[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for atum0:AAK88177.1

[Show Plain Result]


## Summary of Sequence Search
    1::411
  277::450     9e-07  31%  707 aa  BRE1_NEUCR RecName: Full=E3 ubiquitin-protein ligase bre-1;        
  184::407     3e-06  22%  793 aa  ATK1_ARATH RecName: Full=Kinesin-1;AltName: Full=Kinesin-like
  260::471     1e-05  23%  610 aa  CCD93_XENTR RecName: Full=Coiled-coil domain-containing protein 93;
 1059::1243    1e-05  24% 2009 aa  CROCC_MOUSE RecName: Full=Rootletin;AltName: Full=Ciliary rootlet
  208::491     2e-05  25%  692 aa  MYS_PODCA RecName: Full=Myosin heavy chain;Flags: Fragment;
  136::326     5e-05  34%  857 aa  MEDB_GIALA RecName: Full=Median body protein;
  308::495     5e-05  24%  564 aa  ICR3_ARATH RecName: Full=Interactor of constitutive active ROPs 3;
   90::181     1e-04  39%  504 aa  MYOC_HUMAN RecName: Full=Myocilin;AltName: Full=Trabecular
  681::873     1e-04  26% 1411 aa  UACA_MOUSE RecName: Full=Uveal autoantigen with coiled-coil domains
 1131::1340    1e-04  31% 2057 aa  MYSN_DROME RecName: Full=Myosin heavy chain, non-muscle;AltName:
  727::938     1e-04  23% 1463 aa  KIF15_STRPU RecName: Full=Kinesin-like protein KIF15;AltName:
  782::962     1e-04  33% 1395 aa  AGLZ_MYXXD RecName: Full=Adventurous-gliding motility protein Z;
  242::453     2e-04  22%  654 aa  SAS6_MOUSE RecName: Full=Spindle assembly abnormal protein 6
 1123::1298    2e-04  23% 1972 aa  MYH11_MOUSE RecName: Full=Myosin-11;AltName: Full=Myosin heavy chain
  152::243     2e-04  26% 1641 aa  CTTB2_SHEEP RecName: Full=Cortactin-binding protein 2;       
  206::460     2e-04  27%  817 aa  BRE1_USTMA RecName: Full=E3 ubiquitin-protein ligase BRE1;       
  469::572     3e-04  25%  728 aa  P85B_HUMAN RecName: Full=Phosphatidylinositol 3-kinase regulatory
 1123::1298    3e-04  23% 1972 aa  MYH11_HUMAN RecName: Full=Myosin-11;AltName: Full=Myosin heavy chain
   46::285     3e-04  26%  788 aa  GRIP_ARATH RecName: Full=Protein GRIP;         Short=AtGRIP;
  566::757     3e-04  26% 1216 aa  FKB15_MOUSE RecName: Full=FK506-binding protein 15;AltName:
  332::538     4e-04  25%  875 aa  Y066_NPVOP RecName: Full=Uncharacterized 98.6 kDa protein;
  124::191     4e-04  35%  341 aa  PEX14_YEAST RecName: Full=Peroxisomal membrane protein
  152::243     5e-04  25% 1642 aa  CTTB2_MUNRE RecName: Full=Cortactin-binding protein 2;       
  152::243     5e-04  25% 1642 aa  CTTB2_MUNMU RecName: Full=Cortactin-binding protein 2;       
   99::152     5e-04  37%  247 aa  ATPF_SORC5 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
 1308::1532    7e-04  19% 2363 aa  TPR_HUMAN RecName: Full=Nucleoprotein TPR;
  436::632     7e-04  21% 1208 aa  PCP1_SCHPO RecName: Full=Spindle pole body protein pcp1;
  465::568     7e-04  24%  724 aa  P85B_BOVIN RecName: Full=Phosphatidylinositol 3-kinase regulatory
  299::417     7e-04  25%  944 aa  NUF1_YEAST RecName: Full=Protein NUF1;AltName: Full=Spindle poly
   97::166     7e-04  31%  490 aa  MYOC_RABIT RecName: Full=Myocilin;AltName: Full=Trabecular
