[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for atum0:AAK88218.2

[Show Plain Result]


## Summary of Sequence Search
    1::281
    5::251     3e-08  30%  253 aa  YBHP_SHIFL RecName: Full=Uncharacterized protein ybhP;
    5::251     3e-08  30%  253 aa  YBHP_ECOLI RecName: Full=Uncharacterized protein ybhP;
    5::251     3e-08  30%  253 aa  YBHP_ECOL6 RecName: Full=Uncharacterized protein ybhP;
    5::251     3e-08  30%  253 aa  YBHP_ECO57 RecName: Full=Uncharacterized protein ybhP;
    1::281

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTKDHSFPVIASYNVHKCVGRDRKFDPDRTS
YBHP_SHIFL      ----------------------------------------TQQFSFKVL-TINIHKFTAFNRRFILPELR
YBHP_ECOLI      ----------------------------------------TQQFSFKVL-TINIHKFTAFNRRFILPELR
YBHP_ECOL6      ----------------------------------------TQQFSFKVL-TINIHKFTAFNRRFILPELR
YBHP_ECO57      ----------------------------------------TQQFSFKVL-TINIHKFTAFNRRFILPELR


                         .         .         *         .         .         .         .:140
query           RVIQEIGADIIALQEADSRFGERTGLLDLARLERESGLVPVPVQAGVKAHGWHGNVVLFREGAVRDVHTL
YBHP_SHIFL      DAVRTVSADIVCLQEVMGAHEVHPNWPDTSHYEFLADTMWSDFAYGRNAEGHHGNAVLSRYPIEHENRDV
YBHP_ECOLI      DAVRTVSADIVCLQEVMGAHEVHPNWPDTSHYEFLADTMWSDFAYGRNAEGHHGNAVLSRYPIEHENRDV
YBHP_ECOL6      DAVRTVSADIVCLQEVMGAHEVHPNWPDTSHYEFLADTMWSDFAYGRNAEGHHGNAVLSRYPIEHENRDV
YBHP_ECO57      DAVRTVSADIVCLQEVMGAHEVHPNWPDTSHYEFLADTMWSDFAYGRNAEGHHGNAVLSRYPIEHENRDV


                         +         .         .         .         .         *         .:210
query           KLPGLEPRGALVVELDLKSGGTLRVIAAHFGLLRHSRAQQAKALVGLLEARNECATILMGDLNEWRLGNG
YBHP_SHIFL      SVDGAEKRGVLYCRIPPMTGKAIHVMCVHLGLREHRQAQLAMLAEWVNELPDGEPVLVAGDFNDWRQKAN
YBHP_ECOLI      SVDGAEKRGVLYCRIPPMTGKAIHVMCVHLGLREHRQAQLAMLAEWVNELPDGEPVLVAGDFNDWRQKAN
YBHP_ECOL6      SVDGAEKRGVLYCRIPPMTGKAIHVMCVHLGLREHRQAQLAMLAEWVNELPDGEPVLVAGDFNDWRQKAN
YBHP_ECO57      SVDGAEKRGVLYCRIPPMTGKAIHVMCVHLGLREHRQAQLAMLAEWVNELPDGEPVLVAGDFNDWRQKAN


                         .         .         .         +         .         .         .:280
query           SSLNTFRDAFGTLPPAVPSFPSNLPVLALDRIIANREGLIEQVEAHDSALARIASDHLPLKAAIxxxxxx
YBHP_SHIFL      HPLKVFTRAHGR--PA-RTFPVQFPLLRLDRIYV-KNASASAPTALPLRTWRHLSDHAPLSAEI------
YBHP_ECOLI      HPLKVFTRAHGR--PA-RTFPVQFPLLRLDRIYV-KNASASAPTALPLRTWRHLSDHAPLSAEI------
YBHP_ECOL6      HPLKVFTRAHGR--PA-RTFPVQFPLLRLDRIYV-KNASASAPTALPLRTWRHLSDHAPLSAEI------
YBHP_ECO57      HPLKVFTRAHGR--PA-RTFPVQFPLLRLDRIYV-KNASASAPTALPLRTWRHLSDHAPLSAEI------


                         .         *         .         .         .         .         +:350
query           x
YBHP_SHIFL      -
YBHP_ECOLI      -
YBHP_ECOL6      -
YBHP_ECO57      -