[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for atum0:AAK88391.2

[Show Plain Result]


## Summary of Sequence Search
    1::215
   23::210     4e-17  32%  216 aa  Y4757_PSEAE RecName: Full=Uncharacterized membrane protein PA4757;
   20::144     2e-15  34%  206 aa  RHTB_SHIFL RecName: Full=Homoserine/homoserine lactone efflux
   20::144     2e-15  34%  206 aa  RHTB_ECOLI RecName: Full=Homoserine/homoserine lactone efflux
   20::144     2e-15  34%  206 aa  RHTB_ECOL6 RecName: Full=Homoserine/homoserine lactone efflux
   20::144     2e-15  34%  206 aa  RHTB_ECO57 RecName: Full=Homoserine/homoserine lactone efflux
   24::212     1e-14  28%  212 aa  LEUE_SHIDS RecName: Full=Leucine efflux protein;
   24::212     1e-14  28%  212 aa  LEUE_ECOUT RecName: Full=Leucine efflux protein;
   24::212     1e-14  28%  212 aa  LEUE_ECOLI RecName: Full=Leucine efflux protein;
   24::212     1e-14  28%  212 aa  LEUE_ECOL6 RecName: Full=Leucine efflux protein;
   24::212     1e-14  28%  212 aa  LEUE_ECOL5 RecName: Full=Leucine efflux protein;
   24::212     1e-14  28%  212 aa  LEUE_ECOK1 RecName: Full=Leucine efflux protein;
   24::212     1e-14  28%  212 aa  LEUE_ECOHS RecName: Full=Leucine efflux protein;
   24::212     2e-14  28%  212 aa  LEUE_SHISS RecName: Full=Leucine efflux protein;
   24::212     2e-14  28%  212 aa  LEUE_ECO24 RecName: Full=Leucine efflux protein;
    3::191     2e-14  28%  191 aa  LEUE_SHIBS RecName: Full=Putative leucine efflux protein;
   24::212     4e-14  27%  212 aa  LEUE_ECO57 RecName: Full=Leucine efflux protein;
   24::212     2e-13  27%  212 aa  LEUE_KLEP7 RecName: Full=Leucine efflux protein;
   18::141     9e-13  30%  210 aa  YRHP_BACSU RecName: Full=Uncharacterized membrane protein yrhP;
   71::195     2e-11  33%  206 aa  RHTB_SALTY RecName: Full=Homoserine/homoserine lactone efflux
   71::195     2e-11  33%  206 aa  RHTB_SALTI RecName: Full=Homoserine/homoserine lactone efflux
   24::212     5e-11  22%  212 aa  LEUE_CITK8 RecName: Full=Leucine efflux protein;
   24::212     3e-10  25%  212 aa  LEUE_SALTY RecName: Full=Leucine efflux protein;
   24::212     3e-10  25%  212 aa  LEUE_SALTI RecName: Full=Leucine efflux protein;
   24::212     3e-10  25%  212 aa  LEUE_SALPA RecName: Full=Leucine efflux protein;
   24::212     3e-10  25%  212 aa  LEUE_SALCH RecName: Full=Leucine efflux protein;
   16::153     7e-10  30%  210 aa  Y1307_HAEIN RecName: Full=Uncharacterized membrane protein HI1307;
   32::162     1e-09  31%  206 aa  Y1627_SYNY3 RecName: Full=Uncharacterized membrane protein slr1627;
   19::140     2e-09  30%  206 aa  RHTC_SALTY RecName: Full=Threonine efflux protein;
   19::140     2e-09  30%  206 aa  RHTC_SALTI RecName: Full=Threonine efflux protein;
   24::207     2e-09  22%  211 aa  LEUE_ENT38 RecName: Full=Leucine efflux protein;