 1425::1524    7e-04  23% 1938 aa  MYH13_HUMAN RecName: Full=Myosin-13;AltName: Full=Myosin heavy chain
  302::455     7e-04  25% 1224 aa  DCTN1_CHICK RecName: Full=Dynactin subunit 1;AltName: Full=150 kDa
  218::369     7e-04  29%  741 aa  BSG2_DROME RecName: Full=Blastoderm-specific protein 25D;
 1563::1765    9e-04  27% 1790 aa  USO1_YEAST RecName: Full=Intracellular protein transport protein
  653::851     9e-04  20%  979 aa  RAI14_MOUSE RecName: Full=Ankycorbin;AltName: Full=Ankyrin repeat
   85::284     9e-04  23%  388 aa  MRP4_STRPY RecName: Full=Fibrinogen- and Ig-binding
  354::493     9e-04  32% 1068 aa  HIP1R_HUMAN RecName: Full=Huntingtin-interacting protein 1-related
  150::243     9e-04  24% 1663 aa  CTTB2_RHIFE RecName: Full=Cortactin-binding protein 2;       
  325::439     9e-04  30% 1251 aa  CING_XENTR RecName: Full=Cingulin;
    1::411

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxIHRRIVAYTENRIRATMPISPQEVRAQKDMARALYAAENAKVRQE
BRE1_NEUCR      ---------------------------------------------------------------------E
ATK1_ARATH      ----------------------------------------------KEARVAAEKVQASLGEELDKVKEE
CCD93_XENTR     ----------------------------------------------EEGRLTASTVGQIVGLQSKEIKQM
CROCC_MOUSE     --------------------------------------------------SEKQQALSLKESEKTALSEK
MYS_PODCA       -------------------------------------------------KAQRD-ARG-YSTELLKVRTA
MEDB_GIALA      ---------------------------RELQEFSENPAAAVEEI--MQLKAQIDELKYGASNHNALVQEK
ICR3_ARATH      ---------------------------------------------------------SLRRGESNEMDEE
MYOC_HUMAN      ----------------------------------------------------------------------
UACA_MOUSE      -------------------------------------------------------AQHIRPEEHEQLRSR
MYSN_DROME      ----------------------------------------------QQQRQESDRSKRKIETEVADLKEQ
KIF15_STRPU     ------------------------------------------PAMSEEGIIDEEMPEHVIEQCNEALTIE
AGLZ_MYXXD      ------------------------------LAETRGELEATSQTLQQTHAALEDTRGALQETSDTLAH--
SAS6_MOUSE      -------------------------LHQRNIHQLQSRL-SELEAANKELTERKDSTVRELKAKLAGVEEE
MYH11_MOUSE     ------------------------------------------------------------------LQED
CTTB2_SHEEP     ----------------------------------------------------------------------
BRE1_USTMA      -------------------------VEHEYVRYQSNLLRATKPTIPATIVSASEPAPATEQTADTAVKKE
P85B_HUMAN      ----------------------------------------------------------------------
MYH11_HUMAN     ------------------------------------------------------------------LQED
GRIP_ARATH      -----------------------------------------------ELRLENDFLRSQFEGLKDEVAQG
FKB15_MOUSE     ---------------------------QRIIQENE-RLKQELLEKSSRIEEQNDKISDLIERNQRYVEQS
Y066_NPVOP      ------------------------------------------------------------SAELAQLHAE
PEX14_YEAST     ----------------------------------------------------------------------
CTTB2_MUNRE     ----------------------------------------------------------------------
CTTB2_MUNMU     ----------------------------------------------------------------------
