[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for atum0:AAK88284.1

[Show Plain Result]


## Summary of Sequence Search
    1::427
   14::395     3e-41  31%  428 aa  ORDL_RHIME RecName: Full=Probable oxidoreductase ordL;       
   37::418     6e-41  33%  426 aa  PUUB_ECOLI RecName: Full=Gamma-glutamylputrescine oxidoreductase;  
   42::426     8e-40  30%  431 aa  ORDL_HAEIN RecName: Full=Probable oxidoreductase ordL;       
   37::267     4e-08  25%  866 aa  M2GD_HUMAN RecName: Full=Dimethylglycine dehydrogenase,
   54::260     1e-07  27%  857 aa  M2GD_RAT RecName: Full=Dimethylglycine dehydrogenase,
   54::260     7e-07  26%  869 aa  M2GD_MOUSE RecName: Full=Dimethylglycine dehydrogenase,
  331::440     4e-06  34%  647 aa  MNMC_METFK RecName: Full=tRNA 5-methylaminomethyl-2-thiouridine
   68::354     1e-05  21%  369 aa  GLOX_BACSU RecName: Full=Glycine oxidase;         EC=1.4.3.19;
   88::406     1e-05  24%  416 aa  DADA_AGRRK RecName: Full=D-amino acid dehydrogenase small subunit; 
  121::411     2e-05  25%  433 aa  DADA_PARDP RecName: Full=D-amino acid dehydrogenase small subunit; 
  282::472     3e-05  29%  674 aa  MNMC_THICR RecName: Full=tRNA 5-methylaminomethyl-2-thiouridine
  127::257     3e-05  30%  436 aa  DADA_RHOS1 RecName: Full=D-amino acid dehydrogenase small subunit; 
  121::371     1e-04  27%  416 aa  DADA_SPHWW RecName: Full=D-amino acid dehydrogenase small subunit; 
  127::257     1e-04  29%  436 aa  DADA_RHOS4 RecName: Full=D-amino acid dehydrogenase small subunit; 
   89::413     2e-04  24%  418 aa  DADA_NEIMB RecName: Full=D-amino acid dehydrogenase small subunit; 
   89::413     2e-04  24%  418 aa  DADA_NEIMA RecName: Full=D-amino acid dehydrogenase small subunit; 
  121::404     2e-04  25%  416 aa  DADA_BRUSU RecName: Full=D-amino acid dehydrogenase small subunit; 
  121::404     2e-04  25%  416 aa  DADA_BRUSI RecName: Full=D-amino acid dehydrogenase small subunit; 
  121::404     2e-04  25%  416 aa  DADA_BRUO2 RecName: Full=D-amino acid dehydrogenase small subunit; 
  121::404     2e-04  25%  416 aa  DADA_BRUME RecName: Full=D-amino acid dehydrogenase small subunit; 
  121::404     2e-04  25%  416 aa  DADA_BRUMB RecName: Full=D-amino acid dehydrogenase small subunit; 
  121::404     2e-04  25%  416 aa  DADA_BRUC2 RecName: Full=D-amino acid dehydrogenase small subunit; 
  121::404     2e-04  25%  416 aa  DADA_BRUAB RecName: Full=D-amino acid dehydrogenase small subunit; 
  121::404     2e-04  25%  416 aa  DADA_BRUA2 RecName: Full=D-amino acid dehydrogenase small subunit; 
  121::404     2e-04  25%  416 aa  DADA_BRUA1 RecName: Full=D-amino acid dehydrogenase small subunit; 
   30::87      2e-04  33%  612 aa  GLPO_STRP8 RecName: Full=Alpha-glycerophosphate oxidase;       
   30::87      2e-04  33%  612 aa  GLPO_STRP6 RecName: Full=Alpha-glycerophosphate oxidase;       
   30::87      2e-04  33%  612 aa  GLPO_STRP3 RecName: Full=Alpha-glycerophosphate oxidase;       
   30::87      2e-04  33%  612 aa  GLPO_STRP1 RecName: Full=Alpha-glycerophosphate oxidase;       
  131::405     2e-04  23%  417 aa  DADA_VIBSL RecName: Full=D-amino acid dehydrogenase small subunit; 
   89::413     2e-04  25%  418 aa  DADA_NEIM0 RecName: Full=D-amino acid dehydrogenase small subunit; 