   20::195     2e-08  27%  195 aa  EAMB_SHISS RecName: Full=Cysteine/O-acetylserine efflux protein;
   20::195     2e-08  27%  195 aa  EAMB_SHIFL RecName: Full=Cysteine/O-acetylserine efflux protein;
   20::195     2e-08  27%  195 aa  EAMB_SHIF8 RecName: Full=Cysteine/O-acetylserine efflux protein;
   20::195     2e-08  27%  195 aa  EAMB_ECOUT RecName: Full=Cysteine/O-acetylserine efflux protein;
   20::195     2e-08  27%  195 aa  EAMB_ECOLI RecName: Full=Cysteine/O-acetylserine efflux protein;
   20::195     2e-08  27%  195 aa  EAMB_ECOL6 RecName: Full=Cysteine/O-acetylserine efflux protein;
   20::195     2e-08  27%  195 aa  EAMB_ECOL5 RecName: Full=Cysteine/O-acetylserine efflux protein;
   20::195     2e-08  27%  195 aa  EAMB_ECOK1 RecName: Full=Cysteine/O-acetylserine efflux protein;
   20::195     2e-08  27%  195 aa  EAMB_ECOHS RecName: Full=Cysteine/O-acetylserine efflux protein;
   20::195     2e-08  27%  195 aa  EAMB_ECO57 RecName: Full=Cysteine/O-acetylserine efflux protein;
   20::195     2e-08  27%  195 aa  EAMB_ECO24 RecName: Full=Cysteine/O-acetylserine efflux protein;
   20::195     3e-08  32%  195 aa  EAMB_SALTY RecName: Full=Cysteine/O-acetylserine efflux protein;
   20::195     3e-08  32%  195 aa  EAMB_SALTI RecName: Full=Cysteine/O-acetylserine efflux protein;
   20::195     3e-08  32%  195 aa  EAMB_SALPA RecName: Full=Cysteine/O-acetylserine efflux protein;
   20::195     3e-08  32%  195 aa  EAMB_SALCH RecName: Full=Cysteine/O-acetylserine efflux protein;
   34::217     4e-08  22%  223 aa  YAHN_ECOLI RecName: Full=Uncharacterized membrane protein yahN;
   56::179     9e-08  28%  225 aa  YGGA_AERHY RecName: Full=Putative amino-acid transporter yggA;
   20::195     2e-07  27%  195 aa  EAMB_SHIBS RecName: Full=Cysteine/O-acetylserine efflux protein;
   19::157     2e-07  25%  206 aa  RHTC_ECOLI RecName: Full=Threonine efflux protein;
   19::157     2e-07  25%  206 aa  RHTC_ECO57 RecName: Full=Threonine efflux protein;
   56::189     3e-07  33%  206 aa  YGGA_AERSA RecName: Full=Putative amino-acid transporter yggA;
   20::132     2e-06  33%  196 aa  EAMB_KLEP7 RecName: Full=Cysteine/O-acetylserine efflux protein;
   56::127     2e-04  28%  211 aa  ARGO_KLEP3 RecName: Full=Arginine exporter protein argO;
   16::115     5e-04  33%  201 aa  Y498_MYCBO RecName: Full=Putative amino-acid transporter Mb0498;
   16::115     5e-04  33%  201 aa  Y488_MYCTU RecName: Full=Putative amino-acid transporter
   19::88      6e-04  33%  233 aa  LYSE_CORGL RecName: Full=Lysine exporter protein;
   56::127     6e-04  26%  211 aa  ARGO_ENT38 RecName: Full=Arginine exporter protein argO;
   56::127     8e-04  25%  211 aa  ARGO_SALG2 RecName: Full=Arginine exporter protein argO;
   56::127     8e-04  25%  211 aa  ARGO_SALEP RecName: Full=Arginine exporter protein argO;
    1::215

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxPGPDMTLWISRSLREGRAAGFMTLVGTNIGITVHTMLVAFGVAALIV