ATPF_SORC5      ----------------------------------------------------------------------
TPR_HUMAN       ----------------------------------------------QEANAELSEKSGMLQAEKKLLEED
PCP1_SCHPO      --------------------------------------------------------------ERDVLESK
P85B_BOVIN      ----------------------------------------------------------------------
NUF1_YEAST      ----------------------------------------------------------------------
MYOC_RABIT      ----------------------------------------------------------------------
MYH13_HUMAN     ----------------------------------------------------------------------
DCTN1_CHICK     ----------------------------------------------------------------------
BSG2_DROME      ---------------------------------------------------QSNMLRALQATELGNYRLA
USO1_YEAST      --------------------------------------------SEKDIEELKSKLRAKSGSELETVKQE
RAI14_MOUSE     ----------------------------------------------REAQAELEDYRKRKSLEDAA---E
MRP4_STRPY      ----------------------------------------------QTISEQSRKIAALKSEAELKNQQA
HIP1R_HUMAN     ----------------------------------------------------------------------
CTTB2_RHIFE     ----------------------------------------------------------------------
CING_XENTR      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           LDTEREKNTSLRLANEAASSDAYRLGEQNRSFSLKIEELTLEIGELRAALDASEERAGTIXXXXXXXXXX
BRE1_NEUCR      IKTLQEENASFKIKKEGISEEDYARTDVFKQFKAQNEDLIKRINNLEAVNKQFREDAEKLRAERTSYRAT
ATK1_ARATH      KMAAKQKVTSLE--------DMYRLQEYNTSLQQYNSKLQTDLETVRAALTRAEKEKSSILENLSTLRGH
CCD93_XENTR     VSEYAEKQSELSAEDRAEYLGA---AQQHRR---KVASLSKLIGQRKKLLDQLQEKASELQSGCGETR--
CROCC_MOUSE     LMGTRHSLAAISLEMERQKRDAQSRQEQDRN---TLNALTSELRDLRAQLEATAAHAQTVKELEERTGNL
MYS_PODCA       SEDTIEKYDALKKENRALSAELQSVTEQGGKNSAEVEKLRRKLGMXXXXXXXXXXXXXXXXXXXXGKLLK
MEDB_GIALA      RDLERHL-ADLRLSRQDTNS-----------------RLPQEIDRLRAEIEDEKRNLPHMXXXXXXXXXX
ICR3_ARATH      VSSLRCEVERLRAALEASDKKDQE-GNVEASSRLRIQELKIEIDELKARLMDKETELQFISEERDNFSMK
MYOC_HUMAN      ----------------------------------------------------------------------
UACA_MOUSE      LEQKSKKVSELTLKNQTLQKDVEKLHADNKLLNQQVHSLTVEMKTRYVPLRVSEEMKRS-----------
MYSN_DROME      LNERRVQ------VDEMQAQLAKREEELTQTL-LRIDEESATKATAQKAQRELESQLAEIQEDLXXXXXX
KIF15_STRPU     LQKLQDKNANLQQQLEEHESQKHKMLQNSSKLDHQLQQITELYSTESQAWQEHEKDLTT-----------
AGLZ_MYXXD      --TTRERDQRIELADLGAAKDALE------------QELTGQIGHLRSELS---ETQGNYEAERAAHEKL
SAS6_MOUSE      LQRAKQEVLSLRRENCTLDTECHEKEKHINQLQTKVAVLEQEIKDKDQLVLRTKEAFDTI----------
MYH11_MOUSE     LDSERA-------ARNKAEKQKRDLGEELEALKTELED-TLDSTATQQELRAKREQEVTVLKKALDEETR
CTTB2_SHEEP     ----------------------------------------------------------------------
BRE1_USTMA      TPTDGAPHTSETLQKESARQDVELTRRESDSRYAEIQTLNEEVRTLKCKLHETQTKLTTLPEEVLLS---
P85B_HUMAN      ----------------------------------------------------------------------
MYH11_HUMAN     LDSERA-------ARNKAEKQKRDLGEELEALKTELED-TLDSTATQQELRAKREQEVTVLKKALDEETR
GRIP_ARATH      RSLQKAEQV------EADSAQLKQLQEQVASLSREIDEQALELREAYSEADASQEYSSKFSQVEQKLDQE
FKB15_MOUSE     NLMMEKRNNSLQTATENTQARILHAEQEKAKVTEELAAATAQVSHLQLKMTAHQKKE-------------