  110::414     2e-04  26%  419 aa  DADA_METRJ RecName: Full=D-amino acid dehydrogenase small subunit; 
   89::413     4e-04  24%  418 aa  DADA_NEIMF RecName: Full=D-amino acid dehydrogenase small subunit; 
  110::411     4e-04  29%  421 aa  DADA_METS4 RecName: Full=D-amino acid dehydrogenase small subunit; 
  255::446     7e-04  30%  635 aa  MNMC_AZOSB RecName: Full=tRNA 5-methylaminomethyl-2-thiouridine
  167::236     0.001  32%  384 aa  MNMA_BURP8 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
  320::412     0.001  36%  421 aa  DADA_METNO RecName: Full=D-amino acid dehydrogenase small subunit; 
  119::413     0.001  24%  418 aa  DADA_GRABC RecName: Full=D-amino acid dehydrogenase small subunit; 
    1::427

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxWEKTAPQPPVTPALQXXXXXXXXXXXXXFTGQSAALHLAEGGLDVILLEAKEIGFGGAGR
ORDL_RHIME      ----------YEATIPERPVFPIMPGSRKADVAIIGGGYTGLQAACNLARSGTDVTLIDACRFGDGASGR
PUUB_ECOLI      --------------------------------------YTGLSSALHLAEAGFDVVVLEASRIGFGASGR
ORDL_HAEIN      --------------------------------------FFGLSAALELAEKGKKVIVLEGARVGFGASGR
M2GD_HUMAN      ----------------KPPLSAETQWKDRAETVIIGGGCVGVSLAYHLAKAGMDVVLLEKSELTAGSTWH
M2GD_RAT        ----------------------------------------GVSLAYHLAKAGMDVVLLEKSELTAGSTWH
M2GD_MOUSE      ----------------------------------------GVSLAYHLAKAGMDVVLMEKSELTAGSTWH
MNMC_METFK      ----------------------------------------------------------------------
GLOX_BACSU      ----------------------------------------------------------------------
DADA_AGRRK      ----------------------------------------------------------------------
DADA_PARDP      ----------------------------------------------------------------------
MNMC_THICR      ----------------------------------------GATVAYQLASQGLSVTVLEQKAVAQQASGN
DADA_RHOS1      ----------------------------------------------------------------------
DADA_SPHWW      ----------------------------------------------------------------------
DADA_RHOS4      ----------------------------------------------------------------------
DADA_NEIMB      ----------------------------------------------------------------------
DADA_NEIMA      ----------------------------------------------------------------------
DADA_BRUSU      ----------------------------------------------------------------------
DADA_BRUSI      ----------------------------------------------------------------------
DADA_BRUO2      ----------------------------------------------------------------------
DADA_BRUME      ----------------------------------------------------------------------
DADA_BRUMB      ----------------------------------------------------------------------
DADA_BRUC2      ----------------------------------------------------------------------
DADA_BRUAB      ----------------------------------------------------------------------
DADA_BRUA2      ----------------------------------------------------------------------
DADA_BRUA1      ----------------------------------------------------------------------
GLPO_STRP8      ---------------------------------------TGAGVALQAAASGLDTGLIEMQDFAQGTSSR
GLPO_STRP6      ---------------------------------------TGAGVALQAAASGLDTGLIEMQDFAEGTSSR