Y4757_PSEAE     -----------------------PGPNSLFVLATSAQRGVATGYRAACGVFLGDAVLMLLSALGVASLLK
RHTB_SHIFL      -----------------------PGSGAINTMTTSLNHGYRGAVASIAGLQTGLAIHIVLVGVGLGTLFS
RHTB_ECOLI      -----------------------PGSGAINTMTTSLNHGYRGAVASIAGLQTGLAIHIVLVGVGLGTLFS
RHTB_ECOL6      -----------------------PGSGAINTMTTSLNHGYRGAVASIAGLQTGLAIHIVLVGVGLGTLFS
RHTB_ECO57      -----------------------PGSGAINTMTTSLNHGYRGAVASIAGLQTGLAIHIVLVGVGLGTLFS
LEUE_SHIDS      -----------------------PGPNTLFVLKNSVSSGMKGGYLAACGVFIGDAVLMFLAWAGVATLIK
LEUE_ECOUT      -----------------------PGPNTLFVLKNSVSSGMKGGYLAACGVFIGDAVLMFLAWAGVATLIK
LEUE_ECOLI      -----------------------PGPNTLFVLKNSVSSGMKGGYLAACGVFIGDAVLMFLAWAGVATLIK
LEUE_ECOL6      -----------------------PGPNTLFVLKNSVSSGMKGGYLAACGVFIGDAVLMFLAWAGVATLIK
LEUE_ECOL5      -----------------------PGPNTLFVLKNSVSSGMKGGYLAACGVFIGDAVLMFLAWAGVATLIK
LEUE_ECOK1      -----------------------PGPNTLFVLKNSVSSGMKGGYLAACGVFIGDAVLMFLAWAGVATLIK
LEUE_ECOHS      -----------------------PGPNTLFVLKNSVSSGMKGGYLAACGVFIGDAVLMFLAWAGVATLIK
LEUE_SHISS      -----------------------PGPNTLFVLKNSVSSGMKGGYLAACGVFIGDAVLMFLAWAGVATLIK
LEUE_ECO24      -----------------------PGPNTLFVLKNSVSSGMKGGYLAACGVFIGDAVLMFLAWAGVATLIK
LEUE_SHIBS      -----------------------PGPNTLFVLKNSVSSGMKGGYLAACGVFIGDAVLMFLAWAGVATLIK
LEUE_ECO57      -----------------------PGPNTLFVLKNSVSSGMKGGYLAACGVFIGDAVLMFLAWAGMATLIK
LEUE_KLEP7      -----------------------PGPNTFFVLKTGIAHGVKKGYLAAAGVFIGDAVLMFLAFAGVATLIK
YRHP_BACSU      -----------------------PGADTMLVMKNTLRYGPKAGRYNILGLATGLSFWTVIAILGLSVVIA
RHTB_SALTY      ----------------------------------------------------------------------
RHTB_SALTI      ----------------------------------------------------------------------
LEUE_CITK8      -----------------------PGPNTIFVLKNSVGRGMKGGYLAASGVFIGDAVLMFLAYAGVATLIK
LEUE_SALTY      -----------------------PGPNTLFVLKNSVGRGVKGGYLAACGVFIGDAILMFLAYAGVATLIK
LEUE_SALTI      -----------------------PGPNTLFVLKNSVGRGVKGGYLAACGVFIGDAILMFLAYAGVATLIK
LEUE_SALPA      -----------------------PGPNTLFVLKNSVGRGVKGGYLAACGVFIGDAILMFLAYAGVATLIK
LEUE_SALCH      -----------------------PGPNTLFVLKNSVGRGVKGGYLAACGVFIGDAILMFLAYAGVATLIK
Y1307_HAEIN     -----------------------PGPDFFYVSRMAASNSRRNTVCGILGITLGIAFWGMLSMLGLAVLFV
Y1627_SYNY3     --------------------------------SKSASGGFIHGLFAALGVVLGDIIFILIALWGLAFLRG
RHTC_SALTY      -----------------------PGPDFFFVSQTAVSRSRKEAMMGVLGITCGVMVWAGVALLGLHLIIE
RHTC_SALTI      -----------------------PGPDFFFVSQTAVSRSRKEAMMGVLGITCGVMVWAGVALLGLHLIIE
LEUE_ENT38      -----------------------PGPNTLFVLKTGIGHGVKKGYLAATGVFIGDAVLMFLAWAGVAALIQ
EAMB_SHISS      -----------------------PGPNNILALSSATSHGFRQSTRVLAGMSLGFLIVMLLCAGISFSLAV
EAMB_SHIFL      -----------------------PGPNNILALSSATSHGFRQSTRVLAGMSLGFLIVMLLCAGISFSLAV