Y066_NPVOP      MRALRTVTADLQGMRDSAEQRLQAANARYEAADAKSRELDQQLVRLRPLAAQSE----TLRFEKSELATE
PEX14_YEAST     ----------------------------------------------------------------------
CTTB2_MUNRE     ----------------------------------------------------------------------
CTTB2_MUNMU     ----------------------------------------------------------------------
ATPF_SORC5      ----------------------------------------------------------------------
TPR_HUMAN       VKRWKARNQHLVSQQKDPDTEEYRLLSEKEVHTKRIQQLTEEIGRLKAEIARSNNNQNLIQSLKEDLNKV
PCP1_SCHPO      LQTLEDDNNSLRLMTSSLGNQIESLRTQNREIDEEKNHLRLALAETNIRLQEVTKELETLRMKNSNDLNE
P85B_BOVIN      ----------------------------------------------------------------------
NUF1_YEAST      ----------------------------------------------------------------------
MYOC_RABIT      ----------------------------------------------------------------------
MYH13_HUMAN     ----------------------------------------------------------------------
DCTN1_CHICK     ------------LDKEMAEERAESLQQEVDSLKEKVEYLTMDLEILKHEIEEKGSDGAA-----------
BSG2_DROME      YRQQHEENLKLRADNKAANQ--------------RVALLAVEVDERHASLEDNSKK---------QVQQL
USO1_YEAST      LNNAQEKNTVLKSKLEDIERELKDKQAEIKSNQEEKELLTSRLKELEQELDSTQQKAQKSEEERRAEVRK
RAI14_MOUSE     YIHKAEHERLMHVSNLSRAKSEEALSEMKSQYSKVLNELT----QLKQLVDAHKENSVSITEHLQVITTL
MRP4_STRPY      LEALNNKNKQISLTNENAAIEGYVQTIQNASREIAAKQQ--ELAAAKSQLEAKNAEIEALKQQDASKTEE
HIP1R_HUMAN     ---------------------------------LQIESLKREVEMLRSELEKIKLEA-------------
CTTB2_RHIFE     ----------------------------------------------------------------------
CING_XENTR      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           XXXRASQMSDLTARLTNLTRELDDSKITAATRDLEAEQAKQTASRFRKEGETATRELQDVAARNKEAMTA
BRE1_NEUCR      LEQEAQALSDLEDQIQQ--KDQDLTRIRSARDELLAELAMRKAS--QEQEKTASAHLNELV----EAMT-
ATK1_ARATH      SKSLQDQLSSLLSEVTNLRNELXXXXXXXXXXXXXSQKLSEEIRKYQENVGKSSQELDILTAKSGSLEET
CCD93_XENTR     -----KQLTEVTSHMEKLDQELSDPSVLQKLRDLVAESLKAQEQQFRSKCREEMSRLQQNIDGLKAAATE
CROCC_MOUSE     GRQREACMREAEELRTQL-RVLEDTRDGLRRELLEAQ-------RKGRDSQDSSEAHRQEASELRRSLSE
MYS_PODCA       VQLEYTQLRQSSDRLSEKDEELEQRQMESLQNTIDSERSKAEQQKLRKKYDADMMELES----QLESSNR
MEDB_GIALA      XXXRRGNTSGVMAEIENIQRQIDDANSSASSRMLRAEAQKSIVTRLEAENADLRRELQDIRGRAQEMSAS
ICR3_ARATH      LMKNQKEI-DVEAELKKLREAIENLKADLMDKETELQIVSDENETLKSDIHKSETDVQDAFLKLGIAMEE
MYOC_HUMAN      ------------ARLSSLESLLHQLTLDQAARPQETQEGLQTLRRERDQLETQTRELE----------TA
UACA_MOUSE      ---HDVNVEDLNKKLSEATQRYAEKKQEA--ERLLAENDKLTKNVSRLEAEKHEKELMGLKSNIAELKKQ
MYSN_DROME      XXXXXXXXXDLSEELEALKNELLDSDTTAAQQELRSKREQELATLKKSEEETVNHELADMRHKHSQELNS
KIF15_STRPU     ------RLAEATIQISTLQREAEDFKVMLQAADKEIGQEKKQKSKVTQDWDRVRAALDAQVVRLENEMCG
AGLZ_MYXXD      AAESSAHIGDLTSERDGLRSELE-----ATSQTLEQTHGQLAATR-------------DALAREQHAH--
SAS6_MOUSE      ------QEQKVALEENGEKNQIQLGKLEATIKSLSAELLKANEIIKKLQGD-----LKTLMGKLKLKNTV
MYH11_MOUSE     S--HEAQVQEMRQKHTQAVEELTE----------QLEQFKRAKANLDKSKQTLEKENADLAGELRVLGQA
CTTB2_SHEEP     -----------------------EHKKLAARLEEERGKNKHVVLMLVKECKQLSGKVLEEAQKLEEVMAK