GLPO_STRP3      ---------------------------------------TGAGVALQAAASGLDTGLIEMQDFAQGTSSR
GLPO_STRP1      ---------------------------------------TGAGVALQAAASGLDTGLIEMQDFAQGTSSR
DADA_VIBSL      ----------------------------------------------------------------------
DADA_NEIM0      ----------------------------------------------------------------------
DADA_METRJ      ----------------------------------------------------------------------
DADA_NEIMF      ----------------------------------------------------------------------
DADA_METS4      ----------------------------------------------------------------------
MNMC_AZOSB      ----------------------------------------GTSIAERLAARGWQVELLDAASPAQGASGN
MNMA_BURP8      ----------------------------------------------------------------------
DADA_METNO      ----------------------------------------------------------------------
DADA_GRABC      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           NVGLINGGMWVMPKELPDVLGETYGERLLDLLGDAPVLVRELVEKHGIPCEIEKNGTLHCAVGEKGLAEI
ORDL_RHIME      NGGQFGTGQRVWADETEEVLGREWAQRLFDMAENAKRYVLGFAEEHAIDIEFMPG---QLSVGHKASLEY
PUUB_ECOLI      NGGLVNS----YSRDI-DVIEKSYGMDTARMLGEGGEIIRERIKRYQIDCDYRPGG-LFVAMNDKQLATL
ORDL_HAEIN      SGGQAINGFEEGIDEYIKQVGEDKAHKLWNMSLETIDIIDERIEKYSIQCDWKK-GYATLALNERRMDDL
M2GD_HUMAN      AAGLTT---YFHP-----------GINLKKIHYDSIKLYEKLEEETGQVVGFHQPGSIRLATTPVRVDEF
M2GD_RAT        AAGLTT---YFHP-----------GINLKKIHYDSIKLYERLEEETGQVVGFHQPGSIRLATTPERVDEF
M2GD_MOUSE      AAGLTT---YFHP-----------GINLKKIHYDSIKLYERLEEETGQVVGFHQPGSIRLATTPVRVDEF
MNMC_METFK      -------------------------------------------------------GMLQLAFDQREL---
GLOX_BACSU      -----------------------HSQRLYKGLGE------ELYALSGVDIRQHNGGMFKLAFSEEDVLQL
DADA_AGRRK      ---------WLV-KMLSNCTSERYASRMLRLADYSRIALAEVRAGTGIAYDQRMQGTLQLFRTEQQLDAS
DADA_PARDP      ----------------------------------------ELRAETGIRYDERTQGTLQVFRKQQQLDAA
MNMC_THICR      LAGAIH----------PLVTADWNVRSQFYLKGFECSLLRPWFDSHSIVGQ--QNGLMQLAMTETMLQRL
DADA_RHOS1      ----------------------------------------------GLAFDERQQGTLQLFRSQKQLDAA
DADA_SPHWW      ----------------------------------------ELRQETGIRYDERSQGTLQLFRREKDLAGV
DADA_RHOS4      ----------------------------------------------GLAFDERQQGTLQLFRSQKQLDAA
DADA_NEIMB      --------LWQMLQNCTAAHYQTNKERMVRISEYSREMFRRFEAQTGMNFEGRKKGTLQIFRQTKEVEAA
DADA_NEIMA      --------LWQMLQHCTAARYQINKERMVRMSEYSREMFRRFEAQTGMNFEGRKKGTLQIFRQTKEVEAA
DADA_BRUSU      ----------------------------------------ELRKDTGIEYDQRSQGTLQLFREQYQLDGI
DADA_BRUSI      ----------------------------------------ELRKDTGIEYDQRSQGTLQLFREQYQLDGI
DADA_BRUO2      ----------------------------------------ELRKDTGIEYDQRSQGTLQLFREQYQLDGI
DADA_BRUME      ----------------------------------------ELRKDTGIEYDQRSQGTLQLFREQYQLDGI
DADA_BRUMB      ----------------------------------------ELRKDTGIEYDQRSQGTLQLFREQYQLDGI
DADA_BRUC2      ----------------------------------------ELRKDTGIEYDQRSQGTLQLFREQYQLDGI
DADA_BRUAB      ----------------------------------------ELRKDTGIEYDQRSQGTLQLFREQYQLDGI
DADA_BRUA2      ----------------------------------------ELRKDTGIEYDQRSQGTLQLFREQYQLDGI
DADA_BRUA1      ----------------------------------------ELRKDTGIEYDQRSQGTLQLFREQYQLDGI