EAMB_SHIF8      -----------------------PGPNNILALSSATSHGFRQSTRVLAGMSLGFLIVMLLCAGISFSLAV
EAMB_ECOUT      -----------------------PGPNNILALSSATSHGFRQSTRVLAGMSLGFLIVMLLCAGISFSLAV
EAMB_ECOLI      -----------------------PGPNNILALSSATSHGFRQSTRVLAGMSLGFLIVMLLCAGISFSLAV
EAMB_ECOL6      -----------------------PGPNNILALSSATSHGFRQSTRVLAGMSLGFLIVMLLCAGISFSLAV
EAMB_ECOL5      -----------------------PGPNNILALSSATSHGFRQSTRVLAGMSLGFLIVMLLCAGISFSLAV
EAMB_ECOK1      -----------------------PGPNNILALSSATSHGFRQSTRVLAGMSLGFLIVMLLCAGISFSLAV
EAMB_ECOHS      -----------------------PGPNNILALSSATSHGFRQSTRVLAGMSLGFLIVMLLCAGISFSLAV
EAMB_ECO57      -----------------------PGPNNILALSSATTHGFHQSTRVLAGMSLGFLIVMLLCAGISFSLAV
EAMB_ECO24      -----------------------PGPNNILALSSATSHGFRQSTRVLAGMSLGFLIVMLLCAGISFSLAV
EAMB_SALTY      -----------------------PGPNNILALSAATAHGFRQSIRVLAGMSLGFLV-VMLLCAGIASLAV
EAMB_SALTI      -----------------------PGPNNILALSAATAHGFRQSIRVLAGMSLGFLV-VMLLCAGIASLAV
EAMB_SALPA      -----------------------PGPNNILALSAATAHGFRQSIRVLAGMSLGFLV-VMLLCAGIASLAV
EAMB_SALCH      -----------------------PGPNNILALSAATAHGFRQSIRVLAGMSLGFLV-VMLLCAGIASLAV
YAHN_ECOLI      -----------------------PGANLFVVVQTSLASGRRXXXXXXXXXXXXDAFYSGLGLFGLATLIT
YGGA_AERHY      --------------------------------------------------------------FGGANLLA
EAMB_SHIBS      -----------------------PRPNNILALSSATSHGFRQSTRVLAGMSLGFLIVMLLCAGISFSLAV
RHTC_ECOLI      -----------------------PGPDFFFVSQTAVSRSRKEAMMGVLGITCGVMVWXXXXXXXXXXXXE
RHTC_ECO57      -----------------------PGPDFFFVSQTAVSRSRKEAMMGVLGITCGVMVWXXXXXXXXXXXXE
YGGA_AERSA      --------------------------------------------------------------FGGANLLA
EAMB_KLEP7      -----------------------PGPNNILALSSVTSHGLRRSLRVLAGMSVGFII-TMLICAALTFSLV
ARGO_KLEP3      --------------------------------------------------------------FGGSALLM
Y498_MYCBO      -----------------------------------LRQGIRREYVLVIVALCGIADGALIAAGGFAALIH
Y488_MYCTU      -----------------------------------LRQGIRREYVLVIVALCGIADGALIAAGGFAALIH
LYSE_CORGL      ------------------------GPQNVLVIKQGIREGLIAVLLVCLISDVFLFIAGTL---GVDLLSN
ARGO_ENT38      --------------------------------------------------------------FGGSALLM
ARGO_SALG2      --------------------------------------------------------------FGGSALLM
ARGO_SALEP      --------------------------------------------------------------FGGSALLM


                         .         .         *         .         .         .         .:140
query           ASPTAFMILKTGGAAYLVWLAIQAIRKGSDFVMVKSTGEKAQASLKSALLNGIWVNLLNPKVIIFFMTFL
Y4757_PSEAE     AEPMLFIGLKYLGAAYLFYLGVGMLRGARKLRNPEATAAQAQVDVHQPFRKALLLSLSNPKAILFFISFF
RHTB_SHIFL      RSVIAFEVLKWAGAAYLIWLGIQQWR-AAGAIDLKSLA--STQSRRHLFQRAVFVNLTNPKSIVFLAALF
RHTB_ECOLI      RSVIAFEVLKWAGAAYLIWLGIQQWR-AAGAIDLKSLA--STQSRRHLFQRAVFVNLTNPKSIVFLAALF
RHTB_ECOL6      RSVIAFEVLKWAGAAYLIWLGIQQWR-AAGAIDLKSLA--STQSRRHLFQRAVFVNLTNPKSIVFLAALF