BRE1_USTMA      ----SALYRELQTLLRNAQQDLQSSKEAMQALETEATALREDRAAFQQEAEAASRDLEKLIKAKEADVTR
P85B_HUMAN      ---RTSQ--ELQMKRTAIEAFNETIKIFEEQGQTQEKCSKEYLERFRREGNE--KEMQRILLNSERLKSR
MYH11_HUMAN     S--HEAQVQEMRQKHAQAVEELTE----------QLEQFKRAKANLDKNKQTLEKENADLAGELRVLGQA
GRIP_ARATH      IKERDEKYADLDAKFTRLHKRAKQQEIQKEKDDLDAREVNETAERASSQHSSMQQELERTRQQANEALKA
FKB15_MOUSE     --------TELQLQLTDNLKETDRGHVTRLQADLSEEASEQTQTKFKSEKQSR-RQLE------------
Y066_NPVOP      NERLRGEIAALNASANGLAGAETVSRLTASLADAQAQLTARTAEQAQKDNEYATKTQQDYVAKLNAEREA
PEX14_YEAST     -------LPEAKSKLEGDKKEIDDSKIDTVLNAIEAEQAE-----FRKKESETLKELSDTIAELKQALVQ
CTTB2_MUNRE     -----------------------EHKKLAARLEEERGKNKHVVLMLVKECKQLSGKVLEEAQKLEEVMAK
CTTB2_MUNMU     -----------------------EHKKLAARLEEERGKNKHVVLMLVKECKQLSGKVLEEAQKLEEVMAK
ATPF_SORC5      ---------------------------------------KPIAEALKKRKQTITQELDNASRLKQEAELR
TPR_HUMAN       RTEKETIQKDLDAKIIDIQEKVKGRRYKTQYEELKAQQDKVMETSAQSSGDVSVQEMQELKETLNQAETK
PCP1_SCHPO      IHDLREENEGLTLKIDSITKEKDELEQRIKSYEVNVSELNGTIDEYR-------NKLKDKEETYNEVMNA
P85B_BOVIN      ---RTSQ--ELQMKRTAIEAFNETIKIFEEQGQTQEKCSKEYLERFRREGNE--KEMQRILLNSERLKSR
NUF1_YEAST      --------------LRKRTNELNELKIKSDEMDLQLKQKQNESKRLKDELNELETKFSENGSQSSAKENE
MYOC_RABIT      ---------------------------------------QEIQEELQKELGTLRRERDQLESQTRELEAA
MYH13_HUMAN     ----------LQGEVEDLMRDLERSHTACATLDKKQRNFDKVLAEWKQKLDESQAELEAAQKESRSLSTE
DCTN1_CHICK     SSYQVKQLEEQNARL---------KEALVRMRDLSASE-KQEHVKLQKQMEKKNTELESLRQQREKLQEE
BSG2_DROME      EQRHASMVREITLRMTN-----DRDHWTSMTGKLEAQSLEQEEIRLRTELELVRTENTELESEQQKAHIQ
USO1_YEAST      FQVEKSQLDEKAMLLETKYNDLVN-KEQAWKRD--EDTVKKTTDSQRQEIEKLAKELDNLKAENSKLKEA
RAI14_MOUSE     RTTAKEKISALTGHLANKEAEVAKLEKQLAEEKAAVSDAMVPKSSYEKLQASLESEVNALATKLKESVRE
MRP4_STRPY      IAKLQSEAATLENLLGSAKRELTELQAKLDTATAEKAKLESQVTTLENLLGSAKRELTDLQAKLDAANAE
HIP1R_HUMAN     ----QRYIAQLKSQVNALEGELEEQRKQKQKALVDNEQLRHELAQLRAEGERS-QGLREEAERKASATEA
CTTB2_RHIFE     --------------------ELEHKKLAARLEE-ERGKNKHVVLMLVKECKQLSGRVIEEAQKLEDVMAK
CING_XENTR      -----SQKKELERKVAELQRQLDDEM--KQRMKLESSQGRPKAGMQREESKEECSRLKDLYDKKKNELNA


                         .         .         .         +         .         .         .:280
query           VARESRKVTRLEEQLATLMAKNADLDTMLTLRNQDVARLREQLAATGGRSNDMIIRLPNPAVPVEKXXXX
BRE1_NEUCR      -----DRVTQLESELERLVAKAAPTDDLSTLSAEE---LREKFA--------------------------
ATK1_ARATH      CSLQKERLNMLEQQLAIANERQKMADASVSLTRTEFEEQKHLLCELQDRLADM-----------------
CCD93_XENTR     HGEEKEQTQAFEQQYKAEREKLQKIRLLLARRNREIAILQRKIDEVPSRA--------------------
CROCC_MOUSE     GAKEREALRRSNEELRSAVKKAESERISLKLANED-----------------------------------
MYS_PODCA       VAAESQK------QMKKLQAQIKELQSMIDDESRGRDDMRDSASRSERRANDLAVQLDEARVALEQAERA
MEDB_GIALA      QRYSANQAQELQEK--------------------------------------------------------
ICR3_ARATH      ADKSSKKAVRVTEQLEATQASNSEMETEL-----------------------------------------
MYOC_HUMAN      YSNLLRDKSVLEEEKKRLRQENENLARRLESSSQEVARLR------------------------------
UACA_MOUSE      LSELNKKCGEGQEKIRALMSENSSLKK--TLSSQYVAKTHEEVKAS------------------------