GLPO_STRP8      STKLVHGGLRYLKQFDVEVVSDTVSER-------------------------------------------
GLPO_STRP6      STKLVHGGLRYLKQFDVEVVSDTVSER-------------------------------------------
GLPO_STRP3      STKLVHGGLRYLKQFDVEVVSDTVSER-------------------------------------------
GLPO_STRP1      STKLVHGGLRYLKQFDVEVVSDTVSER-------------------------------------------
DADA_VIBSL      --------------------------------------------------EGRQKGTLQVFRSEKQLDAI
DADA_NEIM0      --------LWQMLQNCTAAHYQTNKERMVRISEYSREMFRRFEAQTGMNFEERKKGTLQIFRQTKEVEAA
DADA_METRJ      --------------------------RLAEYSRDA---LRDLRTETGIAYDHREKGTLQLFRTRKQLDHV
DADA_NEIMF      --------LWRMLQNCTAAHYQTNKERMVRISEYSREMFRRFEAQTGMNFEERKKGTLQIFRQTKEVEAA
DADA_METS4      --------------------------RLAEFSRDA---LRDLRGETGIAYDHREKGTLQLFRTRKQLDHV
MNMC_AZOSB      HAGVL--------RPLPSLDDNRMGRRAGTLYGWRHI---QRLQAAGLPLRAEACGVLHLARDAAQEAKM
MNMA_BURP8      -------------------------------LGDIPTKVREIAEQIGLPNAKKKDSTGICFIGERPFRDF
DADA_METNO      ----------------------------------------------------------------------
DADA_GRABC      --------------------------------------LRDLRDETGIAYDNRERGTLQLFRTQKQMDHT


                         +         .         .         .         .         *         .:210
query           RERCEQWSARGAPVRVLDADETASYIGSTAYSGALLDSRAGTIQPLAYVRGLAGAALKAGVRLHTASPVN
ORDL_RHIME      RNHVEAMTGRGYPLSFMDREETVSRLGSSHYHFGIRDTGTGHIHPMKLVVGLARQAALAGANLYEGTKAL
PUUB_ECOLI      EEQKENWERYGKQLELLDANAIRREVASDRYTGALLDHSGGHIHPLNLAIGEADAIRLNGGRVYELSAVT
ORDL_HAEIN      IEM-EKESHKNQNMQLWDKTKLKQHLGSDIYVGGLFDSNSGHLHPLNYCLGLAKACVDLGVQIFEQSPVV
M2GD_HUMAN      KYQMTRTGWHATEQYLIEPEEMFPLLNMNKVLAGLYNPGDGHIDPYSLTMALAAGARKCGALLKYPAPVT
M2GD_RAT        KYQMTRTNWHATEQYIIEPEELFPLLNMDKILAGLYNPGDGHIDPYSLTMALATGARKYGVLLKYPAPVT
M2GD_MOUSE      KYQMTRTNWHATEQYIIEPEELFPLLNMNKILAGLYNPGDGHIDPYSLTMALAAGARKYGALLKYPAPVT
MNMC_METFK      -ERCQTIAAQGFPPELLDQEQAGNIAGIALQYGALYFPEAGWVRPRAYCEALAG---HANITRTLATRVT
GLOX_BACSU      RQMDDSWYSKEEVL------EKEPYASGDIFGASFIQDDVH-VEPYFVCKAYVKAAKMLGAEIFEHTPVL
DADA_AGRRK      AKDVKALAADGIPYEVLDRDEPALSHARDKIVGGLLTPKDETGDCFKFTNALAAKAVELGVQFLYGRTIK
DADA_PARDP      GKDIEVLRADGVPFEVLDRDGCVAAEPGLAGSGGLRLPGDETGDCFLFTNRLAEMATEAGVTFRWGVSIE
MNMC_THICR      QEALTRVGLPKSFAYWCDADQASDLIGQKTDHEGLFFPEAGWVQPTSVVTQCLAIALKQEEAVVSIQPVP
DADA_RHOS1      ARDIEVLRAGGVPFELLDADEPGLRAARDRIAGGLRLTGDETGDCFKFTQGLAGLAEEGGVRFRYGTGVE
DADA_SPHWW      AKDIEVLKADGVPFELLDAAEPGLANSASPIAGGLRLPNDETGDCFKFTNALAELAKAEGVRFVLGRRID
DADA_RHOS4      ARDIEVLRAGGVPFELLDADEPGLRAARDRIAGGLRLTGDETGDCFKFTQGLAGLAEEGGVRFRYGTGVE
DADA_NEIMB      KQDIAVLERYGVPYRRLKPEECAEFEPALAIAGGLHLPADATGDCRLFTENLYKLCQEKGVRFHFNQNIS
DADA_NEIMA      KQDIAVLERYGVPYRRLKPEECAEFEPALAIAGGLHLPADATGDCRLFTENLYKLCQEKGVRFHFNQTIS
DADA_BRUSU      GKDIEVLRQDGVPFEVLDRDEPALAHAKDKFVGGLRLPNDETGDCFKFTNALAKIAEGLGVKFRFGVNIK
DADA_BRUSI      GKDIEVLRQDGVPFEVLDRDEPALAHAKDKFVGGLRLPNDETGDCFKFTNALAKIAEGLGVKFRFGVNIK
DADA_BRUO2      GKDIEVLRQDGVPFEVLDRDEPALAHAKDKFVGGLRLPNDETGDCFKFTNALAKIAEGLGVKFRFGVNIK
DADA_BRUME      GKDIEVLRQDGVPFEVLDRDEPALAHAKDKFVGGLRLPNDETGDCFKFTNALAKIAEGLGVKFRFGVNIK
DADA_BRUMB      GKDIEVLRQDGVPFEVLDRDEPALAHAKDKFVGGLRLPNDETGDCFKFTNALAKIAEGLGVKFRFGVNIK
DADA_BRUC2      GKDIEVLRQDGVPFEVLDRDEPALAHAKDKFVGGLRLPNDETGDCFKFTNALAKIAEGLGVKFRFGVNIK
