNTPD----FDHCFAFMQAVGKGYTDAYLPIVERRKAMAYGERERNFQLYRRGRYVEFNLVWDRGTL
HEM6_ECO81      FDDLNTPD----FDHCFAFMQAVGKGYTDAYLPIVERRKAMAYGERERNFQLYRRGRYVEFNLVWDRGTL
HEM6_ECO45      FDDLNTPD----FDHCFAFMQAVGKGYTDAYLPIVERRKAMAYGERERNFQLYRRGRYVEFNLVWDRGTL
HEM6_ECO27      FDDLNTPD----FDHCFAFMQAVGKGYTDAYLPIVERRKAMAYGERERNFQLYRRGRYVEFNLVWDRGTL
HEM6_SHIDS      FDDLNTPD----FDHCFAFMQAVGKGYTDAYLPIVERRKAMAYAERERNFQLYRRGRYVEFNLVWDRGTL
HEM6_SHEB8      FD----DLNQAGFEQSFSFMQAVGNGFLTAYAPIVERRKDTEFGERERQFQLYRRGRYVEFNLVYDRGTL
HEM6_SHEB5      FD----DLNQAGFEQSFSFMQAVGNGFLTAYAPIVERRKDTEFGERERQFQLYRRGRYVEFNLVYDRGTL
HEM6_ESCF3      FDDLNTPD----FDHCFAFMQAVGKGYTDAYLPIVERRKAMEYGEHERNFQLYRRGRYVEFNLVWDRGTL
HEM6_ENTS8      FDDLNTPD----FDTCFAFMQAVGDGYLNAYLPIVERRKTLPWGEREREFQLYRRGRYVEFNLVWDRGTL
HEM6_DECAR      FD----DLNEGGFERCFELTQAVGNAFTKAYLPVLAKRREMPYDERERDFQAYRRGRYVEFNLVWDRGTL
HEM6_BURCM      FD----DFSEPGFERSFEMMQSVGDAFLNAYLPIVERRAALPYGERERDFQAYRRGRYVEFNLVFDRGTL
HEM6_BURA4      FD----DFSEPGFERSFEMMQSVGDAFLNAYLPIVERRAALPYGERERDFQAYRRGRYVEFNLVFDRGTL
HEM6_BORPA      FD----DLNDPGFDASFALTRSVGDSFLPAYLPIVQARRDMPYGERERDFQAYRRGRYVEFNLVFDRGTL
HEM6_BORBR      FD----DLNDPGFDASFALTRSVGDSFLPAYLPIVQARRDMPYGERERDFQAYRRGRYVEFNLVFDRGTL
HEM6_SHESW      FDDLNQD----GFEQSFSFMQAVGNGFLTAYAPIVERRKETEFGERERQFQLYRRGRYVEFNLVYDRGTL
HEM6_SHEPC      FDDLNQD----GFEQSFSFMQAVGNGFLTAYAPIVERRKETEFGERERQFQLYRRGRYVEFNLVYDRGTL
HEM6_ECOLI      FDDLNTPD----FDRCFAFMQAVGKGYTDAYLPIVERRKAMAYGERERNFQLYRRGRYVEFNLVWDRGTL
HEM6_ECOLC      FDDLNTPD----FDRCFAFMQAVGKGYTDAYLPIVERRKAMAYGERERNFQLYRRGRYVEFNLVWDRGTL
HEM6_ECOHS      FDDLNTPD----FDRCFAFMQAVGKGYTDAYLPIVERRKAMAYGERERNFQLYRRGRYVEFNLVWDRGTL
HEM6_ECODH      FDDLNTPD----FDRCFAFMQAVGKGYTDAYLPIVERRKAMAYGERERNFQLYRRGRYVEFNLVWDRGTL
HEM6_ECOBW      FDDLNTPD----FDRCFAFMQAVGKGYTDAYLPIVERRKAMAYGERERNFQLYRRGRYVEFNLVWDRGTL
HEM6_BURPP      FD----DFSAPGFDQSFAMLKSVGDAFLKAYLPIVEKRRNIPYGQAERDFQAYRRGRYVEFNLVFDRGTL