RHTB_ECO57      RSVIAFEVLKWAGAAYLIWLGIQQWR-AAGAIDLKSLA--STQSRRHLFQRAVFVNLTNPKSIVFLAALF
LEUE_SHIDS      TTPILFNIVRYLGAFYLLYLGLYATLKGKN-SEAKSDEPQYGAIFKRALI----LSLTNPKAILFYVSFF
LEUE_ECOUT      TTPILFNIVRYLGAFYLLYLGLYATLKGKN-SETKSDEPQYGAIFKRALI----LSLTNPKAILFYVSFF
LEUE_ECOLI      TTPILFNIVRYLGAFYLLYLGLYATLKGKN-SEAKSDEPQYGAIFKRALI----LSLTNPKAILFYVSFF
LEUE_ECOL6      TTPILFNIVRYLGAFYLLYLGLYATLKGKN-SETKSDEPQYGAIFKRALI----LSLTNPKAILFYVSFF
LEUE_ECOL5      TTPILFNIVRYLGAFYLLYLGLYATLKGKN-SETKSDEPQYGAIFKRALI----LSLTNPKAILFYVSFF
LEUE_ECOK1      TTPILFNIVRYLGAFYLLYLGLYATLKGKN-SETKSDEPQYGAIFKRALI----LSLTNPKAILFYVSFF
LEUE_ECOHS      TTPILFNIVRYLGAFYLLYLGLYATLKGKN-SEAKSDEPQYGAIFKRALI----LSLTNPKAILFYVSFF
LEUE_SHISS      TTPILFNIVRYLGAFYLLYLGLYATLKGKN-NEAKSDEPQYGAIFKRALI----LSLTNPKAILFYVSFF
LEUE_ECO24      TTPILFNIVRYLGAFYLLYLGLYATLKGKN-NEAKSDEPQYGAIFKRALI----LSLTNPKAILFYVSFF
LEUE_SHIBS      TTPILFNIVRYLGAFYLLYLILYATLKGKN-NEAKSDEPQYGAIFKRALI----LSLTNPKAILFYVSFF
LEUE_ECO57      TTPILFNIVRYLGAFYLLYLGLYATLKGKN-NEAKSDEPQYGAIFKRALI----LSLTNPKAILFYVSFF
LEUE_KLEP7      TTPVLFNVVRYLGAIYLLWLAVLTQRDGQS----DASAEPASAILKRSLT----LSLTNPKAILFYVSFF
YRHP_BACSU      KSVILFTTIKYLGAAYLIYLGVKSFFAKSMFSLAKNMASSPKRYYKTSFMQGSLSNILNPKTVLVYVTIM
RHTB_SALTY      ----AFEILKWAGAAYLIWLGIQQWRAAGAIDLHTLAQTQSRGRL---FKRAIFVNLTNPKSIVFLAALF
RHTB_SALTI      ----AFEILKWAGAAYLIWLGIQQWRAAGAIDLHTLAQTQSRGRL---FKRAIFVNLTNPKSIVFLAALF
LEUE_CITK8      TTPVLFNIVRXXXXXXXXXXXXKIL-----YATLKSKGSEVEVPFGAIFKRALILSLTNPKAILFYVSFF
LEUE_SALTY      TTPVLFNIVRXXXXXXXXXXXXKIL-----YATLTSKGRAATAIFKRALI----LSLTNPKAILFYVSFF
LEUE_SALTI      TTPVLFNIVRXXXXXXXXXXXXKIL-----YATLTSKGRAATAIFKRALI----LSLTNPKAILFYVSFF
LEUE_SALPA      TTPVLFNIVRXXXXXXXXXXXXKIL-----YATLTSKGRAATAIFKRALI----LSLTNPKAILFYVSFF
LEUE_SALCH      TTPVLFNIVRXXXXXXXXXXXXKIL-----YATLTSKGRAATAIFKRALI----LSLTNPKAILFYVSFF
Y1307_HAEIN     TIPALHGVIMLLGGSYLAYLGFLMARKYAKFESHSDTEFNQQTTIKKEILKGLLVNLSNAKVVVYFSSVM
Y1627_SYNY3     AMGDFFVILKYISGIYLSWLGINTIRAK---VNNQSLAKVDVKSLSSSFSAGLLITLADQKAVLFYLGFL
RHTC_SALTY      KMAWLHTIIMVGGGLYLCWMGYQMLRKKQDAAASSPHIELAQSG--RSFLKGLLTNLSNPKAIIYFGSVF
RHTC_SALTI      KMAWLHTIIMVGGGLYLCWMGYQMLRKKQDAAASSPHIELAQSG--RSFLKGLLTNLSNPKAIIYFGSVF
LEUE_ENT38      TTPVLFNIVRXXXXXXXXXXXXKML---WSVIMRKNSAHAGGAEPSSTILRSLVLSLTNPKAILFYVSFF
EAMB_SHISS      IDPAAVHLLSWAGAAYIVWLAWK--------IATSPTKEDGLQAKPISFWASFALQFVNVKIILYGVTAL
EAMB_SHIFL      IDPAAVHLLSWAGAAYIVWLAWK--------IATSPTKEDGLQAKPISFWASFALQFVNVKIILYGVTAL
EAMB_SHIF8      IDPAAVHLLSWAGAAYIVWLAWK--------IATSPTKEDGLQAKPISFWASFALQFVNVKIILYGVTAL
EAMB_ECOUT      IDPAAVHLLSWAGAAYIVWLAWK--------IATSPTKEDGLQTKPISFWASFALQFVNVKIILYGVTAL
EAMB_ECOLI      IDPAAVHLLSWAGAAYIVWLAWK--------IATSPTKEDGLQAKPISFWASFALQFVNVKIILYGVTAL
EAMB_ECOL6      IDPAAVHLLSWAGAAYIVWLAWK--------IATSPTKEDGLQTKPISFWASFALQFVNVKIILYGVTAL
EAMB_ECOL5      IDPAAVHLLSWAGAAYIVWLAWK--------IATSPTKEDGLQTKPISFWASFALQFVNVKIILYGVTAL