DADA_BRUAB      GKDIEVLRQDGVPFEVLDRDEPALAHAKDKFVGGLRLPNDETGDCFKFTNALAKIAEGLGVKFRFGVNIK
DADA_BRUA2      GKDIEVLRQDGVPFEVLDRDEPALAHAKDKFVGGLRLPNDETGDCFKFTNALAKIAEGLGVKFRFGVNIK
DADA_BRUA1      GKDIEVLRQDGVPFEVLDRDEPALAHAKDKFVGGLRLPNDETGDCFKFTNALAKIAEGLGVKFRFGVNIK
GLPO_STRP8      ----------------------------------------------------------------------
GLPO_STRP6      ----------------------------------------------------------------------
GLPO_STRP3      ----------------------------------------------------------------------
GLPO_STRP1      ----------------------------------------------------------------------
DADA_VIBSL      QQDMKLLTESGIEHSLFDVDQCLSVESGLALVGGLYLPHDETGDCHQFCLTLTEKAKQLGVRVFDTEVVS
DADA_NEIM0      EQDIAVLERYGVPYRRLKPEECAEFVTAKIASGLHLPADA-TGDCRLFTENLYKLCQEKGVRFHFNQTIS
DADA_METRJ      GDDTRVLDAYGVPYTVLDAAEPALAAVRDVFVGGLRLPGDETGDAHLFTQRLAALCESLGVTFRYGTAIA
DADA_NEIMF      EQDIAVLERYGVPYRRLKPEECAEFEPALAIAGGLHLPADATGDCHLFTENLYKLCQEKGVQFHFNQTIS
DADA_METS4      GDDTRVLDAYGVAYEVLDAEPALARVRDTFVGGLRLPGDE-TGDAHLFTQRLAALCADRGVRFRFGVAVH
MNMC_AZOSB      RAVVERLALPPAHLRFVSAAEASEIGGWPVPLGGWWFGDSGWVQP----PSLCAANLSAGIRAHWNARVT
MNMA_BURP8      LNR--YLPTRPGPMKTTDGKTVGEHIGLAFYT--------------------------------------
DADA_METNO      ----------------------------------------------------------------------
DADA_GRABC      ADDIAVLKSYGVAYEVLDAAEPGLQWAQVPLVGGLRLPGDETGDAHLFTRELARICMERGVSFLFGTQIH


                         .         .         .         +         .         .         .:280
query           ETGRNGAKWVVKTPEGSVTAKWIVVATEAYSTGPWQIIREEQVYLPYFNFATRPLSDNLQKSILPGRQGC
ORDL_RHIME      KIEKKGGAVVIETTSGTITADRALIACNGYIGNLEPVTASHVMPIRSFIGATTVLHGHPE--ILPGGESV
PUUB_ECOLI      QI-QHTTPAVVRTAKGQVTAKYVIVAGNAYLGDKVEELAKRSMPCGTQVITTERLSEDLARSLIPKNYCV
ORDL_HAEIN      DMVEKNGCVEVKTAKSAVISQDVILATNAYDVLPKSIINRKILPVESFIIATEPLSQAVADSVINNGMSV
M2GD_HUMAN      SLARSDGTWDVETPQGSMRANRIVNAAGFWAREVGKMIGLEHPLIP------------------------
M2GD_RAT        SLKRPDGTWDVETPQGSVRANRIVNAAGFWAREVGKMIGLDHPLIP------------------------
M2GD_MOUSE      SLKRPDGTWDVETPQGSVRANRIVNAAGFWAREVGKMIGLDHPLIP------------------------
MNMC_METFK      GLSQHGNAWQVWTGEQLLDEADIVVIANA-----------------------------------------
GLOX_BACSU      HVERDGEALFIKTPSGDVWANHVVVASGVWSGMFFKQLGLNNAFLPVKGECLSVWNDDIPLTKTLYHDHC
DADA_AGRRK      DLQVEGGQRGVVTDQGAIASDAVVVALGSYSP---LLLKQVGISLPVYPVKGYSLTIPIVDPARSPESTV
DADA_PARDP      ALEAEGGRSAVRTDKGRLTADRYVLAMGSYSP---RMVRHLGLKLPVYPLKGYSLTIDIQDESRAPVSTV
MNMC_THICR      D--QNSQDWQIMTPNSTYQADVVVVATGA-----------------------------------------
DADA_RHOS1      RLRVEGGRVTVETTKGTFLADAVVVALGSYS---------------------------------------
DADA_SPHWW      AIVASGNRIAVRTDRGDISGDAYLVAXXXXXXXPVYPVKGYSITVPIVDPARAPVSTLLDESFKVAITRL
DADA_RHOS4      RLRVEGGRVTVETTKGTFLADAVVVALGSHS---------------------------------------
DADA_NEIMB      RIDHNGLRKTVETETGRFEADAVVCALGCFSRTPIYPVKGYSLTLPVTNSDGAPVSTVLDESY-------
DADA_NEIMA      RIDHNGLRKTVETETGRFEADAVVCALGCFSRTPIYPVKGYSLTLPVTNSDGAPVSTVLDESY-------
DADA_BRUSU      SLLMSGGKISVETSEGIVTAERYVVALGSYTPALIKALGLNAPIYPVKGYSTAPIVD---ESRAPVSTVL
DADA_BRUSI      SLLMSGGKISVETSEGIVTAERYVVALGSYTPALIKALGLNAPIYPVKGYSTAPIVD---ESRAPVSTVL
DADA_BRUO2      SLLMSGGKISVETSEGIVTAERYVVALGSYTPALIKALGLNAPIYPVKGYSTAPIVD---ESRAPVSTVL