HEM6_SHIFL      FDDLNTPD----FDHCFAFMQAVGKGYTDAYLPIVERRKAMAYGERERNFQLYRRGRYVEFNLVWDRGTL
HEM6_SHIF8      FDDLNTPD----FDHCFAFMQAVGKGYTDAYLPIVERRKAMAYGERERNFQLYRRGRYVEFNLVWDRGTL
HEM6_SHEPW      FD----DLNKQGFDKSFDFMQAVGNGFLTAYAPIVERRKETEYGEHERQFQLYRRGRYVEFNLVYDRGTL
HEM6_ECO7I      FDDLNTPD----FDHCFAFMQAVGKGYTNAYLPIVERRKTMAYGERERNFQLYRRGRYVEFNLVWDRGTL
HEM6_BORPE      FD----DLNEPGFDASFALTCSVGDSFLPAYLPIVQARRDMPYGERERDFQAYRRGRYVEFNLVFDRGTL
HEM6_SHESH      FDDLNQD----GFEKSFEFMQAVGNGFLTSYAPIVERRKDTEYGEKEREFQLYRRGRYVEFNLVYDRGTL
HEM6_SHESA      FD----DLNQAGFDKSFDFMQAVGNGFLTAYAPIVERRKETPYGERERDFQLYRRGRYVEFNLVYDRGTL
HEM6_ECO5E      FDDLNTPD----FDHCFAFMQAVGKGYTDAYLPIVERRKAMAYGERERNFQLYRRGRYVEFNLVWDRGTL
HEM6_ECO57      FDDLNTPD----FDHCFAFMQAVGKGYTDAYLPIVERRKAMAYGERERNFQLYRRGRYVEFNLVWDRGTL
HEM6_SHISS      FDDLNTPD----FDHCFAFMQAVGKGYTDAYLPIVERRKAMAYGERERNFQLYRRGRYVEFNLVWDRGTL
HEM6_SHIBS      FDDLNTPD----FDHCFAFMQAVGKGYTDAYLPIVERRKAMAYGERERNFQLYRRGRYVEFNLVWDRGTL
HEM6_SHIB3      FDDLNTPD----FDHCFAFMQAVGKGYTDAYLPIVERRKAMAYGERERNFQLYRRGRYVEFNLVWDRGTL
HEM6_ECO8A      FDDLNTPD----FDHCFAFMQAVGKGYTDAYLPIVERRKAMAYGERERNFQLYRRGRYVEFNLVWDRGTL
HEM6_ECO24      FDDLNTPD----FDHCFAFMQAVGKGYTDAYLPIVERRKAMAYGERERNFQLYRRGRYVEFNLVWDRGTL
HEM6_BURXL      FD----DFSAPGFDQSFAMLRSVGDAFLKAYLPIIEKRRNIPYGQAERDFQAYRRGRYVEFNLVFDRGTL
HEM6_SHEHH      FD----DLNKQGFDTSFAFMQAVGNGFLTAYAPIVERRKDTVYGEHERQFQLYRRGRYVEFNLVYDRGTL
HEM6_CHRVO      FD----DLNEWGFDKSFAFTRAVGDGYLDAYLPIVARRKEQAWGDRERQFQLYRRGRYVEFNLVWDRGTL
HEM62_ANASP     FDYQDASSQKVGWEDIFAFVQSCGQAFLPAYLPIVERRQGIEYGDRQRNFQLYRRGRYVEFNLVYDRGTV
HEM6_SHESR      FD----DLNQAGFDKSFDFMQAVGNGFLTAYAPIVERRKETPYGEREREFQLYRRGRYVEFNLVYDRGTL
HEM6_SHESM      FD----DLNQAGFDKSFDFMQAVGNGFLTAYAPIVERRKETPYGEREREFQLYRRGRYVEFNLVYDRGTL
HEM6_BORPD      FD----DLNEPGFDASFALLRSVGDAFLPAYLPIVQRRRDTPYTQAQRDFQAYRRGRYVEFNLVFDRGTL