EAMB_ECOK1      IDPAAVHLLSWAGAAYIVWLAWK--------IATSPTKEDGLQTKPISFWASFALQFVNVKIILYGVTAL
EAMB_ECOHS      IDPAAVHLLSWAGAAYIVWLAWK--------IATSPTKEDGLQAKPISFWASFALQFVNVKIILYGVTAL
EAMB_ECO57      IDPAAVHLLSWAGAAYIVWLAWK--------IATSPTKEDGLQTKPISFWASFALQFVNVKIILYGVTAL
EAMB_ECO24      IDPAAVHLLSWAGAAYIVWLAWK--------IATSPTKEDGLQAKPISFWASFALQFVNVKIILYGVTAL
EAMB_SALTY      IDPAIIHLLSWVGAAYILWLA---------WKIATSPAADENARPKPV---GFWVSFVNVKIILYGITAL
EAMB_SALTI      IDPAIIHLLSWVGAAYILWLAWKI-----------ATSPAADEKVRPKPV-GFWVSFVNVKIILYGITAL
EAMB_SALPA      IDPAIIHLLSWVGAAYILWLAWKI-----------ATSPAADEKVRPKPV-GFWVSFVNVKIILYGITAL
EAMB_SALCH      IDPAIIHLLSWVGAAYILWLA---------WKIATSPAADENARPKPV---GFWVSFVNVKIILYGITAL
YAHN_ECOLI      QCEEIFSLIRIVGGAYLLWFAWCSMRRQST-PQMSTLQQPISAPWYVFFRRGLITDLSNPQTVLFFISIF
YGGA_AERHY      ASPIGLALLTWGGVLFLGWFGIRSLRSAWRGQGAKLADSPQLMGVKSVLAMTLGVTLLNPHVYLDTLMLL
EAMB_SHIBS      IDPAAVHLLSWAGAAYIVWLAWK--------IATSPTKEDGLQAKPISFWASFALQFVNVKIILYGVTAL
RHTC_ECOLI      KMAWLHTLIMVGGGLYLCWMGYQMLRGALKKEAVSAPAPQVEAKSGRSFLKGLLTNLANPKAIIYFGSVF
RHTC_ECO57      KMAWLHTLIMVGGGLYLCWMGYQMLRGALKKEAVSAPAPQVEAKSGRSFLKGLLTNLANPKAIIYFGSVF
YGGA_AERSA      ASPIGLALLTWGGVLFLCWFGIRSLRSAWQGQGAALADSPRLMGVKSVLAMTLGVTLLNPHVLMLLGSFG
EAMB_KLEP7      ELDSRFLVLGWIGAAYILWLAWQ---------IAKSKPATGTPSVEPV---GFWASLVNVKIILYGITAL
ARGO_KLEP3      QSPWLLAIVTWGGVAFLLWYGFGALKTAFSQNLELASAEVMQQGRWKIIITMLAVTWLNPHVYL------
Y498_MYCBO      AHPNMTLVARFGGAAFLIGYALLAARRPSGLV----PSESGPAALIGVVQMCLVVTFLNPHVYL------
Y488_MYCTU      AHPNMTLVARFGGAAFLIGYALLAARRPSGLV----PSESGPAALIGVVQMCLVVTFLNPHVYL------
LYSE_CORGL      AAPIVLDIMRWGGIAYLLWFAVMAAK--------------------------------------------
ARGO_ENT38      QSPWLLALVTWGGVAFLLWYGFGALKTAMGSNLELATAEVMKQGRWKIIATMLAVTWLNPHVYL------
ARGO_SALG2      QSPWLLALVTWGGVAFLLWYGLGALKTAMSSNLELASAEVMKQGRWKIIATMLAVTWLNPHVYL------
ARGO_SALEP      QSPWLLALVTWGGVAFLLWYGLGALKTAMSSNLELASAEVMKQGRWKIIATMLAVTWLNPHVYL------


                         +         .         .         .         .         *         .:210
query           PQFVSATDPHVTGKLIFLGIWSIIVALPIGIGIVVTADILSAWLQRNRKVLRGLDYTIAGVFSLFAVKIF
Y4757_PSEAE     IQFV---DPGYASFLVLAVILELVSALYLSF-LIFTGVRLAAWFRRRQRLAAGATSGVGALFVGFGVKL-
RHTB_SHIFL      PQFIMPQQPQL-----------------------------------------------------------
RHTB_ECOLI      PQFIMPQQPQL-----------------------------------------------------------
RHTB_ECOL6      PQFIMPQQPQL-----------------------------------------------------------
RHTB_ECO57      PQFIMPQQPQL-----------------------------------------------------------
LEUE_SHIDS      VQFIDVNAPHTGISFFILATTLELVSFCYLSFLIISGAFVTQYIRTKKKLAKVGNSLIGLMFVGFAARLA
LEUE_ECOUT      VQFIDVNAPHTGISFFILATTLELVSFCYLSFLIISGAFVTQYIRTKKKLAKVGNSLIGLMFVGFAARLA
LEUE_ECOLI      VQFIDVNAPHTGISFFILAATLELVSFCYLSFLIISGAFVTQYIRTKKKLAKVGNSLIGLMFVGFAARLA