DADA_BRUME      SLLMSGGKISVETSEGIVTAERYVVALGSYTPALIKALGLNAPIYPVKGYSTAPIVD---ESRAPVSTVL
DADA_BRUMB      SLLMSGGKISVETSEGIVTAERYVVALGSYTPALIKALGLNAPIYPVKGYSTAPIVD---ESRAPVSTVL
DADA_BRUC2      SLLMSGGKISVETSEGIVTAERYVVALGSYTPALIKALGLNAPIYPVKGYSTAPIVD---ESRAPVSTVL
DADA_BRUAB      SLLMSGGKISVETSEGIVTAERYVVALGSYTPALIKALGLNAPIYPVKGYSTAPIVD---ESRAPVSTVL
DADA_BRUA2      SLLMSGGKISVETSEGIVTAERYVVALGSYTPALIKALGLNAPIYPVKGYSTAPIVD---ESRAPVSTVL
DADA_BRUA1      SLLMSGGKISVETSEGIVTAERYVVALGSYTPALIKALGLNAPIYPVKGYSTAPIVD---ESRAPVSTVL
GLPO_STRP8      ----------------------------------------------------------------------
GLPO_STRP6      ----------------------------------------------------------------------
GLPO_STRP3      ----------------------------------------------------------------------
GLPO_STRP1      ----------------------------------------------------------------------
DADA_VIBSL      LNHQNRAIETITTTQGEFKADAYVVASGSYSR---ELLKQVDLSIPVYPVKGYSLTLPIVNVDKSPTSTV
DADA_NEIM0      RIDHNGLRITVETETGRFEADAVVCALGCFSRTPIYPVKGYSLTLPVTNSDGAPVSTVLDESY-------
DADA_METRJ      RLHHAGDRTAVETADGALLADAYVAALGSYTPA---LLRPLGIALPVYPVKTLPITD---AEAAPVSTVM
DADA_NEIMF      RIDHNGLRIAVETETGRFEADAVVCALGCFSRTPIYPVKGYSLTLPVTNSDGAPVSTVLDESY-------
DADA_METS4      EAGRVTG---VETATGEVLAEAYVAAMGSYTPA---LLRPLGLSLPVYPVKTLPVTD---EGSAPVSTVM
MNMC_AZOSB      -LARADTRWQARDAQGALLAE-APVAILAAGTG-------------------------------------
MNMA_BURP8      ----------------------------------------------------------------------
DADA_METNO      ----------------------------------------------------------------------
DADA_GRABC      GFSTQGDKTAIRSSRGDLMADAYVCALGSYSPLLLKQIGIAAPIYPVKGYSTIPITDETHAPV----STV


                         .         *         .         .         .         .         +:350
query           WDTKEILSSFRMDKAGRLVFGSVGALRGTGTAIHRAWAKRSLKRLFPQLGDTEFECEWYGQIGMTDNAVP
ORDL_RHIME      DDSRFVVRYFRKSKDGRLLFGGREAYTADNPRDISAHIRRQICEIYPDLADVEITHAWGGSVGITMPRQP
PUUB_ECOLI      EDCNYLLDYYRLTADNRLLYGG-GVVYGARDPVERLVVPKLLK-TFPQLKGVKIDYRWTGNFLLTLSRMP
ORDL_HAEIN      CDNNLLLDYYRLSADNRLLFGSDSSSEKDMVAIMR----KNMLCVFPQLENVKIDYGWAGPIDMTLNSTP
M2GD_HUMAN      ----------------------------------------------------------------------
M2GD_RAT        ----------------------------------------------------------------------
M2GD_MOUSE      ----------------------------------------------------------------------
MNMC_METFK      ----------------------------------------------------------------------
GLOX_BACSU      YIVPR--------KSGRLVVGATGDWSETPDLGGLESVMKKAKTMLPAIQNMKVDRFWAGLRPGTKDGKP
DADA_AGRRK      MDETYKIAITRL--GDRIRVGGMAEISGYTNDLRRNTLEHSVMDLFPG-GDVSKAAFWSGLRPMTPDGTP
DADA_PARDP      MDETYKVAITRL--GDRIRVGGLAEIAGYDLSLNKETLAKSVGELFGGAGDAEQALFWTGLRPMTPDGTP
MNMC_THICR      ----------------------------------------------------------------------
DADA_RHOS1      ----------------------------------------------------------------------
DADA_SPHWW      GD--------------RIRVGGMAEISGYSNDLRRATLDHCVGSLFPDAGDLSQASFWTGLRPMTPDGTP
DADA_RHOS4      ----------------------------------------------------------------------
DADA_NEIMB      ---KVAITRF----DNRIRVGGMAELSGYEIKLRRETLALVVNDLFPEGGDLSQASFWSGLRPMTPDSTP
DADA_NEIMA      ---KVAITRFN----NRIRVGGMAELSGYAIKLRRETLALVVNDLFPEGGDLNQTLFWSGLRPMTPDSTP