HEM6_AERS4      FD----DLNRWPFADCFAFMQAVGRGYLDAYLPIIERRKAQPYGEREREFQLYRRGRYVEFNLVYDRGTL
HEM6_SHEWM      FDDLNAE----GFDTSFAFMQAVGNGFLTAYAPIVQRRKETQYGEREREFQLYRRGRYVEFNLVYDRGTL
HEM6_SHEPA      FD----DLNKQGFEQSFAFMQAVGNGFLTAYAPIVERRRDTEYGEHERQFQLYRRGRYVEFNLVYDRGTL
HEM6_YEAST      FD----DYDERDPQEILKMVEDCFDAFLPSYLTIVKRRKDMPYTKEEQQWQAIRRGRYVEFNLIYDRGTQ
HEM6_PROM1      YDYLYKGQNANGWENLFSLAKACGQAFLPSYEPIIKKRKNQSFSTKERDFQLYRRGRYAEFNLVWDRGTI
HEM6_ECO55      VDDLNTPD----FDHCFAFMQAVGKGYTDAYLPIVERRKAMAYGERERNFQLYRRGRYVEFNLVWDRGTL
HEM6_ECOSE      FDDLNTPD----FDHCFAFMQAVGKGYTDAYLPIVERRKAMAYGERERNFQLYRRGRYVEFNLVWDRGTL
HEM6_PSEU5      FD----DLNQWDFDTSFAFMRAVGDAYLQAYLPIVQRRKATPFGERERQFQLLRRGRYVEYNLVYDRGTL
HEM6_POLSJ      FD----DFQELGLEQSFAMMQSVADSFLPAYLPIVRRRQSQPYGARERDFQLYRRGRYVEFNLVWDRGTH
HEM6_KLEP7      FDDLNTPD----FDHCFAFMQAVGNGYADAYLPIVERRKATPYGERERHFQLYRRGRYVEFNLVWDRGTL
HEM6_PROM9      YDYIYRGNNQNGWDNLFSLAENCGQAFLPSYLPIIEKRANKTYTSKEREFQLYRRGRYVEFNLVWDRGTI
HEM6_SODGM      FD----DLSAPNFNEAFAFCRAVSQGYLDAYLPIVERRKSHPWGERERQFQLYRRGRYVEFNLVWDRGTL
HEM6_PROMT      YDYLYKGQNANGWENLFSLAKACGQAFLPSYEPIIKKRKNQSFSTKERDFQLYRRGRYAEFNLVWDRGTI
HEM6_POLNA      FD----DFQELGLAQSFAMMQSVGDSFLQAYLPIVERRKDSLFGERERDFQLYRRGRYVEFNLVWDRGTH
HEM6_PROMS      YDYIYRGNNKNGWDNLFSLAENCGQAFLPSYLPIIEKRASQKYSPKEREFQLYRRGRYVEFNLVWDRGTI
HEM6_PROMA      FDYQNPNEYKLSWEDLFSLAKACGNAFLPSYIPIIEKRHNQTFSDRERNFQLYRRGRYVEFNLVWDRGTI
HEM6_BURPS      FD----DFSELGFERSFEMLQSVGDAFLPSYLPIVERRRDTPYGERERAFQAYRRGRYVEFNLVFDRGTL
HEM6_BURP6      FD----DFSELGFERSFEMLQSVGDAFLPSYLPIVERRRDTPYGERERAFQAYRRGRYVEFNLVFDRGTL
HEM6_BURP0      FD----DFSELGFERSFEMLQSVGDAFLPSYLPIVERRRDTPYGERERAFQAYRRGRYVEFNLVFDRGTL
HEM6_BURMS      FD----DFSELGFERSFEMLQSVGDAFLPSYLPIVERRRDTPYGERERAFQAYRRGRYVEFNLVFDRGTL
HEM6_BURMA      FD----DFSELGFERSFEMLQSVGDAFLPSYLPIVERRRDTPYGERERAFQAYRRGRYVEFNLVFDRGTL