LEUE_ECOL6      VQFIDVNAPHTGISFFILATTLELVSFCYLSFLIISGAFVTQYIRTKKKLAKVGNSLIGLMFVGFAARLA
LEUE_ECOL5      VQFIDVNAPHTGISFFILATTLELVSFCYLSFLIISGAFVTQYIRTKKKLAKVGNSLIGLMFVGFAARLA
LEUE_ECOK1      VQFIDVNAPHTGISFFILATTLELVSFCYLSFLIISGAFVTQYIRTKKKLAKVGNSLIGLMFVGFAARLA
LEUE_ECOHS      VQFIDVNAPHTGISFFILAATLELVSFCYLSFLIISGAFVTQYIRTKKKLAKVGNSLIGLMFVGFAARLA
LEUE_SHISS      VQFIDVNAPHTGISFFILATTLELVSFCYLSFLIISGAFVTQYIRTKKKLAKVGNSLIGLMFVGFAARLA
LEUE_ECO24      VQFIDVNAPHTGISFFILATTLELVSFCYLSFLIISGAFVTQYIRTKKKLAKVGNSLIGLMFVGFAARLA
LEUE_SHIBS      VQFIDVNAPHTGISFFILATTLELVSFCYLSFLIISGAFVTQYIRTKKKLAKVGNSLIGLMFVGFAARLA
LEUE_ECO57      VQFIDVNAPHTGISFFILATTLELVSFCYLSFLIISGAFVTQYIRTKKKLAKVGNSLIGLMFVGFAARLA
LEUE_KLEP7      VQFIDVNAKTPGVAFFILALTLEVISFCYMSFLILSGSFVTRYVKTRKKLAKLGNSLIGLVFVGFAARLA
YRHP_BACSU      P---------------------------------------------------------------------
RHTB_SALTY      PQFIMPQQPQLAQYLI-LGXXXXXXXXXXXXGYATLAQRIAAWI-KGPKQMKALNKAFGSLFML------
RHTB_SALTI      PQFIMPQQPQLAQYLI-LGXXXXXXXXXXXXGYATLAQRIAAWI-KGPKQMKALNKAFGSLFML------
LEUE_CITK8      VQFIDVNAPHAGLSFFILATTLEVVSFFYLSFLIISGAFVTQYIRTKKKLAKVGNSLIGLIFVGFAARLA
LEUE_SALTY      VQFIDVTAPHTGVSFFILATTLEIVSFCYLSFLILSGAFVTHYIGTKKKLAKVGNSLIGLLFVGFAARLA
LEUE_SALTI      VQFIDVTAPHTGVSFFILATTLEIVSFCYLSFLILSGAFVTHYIGTKKKLAKVGNSLIGLLFVGFAARLA
LEUE_SALPA      VQFIDVTAPHTGVSFFILATTLEIVSFCYLSFLILSGAFVTHYIGTKKKLAKVGNSLIGLLFVGFAARLA
LEUE_SALCH      VQFIDVTAPHTGVSFFILATTLEIVSFCYLSFLILSGAFVTHYIGTKKKLAKVGNSLIGLLFVGFAARLA
Y1307_HAEIN     SVLVNITE-----------MWQIILAFAV-----------------------------------------
Y1627_SYNY3     PTFVDVNN------IAYLDIAVIILTAILTVG--------------------------------------
RHTC_SALTY      SLFV------------------------------------------------------------------
RHTC_SALTI      SLFV------------------------------------------------------------------
LEUE_ENT38      VQFIDVSATNTGTSFLILATTLELISFMYMSFLIFSGAFVTRYLKTKKKLAKLGNGLIGLLFVGFAARL-
EAMB_SHISS      STFVL---PQTQALSWVVGV-SVLLAMIGTFGNVCWALAGHLFQRLFRQYGRQLNIVLALLLVYCAVRIF
EAMB_SHIFL      STFVL---PQTQALSWVVGV-SVLLAMIGTFGNVCWALAGHLFQRLFRQYGRQLNIVLALLLVYCAVRIF
EAMB_SHIF8      STFVL---PQTQALSWVVGV-SVLLAMIGTFGNVCWALAGHLFQRLFRQYGRQLNIVLALLLVYCAVRIF
EAMB_ECOUT      STFVL---PQTQALSWVVGV-SVLLAMIGTFGNVCWALAGHLFQRLFRQYGRQLNIVLALLLVYCAVRIF
EAMB_ECOLI      STFVL---PQTQALSWVVGV-SVLLAMIGTFGNVCWALAGHLFQRLFRQYGRQLNIVLALLLVYCAVRIF
EAMB_ECOL6      STFVL---PQTQALSWVVGV-SVLLAMIGTFGNVCWALAGHLFQRLFRQYGRQLNIVLALLLVYCAVRIF
EAMB_ECOL5      STFVL---PQTQALSWVVGV-SVLLAMIGTFGNVCWALAGHLFQRLFRQYGRQLNIVLALLLVYCAVRIF
EAMB_ECOK1      STFVL---PQTQALSWVVGV-SVLLAMIGTFGNVCWALAGHLFQRLFRQYGRQLNIVLALLLVYCAVRIF
EAMB_ECOHS      STFVL---PQTQALSWVVGV-SVLLAMIGTFGNVCWALAGHLFQRLFRQYGRQLNIVLALLLVYCAVRIF
EAMB_ECO57      STFVL---PQTQALSWIVGV-SVLLAMIGTFGNVCWALAGHLFQRLFRQYGRQLNIVLALLLIYCAVRIF
EAMB_ECO24      STFVL---PQTQALSWVVGV-SVLLAMIGTFGNVCWALAGHLFQRLFRQYGRQLNIVLALLLIYCAVRIF