MYSN_DROME      INDQLENLTVLEKAKGTLEAENADLATELRSVNQENDRRRKQ----------------------------
KIF15_STRPU     QSRELENLTEDREQLQTLQAREADLENRLKGKKAEITQLQEEI---------------------------
AGLZ_MYXXD      --QESRKATTLEGQLAEARAHGEDLGEHLTLTKHEL----------------------------------
SAS6_MOUSE      TIQQEKLLAEKEEMLQKERKESQDAGQFLRAKEQEVCRLQEQLETT------------------------
MYH11_MOUSE     KQEVEHKKKKLEVQLQDLQSKCSDGERARAELSDKVHKLQNEVESVTGMLNE------------------
CTTB2_SHEEP     LEEEKKKTSALEEELATEKRRSAEMEAQMEKQLSEFDTEREQLRA-------------------------
BRE1_USTMA      LSREQVKFTQIEEMKALLNSK----EERLILLSSQVRRLRMAVAAFHGQS--------------------
P85B_HUMAN      IAEIHESRTKLEQQLRAQASDNREIDKRMNSLKPDLMQLRK-----------------------------
MYH11_HUMAN     KQEVEHKKKKLEAQVQELQSKCSDGERARAELNDKVHKLQNEVESVTGMLNE------------------
GRIP_ARATH      MDAERQQLDTIEELRGSLQPKENKIETLLLDKDQILEDLKKQLQAVEERKQIAVTEL-------------
FKB15_MOUSE     -----LKVTSLEEELTDLRAEKTSLEKNLSERKKKSAQERCQAEA-------------------------
Y066_NPVOP      YERNLRKEDGLGATIQRLQEENAELRSTLDNRNREFAQGSDQFAAVNMQLNE------------------
PEX14_YEAST     TTRSREKI--------------------------------------------------------------
CTTB2_MUNRE     LEEEKKKTSALEEELATEKRRSTEMEAQMEKQLSEFDTEREQLRA-------------------------
CTTB2_MUNMU     LEEEKKKTSALEEELATEKRRSTEMEAQMEKQLSEFDTEREQLRA-------------------------
ATPF_SORC5      LEEYEDKLTRLEETLAELKAEHA-----------------------------------------------
TPR_HUMAN       SKSLESQVENLQKTLSEKETEARNLQEQTVQLQSELSRLRQDL---------------------------
PCP1_SCHPO      FQYKDNDLRRFHESINKLQDREKELTSNLEKKNLVISSLRETVA--------------------------
P85B_BOVIN      IAEIHESRTKLEQELRAQASDNREIDKRMNSLKPDLMQLRK-----------------------------
NUF1_YEAST      LKMLKNKIAELEEELASLMAQLTQLESKLNQRDSQLGSREEELKKTNDK---------------------
MYOC_RABIT      YSNLLRDKSALEEEKRRLMQENEDLARRLESSSQEVARL-------------------------------
MYH13_HUMAN     LFKMRNAYEEVVDQLETLRRENKNL-------QEEISDLTEQIAETG-----------------------
DCTN1_CHICK     VKQAEKTVDELKEQVDAALGAEEMVET-LTERNLDLEEKVRELRETVG----------------------
BSG2_DROME      ITELLEQNIKLNQELA------------------------------------------------------
USO1_YEAST      NEDRSELVTDLDEKNAKYRSKLKDL---------------------------------------------
RAI14_MOUSE     REKAHSEVAQVRSEVSQARREKDNIQTLLKAKEQEVTAL-------------------------------
MRP4_STRPY      KEKLQSQAATLEKQLEATKKELADLQAKLAATN-------------------------------------
HIP1R_HUMAN     RYNKLKKHSELVHVHAELLRKNADTAKQLTVTQQEVARVKEQLA--------------------------
CTTB2_RHIFE     LDEEKKKTSALEEELSTEKRRSTDMEAQMEKQLSEFDTEREQLRA-------------------------
CING_XENTR      VSQELMEVRMGKEQVET---KLRAMEDKLMDSKEELSHLR----AKGGTSPDKL----------------


                         .         *         .         .         .         .         +:350
query           XXXXXXXXXXXXXXXXVVEDEVTEAMAAEDTVVSPVVERAAPAKEGLEQEIEDIRNQGTALTERxxxxxx
BRE1_NEUCR      ----------------------------------------------------------------------
ATK1_ARATH      ----------------------------------------------------------------------
CCD93_XENTR     ----------------------------------------------------------------------