DADA_BRUSU      DESYKIAITRLGDRIRVGGMAEVSGFTDDLPAARRATLDLSVTDLFPG-GDLKAATFWSGLRPMTPDSTP
DADA_BRUSI      DESYKIAITRLGDRIRVGGMAEVSGFTDDLPAARRATLDLSVTDLFPG-GDLKAATFWSGLRPMTPDSTP
DADA_BRUO2      DESYKIAITRLGDRIRVGGMAEVSGFTDDLPAARRATLDLSVTDLFPG-GDLKAATFWSGLRPMTPDSTP
DADA_BRUME      DESYKIAITRLGDRIRVGGMAEVSGFTDDLPAARRATLDLSVTDLFPG-GDLKAATFWSGLRPMTPDSTP
DADA_BRUMB      DESYKIAITRLGDRIRVGGMAEVSGFTDDLPAARRATLDLSVTDLFPG-GDLKAATFWSGLRPMTPDSTP
DADA_BRUC2      DESYKIAITRLGDRIRVGGMAEVSGFTDDLPAARRATLDLSVTDLFPG-GDLKAATFWSGLRPMTPDSTP
DADA_BRUAB      DESYKIAITRLGDRIRVGGMAEVSGFTDDLPAARRATLDLSVTDLFPG-GDLKAATFWSGLRPMTPDSTP
DADA_BRUA2      DESYKIAITRLGDRIRVGGMAEVSGFTDDLPAARRATLDLSVTDLFPG-GDLKAATFWSGLRPMTPDSTP
DADA_BRUA1      DESYKIAITRLGDRIRVGGMAEVSGFTDDLPAARRATLDLSVTDLFPG-GDLKAATFWSGLRPMTPDSTP
GLPO_STRP8      ----------------------------------------------------------------------
GLPO_STRP6      ----------------------------------------------------------------------
GLPO_STRP3      ----------------------------------------------------------------------
GLPO_STRP1      ----------------------------------------------------------------------
DADA_VIBSL      MDETYKVAMTRFDD--RIRIAGTAELAGFDYLIRKATIDMVIKDLFPQAGDFSKAEYWTGLRPMTPDGTP
DADA_NEIM0      ---KVAITRFD----NRIRVGGMAELSGYEIKLRRETLALVVNDLFPEGGDLSQASFWSGLRPMTPDSTP
DADA_METRJ      DETYKVAITRLGD---RIRVGGTAELAGFSNALRRETLARSVQDLFPAGGDLDKASFWTGLRPMTPDGTP
DADA_NEIMF      ---KVAITRFD----NRIRVGGMAELSGYEIKLRRETLALVVNDLFPEGGDLSQALFWSGLRPMTPDSTP
DADA_METS4      DETYKVAITRLGD---RIRVGGTAELAGFSQALRRATLERSLTDLFPAGGDLSRATFWTGLRPMTPDGTP
MNMC_AZOSB      ----------------------------------------------------------------------
MNMA_BURP8      ----------------------------------------------------------------------
DADA_METNO      --------------------GFSGTLRGP----RRATLERSLRDLFPAGGDARQAQFWTGLRPMTPDGTP
DADA_GRABC      MDETYKIAITRL--GNRIRVGGTAELAGYDTRLRRMTLEGSVKELFPDSGDLPAATFWSGLRPMTPDGTP


                         .         .         .         .         *         .         .:420
query           RFHKFAENVIGFSGYNGRGIAPGTAFGKVIAQHILGEIAEADLPLPVTEPKAQAFRAVKEAYYEAGAQIA
ORDL_RHIME      FCREVMPGVTTIGGYSGHGVMLANYCGKLYAELALGKSTELDL---------------------------
PUUB_ECOLI      QFGRLDTNIYYMQGYSGHGVTCTHLAGRLIAELLRGDAERFDYPFPGGRTLRVPFTAMGAAYY-------
ORDL_HAEIN      HFGRISPHIYFAHGYSGHGVALTGLAGRIVAEAILGDDERLSIFEGLKVPSVYGGRIIKDLATKIGVQYY
M2GD_HUMAN      ----------------------------------------------------------------------
M2GD_RAT        ----------------------------------------------------------------------
M2GD_MOUSE      ----------------------------------------------------------------------
MNMC_METFK      ----------------------------------------------------------------------
GLOX_BACSU      YIGRHPEDILFAAGHFRNGILLAPATGALISDLIMNKEVNQD----------------------------
DADA_AGRRK      VIG--ATKIRGLTGHGTLGWTMSCGSARVISDLVSGHKAEID----------------------------
DADA_PARDP      IVGATIPNLYLNTGHGTLGWTMSAGSGRLIADLISGDIAAEDL---------------------------
MNMC_THICR      ----------------------------------------------------------------------
DADA_RHOS1      ----------------------------------------------------------------------
DADA_SPHWW      --------VIGATGY-------------------------------------------------------