EAMB_SALTY      STFVL---PQTQALNWVIGV-SILLALIGTFGNVCWALAGHLFQRAFRHYGRQLNIILALLLVYCAVRIF
EAMB_SALTI      STFVL---PQTQALNWVIGV-SILLALIGTFGNVCWALAGHLFQRAFRHYGRQLNIILALLLVYCAVRIF
EAMB_SALPA      STFVL---PQTQALNWVIGV-SILLALIGTFGNVCWALAGHLFQRAFRHYGRQLNIILALLLVYCAVRIF
EAMB_SALCH      STFVL---PQTQALNWVIGV-SILLALIGTFGNVCWALAGHLFQRAFRHYGRQLNIILALLLVYCAVRIF
YAHN_ECOLI      SVTLNAETPTWARLMAWAG---IVLASIIWRVFLSQAFSLPAVRRAYGRMQRVASRVIGAIIGVFALRLI
YGGA_AERHY      GSFGSQFAEELRSAFAAV---AMLASLVWFYSLAFGAVVLSPWLARSRQ---------------------
EAMB_SHIBS      STFVL---PQTQALSWVVGV-SVLLAMIGTFGNVCWALAGHLFQRLFRQYGRQLNIVLALLLVYCAVRIF
RHTC_ECOLI      SLFVGDN----VGTTARWGIFALII---------------------------------------------
RHTC_ECO57      SLFVGDN----VGTTARWGIFALII---------------------------------------------
YGGA_AERSA      SQFAEPLRPFAAGAMLASLVWFYSLAF--------GAAALSPWLARGR-VQQAID-TIVGL---------
EAMB_KLEP7      STFV------------------------------------------------------------------
ARGO_KLEP3      ----------------------------------------------------------------------
Y498_MYCBO      ----------------------------------------------------------------------
Y488_MYCTU      ----------------------------------------------------------------------
LYSE_CORGL      ----------------------------------------------------------------------
ARGO_ENT38      ----------------------------------------------------------------------
ARGO_SALG2      ----------------------------------------------------------------------
ARGO_SALEP      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           FTQTx
Y4757_PSEAE     -----
RHTB_SHIFL      -----
RHTB_ECOLI      -----
RHTB_ECOL6      -----
RHTB_ECO57      -----
LEUE_SHIDS      TLQS-
LEUE_ECOUT      TLQS-
LEUE_ECOLI      TLQS-
LEUE_ECOL6      TLQS-
LEUE_ECOL5      TLQS-
LEUE_ECOK1      TLQS-
LEUE_ECOHS      TLQS-
LEUE_SHISS      TLQS-
LEUE_ECO24      TLQS-
LEUE_SHIBS      TLQS-
LEUE_ECO57      TLQS-
LEUE_KLEP7      TLQS-
YRHP_BACSU      -----
RHTB_SALTY      -----
RHTB_SALTI      -----
LEUE_CITK8      TLQS-
LEUE_SALTY      TLQS-
LEUE_SALTI      TLQS-
LEUE_SALPA      TLQS-
LEUE_SALCH      TLQS-
Y1307_HAEIN     -----
Y1627_SYNY3     -----
RHTC_SALTY      -----
RHTC_SALTI      -----
LEUE_ENT38      -----
EAMB_SHISS      Y----
EAMB_SHIFL      Y----
EAMB_SHIF8      Y----
EAMB_ECOUT      Y----
EAMB_ECOLI      Y----
EAMB_ECOL6      Y----
EAMB_ECOL5      Y----
EAMB_ECOK1      Y----
EAMB_ECOHS      Y----
EAMB_ECO57      Y----
EAMB_ECO24      Y----
EAMB_SALTY      Y----
EAMB_SALTI      Y----
EAMB_SALPA      Y----
EAMB_SALCH      Y----
YAHN_ECOLI      Y----
YGGA_AERHY      -----
EAMB_SHIBS      Y----
RHTC_ECOLI      -----
RHTC_ECO57      -----
YGGA_AERSA      -----
EAMB_KLEP7      -----
ARGO_KLEP3      -----
Y498_MYCBO      -----
Y488_MYCTU      -----
LYSE_CORGL      -----
ARGO_ENT38      -----
ARGO_SALG2      -----
ARGO_SALEP      -----