CROCC_MOUSE     ----------------------------------------------------------------------
MYS_PODCA       RKLAENEKSEN-------SDRVAELQALYNNVANA---KAEGDYHSLQEEIEDLENEAKASEDK------
MEDB_GIALA      ----------------------------------------------------------------------
ICR3_ARATH      ----------------------------------------------------------------------
MYOC_HUMAN      ----------------------------------------------------------------------
UACA_MOUSE      ----------------------------------------------------------------------
MYSN_DROME      ----------------------------------------------------------------------
KIF15_STRPU     ----------------------------------------------------------------------
AGLZ_MYXXD      ----------------------------------------------------------------------
SAS6_MOUSE      ----------------------------------------------------------------------
MYH11_MOUSE     ----------------------------------------------------------------------
CTTB2_SHEEP     ----------------------------------------------------------------------
BRE1_USTMA      ----------------------------------------------------------------------
P85B_HUMAN      ----------------------------------------------------------------------
MYH11_HUMAN     ----------------------------------------------------------------------
GRIP_ARATH      ----------------------------------------------------------------------
FKB15_MOUSE     ----------------------------------------------------------------------
Y066_NPVOP      ----------------------------------------------------------------------
PEX14_YEAST     ----------------------------------------------------------------------
CTTB2_MUNRE     ----------------------------------------------------------------------
CTTB2_MUNMU     ----------------------------------------------------------------------
ATPF_SORC5      ----------------------------------------------------------------------
TPR_HUMAN       ----------------------------------------------------------------------
PCP1_SCHPO      ----------------------------------------------------------------------
P85B_BOVIN      ----------------------------------------------------------------------
NUF1_YEAST      ----------------------------------------------------------------------
MYOC_RABIT      ----------------------------------------------------------------------
MYH13_HUMAN     ----------------------------------------------------------------------
DCTN1_CHICK     ----------------------------------------------------------------------
BSG2_DROME      ----------------------------------------------------------------------
USO1_YEAST      ----------------------------------------------------------------------
RAI14_MOUSE     ----------------------------------------------------------------------
MRP4_STRPY      ----------------------------------------------------------------------
HIP1R_HUMAN     ----------------------------------------------------------------------
CTTB2_RHIFE     ----------------------------------------------------------------------
CING_XENTR      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