DADA_RHOS4      ----------------------------------------------------------------------
DADA_NEIMB      LIGRTRDNLFLNTGHGTLGWTMSLGSAKLTADIVSGEIRSDDLSL-------------------------
DADA_NEIMA      LIGRTRDNLFLNTGHGTLGWTMSLGSAKLTADIVSGEIRSDDLSL-------------------------
DADA_BRUSU      IIGGTRDNLFINAGHGTLGWTMACGSGRLLADLISGNKAD------------------------------
DADA_BRUSI      IIGGTRDNLFINAGHGTLGWTMACGSGRLLADLISGNKAD------------------------------
DADA_BRUO2      IIGGTRDNLFINAGHGTLGWTMACGSGRLLADLISGNKAD------------------------------
DADA_BRUME      IIGGTRDNLFINAGHGTLGWTMACGSGRLLADLISGNKAD------------------------------
DADA_BRUMB      IIGGTRDNLFINAGHGTLGWTMACGSGRLLADLISGNKAD------------------------------
DADA_BRUC2      IIGGTRDNLFINAGHGTLGWTMACGSGRLLADLISGNKAD------------------------------
DADA_BRUAB      IIGGTRDNLFINAGHGTLGWTMACGSGRLLADLISGNKAD------------------------------
DADA_BRUA2      IIGGTRDNLFINAGHGTLGWTMACGSGRLLADLISGNKAD------------------------------
DADA_BRUA1      IIGGTRDNLFINAGHGTLGWTMACGSGRLLADLISGNKAD------------------------------
GLPO_STRP8      ----------------------------------------------------------------------
GLPO_STRP6      ----------------------------------------------------------------------
GLPO_STRP3      ----------------------------------------------------------------------
GLPO_STRP1      ----------------------------------------------------------------------
DADA_VIBSL      IIGKTIKNLFTNTGHGTLGWTMACGSGKILASVVSGSASD------------------------------
DADA_NEIM0      LIGRTRDNLFLNTGHGTLGWTMSLGSAKLTADIVSGEIRSDDLSL-------------------------
DADA_METRJ      IVGTRVGNLFTNTGHGTLGWTMACGSGRLLADLVSGEIASDDLAL-------------------------
DADA_NEIMF      LIGRTRENLFLNTGHGTLGWTMSLGSAKLTADIVSGEIRSDDLSL-------------------------
DADA_METS4      IVGATAGNLYTNTGHGTLGWTMACGSGRMLADLITGEIAHED----------------------------
MNMC_AZOSB      ----------------------------------------------------------------------
MNMA_BURP8      ----------------------------------------------------------------------
DADA_METNO      IVGPTVDNLYTNTGHGTLGWTMACGSGRLLADLITGEIAHEDL---------------------------
DADA_GRABC      RYRNLHLN----TGHGTLGWTMSCGSGRLLADMISGKIDHADLAI-------------------------


                         .         .         +         .         .         .         .:490
query           HFxxxxx
ORDL_RHIME      -------
PUUB_ECOLI      -------
ORDL_HAEIN      KF-----
M2GD_HUMAN      -------
M2GD_RAT        -------
M2GD_MOUSE      -------
MNMC_METFK      -------
GLOX_BACSU      -------
DADA_AGRRK      -------
DADA_PARDP      -------
MNMC_THICR      -------
DADA_RHOS1      -------
DADA_SPHWW      -------
DADA_RHOS4      -------
DADA_NEIMB      -------
DADA_NEIMA      -------
DADA_BRUSU      -------
DADA_BRUSI      -------
DADA_BRUO2      -------
DADA_BRUME      -------
DADA_BRUMB      -------
DADA_BRUC2      -------
DADA_BRUAB      -------
DADA_BRUA2      -------
DADA_BRUA1      -------
GLPO_STRP8      -------
GLPO_STRP6      -------
GLPO_STRP3      -------
GLPO_STRP1      -------
DADA_VIBSL      -------
DADA_NEIM0      -------
DADA_METRJ      -------
DADA_NEIMF      -------
DADA_METS4      -------
MNMC_AZOSB      -------
MNMA_BURP8      -------
DADA_METNO      -------
DADA_GRABC      -------