HEM6_BURM9      FD----DFSELGFERSFEMLQSVGDAFLPSYLPIVERRRDTPYGERERAFQAYRRGRYVEFNLVFDRGTL
HEM6_BURM7      FD----DFSELGFERSFEMLQSVGDAFLPSYLPIVERRRDTPYGERERAFQAYRRGRYVEFNLVFDRGTL
HEM6_VARPS      FD----DFAEGGFDNGFALLRSVGNAFLPAYLPIIERRRAMPWGERERAFQLYRRGRYVEFNLVWDRGTH
HEM6_KLEP3      FDDLNTPD----FDHCFAFMQAVGNGYADAYLPIVERRKAMPYGERERHFQLYRRGRYVEFNLVWDRGTL
HEM6_COXBU      FDDLNEWEFK----RCFEFIKILGDSFLEAYLPIMQNRKNHPYGERQREFQLYRRGRYVEFNLLYDRGTR
HEM6_SHEAM      FDDLNHWE----FDKCFDYMQAVGNGFLTAYAPIVERRKDTAYGERERDFQLYRRGRYVEFNLVYDRGTL
HEM6_PROM0      YDYYRGNNQKGNWDDLFSLAENCGQAFLPSYLPIIEKRASQAYSSKEREFQLYRRGRYVEFNLVWDRGTI
HEM6_FRATF      FD----DLNDKSFDECFNFVTDCANSYLDAYIPIVAQRKNIEYSQKHKDFQLYRRGRYVEFNLVFDRGTI
HEM6_COXBR      FDDLNEWEFK----RCFEFIKILGDSFLEAYLPIMQNRKNHPYGERQREFQLYRRGRYVEFNLLYDRGTR
HEM6_COXBN      FDDLNEWEFK----RCFEFIKILGDSFLEAYLPIMQNRKNHPYGERQREFQLYRRGRYVEFNLLYDRGTR
HEM6_ERWCT      FDDLNEPD----FATSFAFIRAVGNGFLDGYLPIVERRKDLAWGERERDFQLYRRGRYVEFNLIWDRGTL
HEM6_YERP3      FDDLNSPD----FMTCFNFTQAVGDGFLAAYMPIVARRKALGWGDRERQFQLYRRGRYVEFNLVWDRGTL
HEM6_SHEDO      FD----DLNQAGFEQSFAFMRAVGEGFIQAYAPIVERRKALSFGEHERQFQLYRRGRYVEFNLVYDRGTL
HEM6_NITEC      FDDLNQPD----FVTCFNLTKSVGDQFLAAYVPILQKRCNLPYGERERDFQAYRRGRYVEFNLVWDRGTL
HEM6_PHOLL      YDDLNTPD----FEHCFNFTQDIGKGFLSAYLPIVEKRKEILWGERERQFQLYRRGRYVEFNLVWDRGTL
HEM6_NITEU      FDDLNQPD----FATCFNLTRSVGDHFLAAYVPILQKRRDLPYGERERDFQAYRRGRYVEFNLVWDRGTL
HEM6_SERP5      FDDLNTPD----FATCFAFTQAVGEGFLEAYLPIVEKRKTLSWGDHERQFQLYRRGRYVEFNLVWDRGTL
HEM6_PSEPF      FD----DLNEWDFDTSFAFMRAIGDAYIDAYLPIVQRRKNDAFTAXXXXXXXXXXGRYVEFNLVYDRGTL
HEM6_PROM2      YDYIYRGNNQNGWDNLFSLAENCGQAFLPSYLPIIEKRASQTYSSREREFQLYRRGRYVEFNLVWDRGTI
HEM6_FRATT      FD----DLNDKSFDECFNFVTDCANSYLDAYIPIVAQRKNIEYSQKHKDFQLYRRGRYVEFNLVFDRGTI
HEM6_FRAT1      FD----DLNDKSFDECFNFVTDCANSYLDAYIPIVAQRKNIEYSQKHKDFQLYRRGRYVEFNLVFDRGTI
HEM6_YERPY      FDDLNSPD----FMTCFNFTQAVGDGFLAAYMPIVARRKALGWGDRERQFQLYRRGRYVEF