BRE1_NEUCR      -------------------------------------------------------------
ATK1_ARATH      -------------------------------------------------------------
CCD93_XENTR     -------------------------------------------------------------
CROCC_MOUSE     -------------------------------------------------------------
MYS_PODCA       -------------------------------------------------------------
MEDB_GIALA      -------------------------------------------------------------
ICR3_ARATH      -------------------------------------------------------------
MYOC_HUMAN      -------------------------------------------------------------
UACA_MOUSE      -------------------------------------------------------------
MYSN_DROME      -------------------------------------------------------------
KIF15_STRPU     -------------------------------------------------------------
AGLZ_MYXXD      -------------------------------------------------------------
SAS6_MOUSE      -------------------------------------------------------------
MYH11_MOUSE     -------------------------------------------------------------
CTTB2_SHEEP     -------------------------------------------------------------
BRE1_USTMA      -------------------------------------------------------------
P85B_HUMAN      -------------------------------------------------------------
MYH11_HUMAN     -------------------------------------------------------------
GRIP_ARATH      -------------------------------------------------------------
FKB15_MOUSE     -------------------------------------------------------------
Y066_NPVOP      -------------------------------------------------------------
PEX14_YEAST     -------------------------------------------------------------
CTTB2_MUNRE     -------------------------------------------------------------
CTTB2_MUNMU     -------------------------------------------------------------
ATPF_SORC5      -------------------------------------------------------------
TPR_HUMAN       -------------------------------------------------------------
PCP1_SCHPO      -------------------------------------------------------------
P85B_BOVIN      -------------------------------------------------------------
NUF1_YEAST      -------------------------------------------------------------
MYOC_RABIT      -------------------------------------------------------------
MYH13_HUMAN     -------------------------------------------------------------
DCTN1_CHICK     -------------------------------------------------------------
BSG2_DROME      -------------------------------------------------------------
USO1_YEAST      -------------------------------------------------------------
RAI14_MOUSE     -------------------------------------------------------------
MRP4_STRPY      -------------------------------------------------------------
HIP1R_HUMAN     -------------------------------------------------------------
CTTB2_RHIFE     -------------------------------------------------------------
CING_XENTR      -------------------------------------------------------------